RPSBLAST alignment for GI: 254780371 and conserved domain: cd06842

>gnl|CDD|143509 cd06842, PLPDE_III_Y4yA_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Y4yA. This subfamily is composed of the hypothetical Rhizobium sp. protein Y4yA and similar uncharacterized bacterial proteins. These proteins are homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC). ODC and DapDC are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. DapDC participates in the last step of lysine biosynthesis, the conversion of meso-2,6-diaminoheptanedioate to L-lysine. Proteins in this subfamily may function as PLP-dependent decarboxylases. Length = 423
 Score =  139 bits (353), Expect = 1e-33
 Identities = 104/423 (24%), Positives = 165/423 (39%), Gaps = 89/423 (21%)

Query: 21  LAHVVQ---TPFYCYSTTAIEKNYLTFSNAFD--GMDTMVCYALKANSNQAVIKTLAHLG 75
           L  +V+   +P          +N        D  G+D  V +A KAN + A+++  A  G
Sbjct: 1   LVALVEAYGSPLNVLFPQTFRENIAALRAVLDRHGVDGRVYFARKANKSLALVRAAAAAG 60

Query: 76  SGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQ 135
            G+D+ S  ELR+ALAA V  +RIV +G  KT + + LA++ G     V+S  EL  L  
Sbjct: 61  IGVDVASLAELRQALAAGVRGDRIVATGPAKTDEFLWLAVRHGA-TIAVDSLDELDRLLA 119

Query: 136 RA-VSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQI-HSLYAYASTLPGVKI 193
            A       A +  R++P          S      +FG+P  ++  +L   A     V++
Sbjct: 120 LARGYTTGPARVLLRLSPF----PASLPS------RFGMPAAEVRTALERLAQLRERVRL 169

Query: 194 SGVDMHIG--SQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSD---- 247
            G   H+   S   ++ +  +   L+     + R+ G   + ID+GGG  ++Y +D    
Sbjct: 170 VGFHFHLDGYSAAQRVAALQECLPLID----RARALGLAPRFIDIGGGFPVSYLADAAEW 225

Query: 248 ------------------------------------HRPPSSSDY--ASLIHQYFGN--- 266
                                                +P  ++D+  A L          
Sbjct: 226 EAFLAALTEALYGYGRPLTWRNEGGTLRGPDDFYPYGQPLVAADWLRAILSAPLPQGRTI 285

Query: 267 ----LQCKIIL--EPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAY 320
                   I L  EPGR L+   G+ V +V  +K+  D   +I  +  N F   +  +  
Sbjct: 286 AERLRDNGITLALEPGRALLDQCGLTVARVAFVKQLGDGNHLIG-LEGNSF---SACEFS 341

Query: 321 HE--INYIVNPAGDRLHIHADI----VGPICETGDFIALNRKIALPR---PGDLLYIEKT 371
            E  ++ ++ PA +     A I     G  C   D I   RKI  PR   PGDLL    T
Sbjct: 342 SEFLVDPLLIPAPEPTTDGAPIEAYLAGASCLESDLI-TRRKIPFPRLPKPGDLLVFPNT 400

Query: 372 GAY 374
             Y
Sbjct: 401 AGY 403