RPSBLAST alignment of GI: 254780371 and protein with PDBid: 3n2b

>3n2b_A Diaminopimelate decarboxylase; LYSA, lyase, structural genom center for structural genomics of infectious diseases, CSGI; 1.80A {Vibrio cholerae} Length = 441
 Score =  402 bits (1035), Expect = e-113
 Identities = 182/418 (43%), Positives = 255/418 (61%), Gaps = 4/418 (0%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y E G L AE V L  LA+   TP Y YS   +E+++  F  +      ++CYA+
Sbjct: 25  MDYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAV 84

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  ALQ  I
Sbjct: 85  KANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKI 144

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 145 KCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAA 204

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP + + G+D HIGSQ+  +  F  A   L  L   L++ G +I+H+DVGGG
Sbjct: 205 QVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGG 264

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           LG+ Y  +  P  S    +L+ +   +   ++I EPGR + A+ G+LVTKV  +K +  K
Sbjct: 265 LGVVYRDELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEHK 324

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D AMND +RP LY A+ +I  +    G+      D+VGP+CET DF+  +R + L
Sbjct: 325 NFAIIDAAMNDLIRPALYQAWQDIIPLRPRQGEA--QTYDLVGPVCETSDFLGKDRDLVL 382

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIP 417
            + GDLL +  +GAYG   S  YN+R  + E+MV+G++ +++R R     L  L+S+ 
Sbjct: 383 -QEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESVL 439