RPSBLAST alignment for GI: 254780371 and conserved domain: cd00635

>gnl|CDD|143483 cd00635, PLPDE_III_YBL036c_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, YBL036c-like proteins. This family contains mostly uncharacterized proteins, widely distributed among eukaryotes, bacteria and archaea, that bear similarity to the yeast hypothetical protein YBL036c, which is homologous to a Pseudomonas aeruginosa gene that is co-transcribed with a known proline biosynthetic gene. YBL036c is a single domain monomeric protein with a typical TIM barrel fold. It binds the PLP cofactor and has been shown to exhibit amino acid racemase activity. The YBL036c structure is similar to the N-terminal domain of the fold type III PLP-dependent enzymes, bacterial alanine racemase and eukaryotic ornithine decarboxylase, which are two-domain dimeric proteins. The lack of a second domain in YBL036c may explain limited D- to L-alanine racemase or non-specific racemase activity. Length = 222
 Score = 48.6 bits (117), Expect = 3e-06
 Identities = 27/105 (25%), Positives = 46/105 (43%), Gaps = 13/105 (12%)

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           V+S    + LN+RA   G+   +  +VN             G +E K G+   ++  L  
Sbjct: 97  VDSLKLAEELNKRAEKEGRVLDVLVQVN------------IGGEESKSGVAPEELEELLE 144

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNG 228
             + LP ++I G+ M I    +  E     F+ LR+L  +L + G
Sbjct: 145 EIAALPNLRIRGL-MTIAPLTEDPEEVRPYFRELRELRDELGAKG 188