RPSBLAST alignment of GI: 254780371 and protein with PDBid: 2nva

>2nva_A Arginine decarboxylase, A207R protein; PLP, TIM barrel, eukaryotic ODC- like, lyase; HET: PL2; 1.80A {Paramecium bursaria chlorella virus 1} PDB: 2nv9_A* Length = 372
 Score =  217 bits (552), Expect = 5e-57
 Identities = 78/379 (20%), Positives = 146/379 (38%), Gaps = 15/379 (3%)

Query: 17  SLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGS 76
           ++ K        FY  S   +E     ++  F  +     YA+K N+++ ++KT+     
Sbjct: 7   NILKAHPHQTKSFYVSSPKIVEDLIDQWTILFPRVT--PHYAVKCNNDEVLLKTMCDKNV 64

Query: 77  GLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQR 136
             D  S  E+++ +   V   RI+F+   KTID++  A   G+     +S  EL  ++  
Sbjct: 65  NFDCASSSEIKKVIQIGVSPSRIIFAHTMKTIDDLIFAKDQGVDIATFDSSFELDKIHT- 123

Query: 137 AVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGV 196
                            +        +T +  +KFG    +I  L  YA     +++ G+
Sbjct: 124 ---------YHPNCKMILRIRCDDPNATVQLGNKFGANEDEIRHLLEYAKQ-LDIEVIGI 173

Query: 197 DMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPS-SSD 255
             H+GS     E++++A K  ++   +  S GH    +D+GGGL             S  
Sbjct: 174 SFHVGSGSRNPEAYYRAIKSSKEAFNEAISVGHKPYILDIGGGLHADIDEGELSTYMSDY 233

Query: 256 YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPT 315
               I  +F      I+ EPGRF      +L T+VI  +          + +        
Sbjct: 234 INDAIKDFFPEDTVTIVAEPGRFFAEHYSVLATQVIGKRVRDGLYEYFFNESTYGGFSNV 293

Query: 316 LYDAYHEINYIV-NPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAY 374
           +++       ++ +   D  ++ + + G  C+  D I  N  +     GD +Y    GAY
Sbjct: 294 IFEKSVPTPQLLRDVPDDEEYVPSVLYGCTCDGVDVINHNVALPELHIGDWVYFPSWGAY 353

Query: 375 GAVQSGTYNSRLLIPEIMV 393
             V + ++N         +
Sbjct: 354 TNVLTTSFNGFGEYDVYYI 372