RPSBLAST alignment for GI: 254780371 and conserved domain: KOG0622

>gnl|CDD|35841 KOG0622, KOG0622, KOG0622, Ornithine decarboxylase [Amino acid transport and metabolism]. Length = 448
 Score =  185 bits (470), Expect = 3e-47
 Identities = 96/370 (25%), Positives = 154/370 (41%), Gaps = 27/370 (7%)

Query: 28  PFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELR 87
            F+     AIE+    +  A   +     YA+K NS+  V++ LA LG G D  S+ EL 
Sbjct: 57  AFFVADLGAIERKLEAWKKALPRVRPF--YAVKCNSDPKVLRLLASLGCGFDCASKNELD 114

Query: 88  RALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIA 147
             L+  V  ERI+++   K + +I  A + G+     ++E EL+ + +        A + 
Sbjct: 115 LVLSLGVSPERIIYANPCKQVSQIKYAAKHGVSVMTFDNEEELEKVAK----SHPNANLL 170

Query: 148 FRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQI 207
            R+  D +       +T +   KFG  +     L   A  L  + + GV  H+GS    +
Sbjct: 171 LRIATDDS------TATCRLNLKFGCSLDNCRHLLDMAKEL-ELNVVGVSFHVGSGCTDL 223

Query: 208 ESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSD-YASLIHQYFGN 266
           +++  A    R++       G  +  +D+GGG              +D   + +  YF +
Sbjct: 224 QAYRDAISDARNVFDMGAELGFEMDILDIGGGFPGDEGHAVVFEEIADVINTALDLYFPS 283

Query: 267 LQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVA--------MND----FMRP 314
               II EPGRF VA    L   VI+ K+   K     D          +ND        
Sbjct: 284 GGVDIIAEPGRFFVASAFTLAVNVIAKKEVDAKKITSDDEDDEVTFMYYVNDGVYGSFNC 343

Query: 315 TLYDAYHEINYIV-NPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGA 373
            L+D  H I  +V +P+ +     + I GP C+  D IA +  +     GD L  E  GA
Sbjct: 344 ILFDHQHPIPLVVKDPSEEEPLYKSSIWGPTCDGLDVIAEDCLLPQLNVGDWLVFENMGA 403

Query: 374 YGAVQSGTYN 383
           Y    + T+N
Sbjct: 404 YTMSAASTFN 413