RPSBLAST alignment of GI: 254780371 and protein with PDBid: 7odc

>7odc_A Protein (ornithine decarboxylase); pyridoxal-5'-phosphate, PLP, group IV decarboxylase, polyamines, parasitical, chemotherapy target, putrescine; HET: PLP; 1.60A {Mus musculus} SCOP: b.49.2.3 c.1.6.1 PDB: 2on3_A 1d7k_A* Length = 424
 Score =  249 bits (637), Expect = 7e-67
 Identities = 89/426 (20%), Positives = 163/426 (38%), Gaps = 35/426 (8%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQ----TPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
               +    A+++  +K+  V        FY      I K +L +  A   +     YA+
Sbjct: 11  CHILDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVT--PFYAV 68

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           K N ++A++ TLA +G+G D  S+ E++      VPAER++++   K + +I  A  +G+
Sbjct: 69  KCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQIKYAASNGV 128

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
                +SE EL           K A    +    +   T    +  +   KFG  +    
Sbjct: 129 QMMTFDSEIELM----------KVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSR 178

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            L    +    + + GV  H+GS     ++F +A    R +       G ++  +D+GGG
Sbjct: 179 -LLLERAKELNIDVIGVSFHVGSGCTDPDTFVQAVSDARCVFDMATEVGFSMHLLDIGGG 237

Query: 240 LGIAYHSDHRPP--SSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSA 297
              +  +  +    +S    +L   +  +   +II EPGR+ VA    L   +I+ K   
Sbjct: 238 FPGSEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVW 297

Query: 298 DKT--------------FVILDVAMNDFMRPTLYDAYHEINYIVN-PAGDRLHIHADIVG 342
            +                  ++  +       LYD  H    +   P  D  +  + I G
Sbjct: 298 KEQPGSDDEDESNEQTFMYYVNDGVYGSFNCILYDHAHVKALLQKRPKPDEKYYSSSIWG 357

Query: 343 PICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMV-NGSQFHII 401
           P C+  D I     +     GD +  E  GAY    + T+N         V +   + ++
Sbjct: 358 PTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRPMWQLM 417

Query: 402 RPRMTF 407
           +   + 
Sbjct: 418 KQIQSH 423