RPSBLAST alignment of GI: 254780371 and protein with PDBid: 2yxx

>2yxx_A Diaminopimelate decarboxylase; TM1517, TIM beta/alpha barrel fold, lyase, structural genomics, NPPSFA; HET: PLP; 1.70A {Thermotoga maritima MSB8} Length = 386
 Score =  251 bits (642), Expect = 2e-67
 Identities = 131/396 (33%), Positives = 216/396 (54%), Gaps = 18/396 (4%)

Query: 18  LEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSG 77
           L K+A +  TP Y Y    + K        F+G++ +  +A+KAN+N  ++K L   G G
Sbjct: 4   LRKVAEIHGTPTYVYFEETLRKRSRLVKEVFEGVNLLPTFAVKANNNPVLLKILREEGFG 63

Query: 78  LDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRA 137
           +D+V++GEL  A  A VP+  +V++G GK+ D+++  L+  +   NV+S  E++   +  
Sbjct: 64  MDVVTKGELLAAKLAGVPSHTVVWNGNGKSRDQMEHFLREDVRIVNVDSFEEMEIWRELN 123

Query: 138 VSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVD 197
               +      RVNP+++A TH  ISTG K+ KFGIP+  + S          + I G+ 
Sbjct: 124 P---EGVEYFIRVNPEVDAKTHPHISTGLKKHKFGIPLEDLDSFMERF---RSMNIRGLH 177

Query: 198 MHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYA 257
           +HIGSQI ++E F +AF  +   +++     +  + I++GGG GI Y  +    SS    
Sbjct: 178 VHIGSQITRVEPFVEAFSKVVRASER-----YGFEEINIGGGWGINYSGEELDLSSYREK 232

Query: 258 SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLY 317
            +          ++I+E GR++VA  G L+ +V+ +K+  +K FV++D  MN  +RP LY
Sbjct: 233 VVPDLKR---FKRVIVEIGRYIVAPSGYLLLRVVLVKRRHNKAFVVVDGGMNVLIRPALY 289

Query: 318 DAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAV 377
            AYH I  +         + AD+VGP+CE+GD IA +R++    PGD++ +E  GAYG  
Sbjct: 290 SAYHRIFVLGKQGK---EMRADVVGPLCESGDVIAYDRELPEVEPGDIIAVENAGAYGYT 346

Query: 378 QSGTYNSRLLIPEIMVN-GSQFHIIRPRMTFQELIE 412
            S  YNS     E++V    +  +IR R T  ++ +
Sbjct: 347 MSNNYNSTTRPAEVLVRENGRISLIRRRETEMDIFK 382