RPSBLAST alignment for GI: 254780371 and conserved domain: cd06808

>gnl|CDD|143484 cd06808, PLPDE_III, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes. The fold type III PLP-dependent enzyme family is predominantly composed of two-domain proteins with similarity to bacterial alanine racemases (AR) including eukaryotic ornithine decarboxylases (ODC), prokaryotic diaminopimelate decarboxylases (DapDC), biosynthetic arginine decarboxylases (ADC), carboxynorspermidine decarboxylases (CANSDC), and similar proteins. AR-like proteins contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. These proteins play important roles in the biosynthesis of amino acids and polyamine. The family also includes the single-domain YBL036c-like proteins, which contain a single PLP-binding TIM-barrel domain without any N- or C-terminal extensions. Due to the lack of a second domain, these proteins may possess only limited D- to L-alanine racemase activity or non-specific racemase activity. Length = 211
 Score =  155 bits (395), Expect = 2e-38
 Identities = 68/241 (28%), Positives = 105/241 (43%), Gaps = 30/241 (12%)

Query: 37  IEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPA 96
           I  NY     A       +   +KAN+N  V +TLA LG+G D+ S GE     AA +P 
Sbjct: 1   IRHNYRRLREAA-PAGITLFAVVKANANPEVARTLAALGTGFDVASLGEALLLRAAGIPP 59

Query: 97  ERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINA 156
           E I+F G  K + E++ A + G+    V+S  EL+ L + A+  G  A +  R++     
Sbjct: 60  EPILFLGPCKQVSELEDAAEQGVIVVTVDSLEELEKLEEAALKAGPPARVLLRID----- 114

Query: 157 NTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKL 216
                  TG +  KFG+   ++ +L   A  LP +++ G+  H GS  +    F +A   
Sbjct: 115 -------TGDENGKFGVRPEELKALLERAKELPHLRLVGLHTHFGSADEDYSPFVEALSR 167

Query: 217 LRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPG 276
                 QL   G +++ + +GG   I Y     P                    II+EPG
Sbjct: 168 FVAALDQLGELGIDLEQLSIGGSFAILYLQ-ELPL----------------GTFIIVEPG 210

Query: 277 R 277
           R
Sbjct: 211 R 211