RPSBLAST alignment for GI: 254780371 and conserved domain: cd06841

>gnl|CDD|143508 cd06841, PLPDE_III_MccE_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme MccE. This subfamily is composed of uncharacterized proteins with similarity to Escherichia coli MccE, a hypothetical protein that is homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC). ODC and DapDC are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. DapDC participates in the last step of lysine biosynthesis, the conversion of meso-2,6-diaminoheptanedioate to L-lysine. Most members of this subfamily share the same domain architecture as ODC and DapDC. A few members, including Escherichia coli MccE, contain an additional acetyltransferase domain at the C-terminus. Length = 379
 Score =  171 bits (436), Expect = 3e-43
 Identities = 106/372 (28%), Positives = 173/372 (46%), Gaps = 35/372 (9%)

Query: 27  TPFYCYSTTAIEKNYLTFSNAFDGM--DTMVCYALKANSNQAVIKTLAHLGSGLDIVSEG 84
           +PF+ +   A+ +NY     AF     + ++ Y+ K N   A+ K L   G   ++VS  
Sbjct: 7   SPFFVFDEDALRENYRELLGAFKKRYPNVVIAYSYKTNYLPAICKILHEEGGYAEVVSAM 66

Query: 85  ELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKA 144
           E   AL   VP +RI+F+G  K+ +E++ AL+ G    N++S  EL+ + + A  LG+ A
Sbjct: 67  EYELALKLGVPGKRIIFNGPYKSKEELEKALEEGAL-INIDSFDELERILEIAKELGRVA 125

Query: 145 PIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAST---LPGVKISGVDMHIG 201
            +  R+N +                +FG  I +     A          + + G+  H+G
Sbjct: 126 KVGIRLNMNY---------GNNVWSRFGFDIEENGEALAALKKIQESKNLSLVGLHCHVG 176

Query: 202 SQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG------IAYHSDHRPPSSSD 255
           S I   E++  A K L +L  +L   G  ++++D+GGG        +AY  +   P   D
Sbjct: 177 SNILNPEAYSAAAKKLIELLDRLF--GLELEYLDLGGGFPAKTPLSLAYPQEDTVPDPED 234

Query: 256 YASLIHQ----YFGNL--QCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
           YA  I      Y+ N   + K+ILEPGR LV D G L+ +V+++K    +   + D  +N
Sbjct: 235 YAEAIASTLKEYYANKENKPKLILEPGRALVDDAGYLLGRVVAVKNRYGRNIAVTDAGIN 294

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP--RPGDLLY 367
           +   PT++  +H I  +     D    + D+ G  C   D +  N  + LP    GD+L 
Sbjct: 295 NI--PTIFWYHHPILVLRPGKEDPTSKNYDVYGFNCMESDVLFPN--VPLPPLNVGDILA 350

Query: 368 IEKTGAYGAVQS 379
           I   GAY   QS
Sbjct: 351 IRNVGAYNMTQS 362