RPSBLAST alignment of GI: 254780371 and protein with PDBid: 2p3e

>2p3e_A Diaminopimelate decarboxylase; southeast collaboratory for structural genomics, riken spring-8 center, riken genomic sciences center; 1.99A {Aquifex aeolicus VF5} Length = 420
 Score =  307 bits (786), Expect = 4e-84
 Identities = 176/411 (42%), Positives = 250/411 (60%), Gaps = 4/411 (0%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
            +Y +G L  E VSL++LA    TP Y YS+  I++ +  +  AF     ++CYA+KAN 
Sbjct: 11  LEYRDGELFIEGVSLKELAQTFGTPLYVYSSNFIKERFEAYRKAFPD--ALICYAVKANF 68

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N  ++K L  LG+G DIVS GEL  A  A +P ERIV++GVGKT  E+  A+ S I  FN
Sbjct: 69  NPHLVKLLGELGAGADIVSGGELYLAKKAGIPPERIVYAGVGKTEKELTDAVDSEILMFN 128

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VES  EL  LN+ A  LGKKA IA RVNPD++  TH  I+TG ++ KFG+ I +    Y 
Sbjct: 129 VESRQELDVLNEIAGKLGKKARIAIRVNPDVDPKTHPYIATGMQKSKFGVDIREAQKEYE 188

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
           YAS L  ++I G+  HIGSQI  I  + +A + +  L + L   G +I+++D+GGGLGI 
Sbjct: 189 YASKLENLEIVGIHCHIGSQILDISPYREAVEKVVSLYESLTQKGFDIKYLDIGGGLGIK 248

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVI 303
           Y  + + P+  D A L+     N++ KIILEPGR ++ + GIL+T+V  +K    K F+I
Sbjct: 249 YKPEDKEPAPQDLADLLKDLLENVKAKIILEPGRSIMGNAGILITQVQFLKDKGSKHFII 308

Query: 304 LDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPG 363
           +D  MND +RP++Y+AYH I  +      +  + ADIVGPICETGDF+AL+R+I   + G
Sbjct: 309 VDAGMNDLIRPSIYNAYHHIIPVETKERKK--VVADIVGPICETGDFLALDREIEEVQRG 366

Query: 364 DLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
           + L +   GAYG   S  YN R    E++V      +IR R  +  ++E  
Sbjct: 367 EYLAVLSAGAYGFAMSSHYNMRPRAAEVLVENGSVKLIRKRENYDYIVEPS 417