RPSBLAST alignment for GI: 254780371 and conserved domain: PLN02537

>gnl|CDD|178152 PLN02537, PLN02537, diaminopimelate decarboxylase. Length = 410
 Score =  270 bits (692), Expect = 5e-73
 Identities = 132/403 (32%), Positives = 220/403 (54%), Gaps = 5/403 (1%)

Query: 11  LHAENVSLEK-LAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           L+ E + ++  +  V + PFY YS   I +NY  +  A +G+ +++ YA+KAN+N  +++
Sbjct: 1   LYCEGLRVQDIMESVEKRPFYLYSKPQITRNYEAYKEALEGLRSIIGYAIKANNNLKILE 60

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
            L  LG G  +VS  ELR AL A     R +F+G GK ++++ LA Q G++  NV+SE +
Sbjct: 61  HLRELGCGAVLVSGNELRLALRAGFDPTRCIFNGNGKLLEDLVLAAQEGVF-VNVDSEFD 119

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           L+ + + A   GKK  +  R+NPD++   H  ++TG K  KFGI   ++          P
Sbjct: 120 LENIVEAARIAGKKVNVLLRINPDVDPQVHPYVATGNKNSKFGIRNEKLQWFLDAVKAHP 179

Query: 190 G-VKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAY-HSD 247
             +K+ G   H+GS I +++ F  A  L+ +   ++R+ G  + ++++GGGLGI Y H+ 
Sbjct: 180 NELKLVGAHCHLGSTITKVDIFRDAAVLMVNYVDEIRAQGFELSYLNIGGGLGIDYYHAG 239

Query: 248 HRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVA 307
              P+  D    + +   +    +I+EPGR L+A+    V +V  +K +  K F+++D +
Sbjct: 240 AVLPTPRDLIDTVRELVLSRDLTLIIEPGRSLIANTCCFVNRVTGVKTNGTKNFIVIDGS 299

Query: 308 MNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLY 367
           M + +RP+LYDAY  I  +  P  D      D+VGP+CE+ DF+  +R++  P  G  L 
Sbjct: 300 MAELIRPSLYDAYQHIELVSPPPPDAEVSTFDVVGPVCESADFLGKDRELPTPPKGAGLV 359

Query: 368 IEKTGAYGAVQSGTYNSRLLIPEIMV-NGSQFHIIRPRMTFQE 409
           +   GAY    + TYN ++  PE  V        IR   TF +
Sbjct: 360 VHDAGAYCMSMASTYNLKMRPPEYWVEEDGSITKIRHAETFDD 402