RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780371|ref|YP_003064784.1| diaminopimelate decarboxylase
protein [Candidatus Liberibacter asiaticus str. psy62]
         (431 letters)



>3n2b_A Diaminopimelate decarboxylase; LYSA, lyase, structural genom center
           for structural genomics of infectious diseases, CSGI;
           1.80A {Vibrio cholerae}
          Length = 441

 Score =  402 bits (1035), Expect = e-113
 Identities = 182/418 (43%), Positives = 255/418 (61%), Gaps = 4/418 (0%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y E G L AE V L  LA+   TP Y YS   +E+++  F  +      ++CYA+
Sbjct: 25  MDYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAV 84

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  ALQ  I
Sbjct: 85  KANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKI 144

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 145 KCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAA 204

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP + + G+D HIGSQ+  +  F  A   L  L   L++ G +I+H+DVGGG
Sbjct: 205 QVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGG 264

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           LG+ Y  +  P  S    +L+ +   +   ++I EPGR + A+ G+LVTKV  +K +  K
Sbjct: 265 LGVVYRDELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEHK 324

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D AMND +RP LY A+ +I  +    G+      D+VGP+CET DF+  +R + L
Sbjct: 325 NFAIIDAAMNDLIRPALYQAWQDIIPLRPRQGEA--QTYDLVGPVCETSDFLGKDRDLVL 382

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIP 417
            + GDLL +  +GAYG   S  YN+R  + E+MV+G++ +++R R     L  L+S+ 
Sbjct: 383 -QEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESVL 439


>1f3t_A ODC, ornithine decarboxylase; beta-alpha-barrel, modified greek KEY
           beta-sheet, lyase; HET: PLP; 2.00A {Trypanosoma brucei}
           SCOP: b.49.2.3 c.1.6.1 PDB: 1qu4_A* 1szr_C* 2tod_A*
           1njj_A*
          Length = 425

 Score =  320 bits (820), Expect = 5e-88
 Identities = 92/429 (21%), Positives = 167/429 (38%), Gaps = 41/429 (9%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQ---TPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
            ++ EG  +  +   +K++        PF+      I + + T+      +     YA+K
Sbjct: 13  CRFLEG-FNTRDALCKKISMNTCDEGDPFFVADLGDIVRKHETWKKCLPRVT--PFYAVK 69

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
            N +  V+ TLA LG+G D  S  E++R     VP E+I+++   K I  I  A  SG+ 
Sbjct: 70  CNDDWRVLGTLAALGTGFDCASNTEIQRVRGIGVPPEKIIYANPCKQISHIRYARDSGVD 129

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
               +   EL+ + +       KA +  R++          ++  +   KFG  +     
Sbjct: 130 VMTFDCVDELEKVAK----THPKAKMVLRIST------DDSLARCRLSVKFGAKVEDCRF 179

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +   A  L  + ++GV  H+GS      +F +A    R +       G N+  +D+GGG 
Sbjct: 180 ILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVFDMGTELGFNMHILDIGGGF 238

Query: 241 GIAYHSDHRPPSSSDYASLIHQYF-----GNLQCKIILEPGRFLVADVGILVTKVISIKK 295
                +   P    + A +I+         +L+  I+ EPGR+ VA    L   VI+ K 
Sbjct: 239 PGTRDA---PLKFEEIAGVINNALEKHFPPDLKLTIVAEPGRYYVASAFTLAVNVIAKKV 295

Query: 296 SADKTFVI--------------LDVAMNDFMRPTLYDAYHEINYIV-NPAGDRLHIHADI 340
           +      +              ++  +       LYD           P  +     + +
Sbjct: 296 TPGVQTDVGAHAESNAQSFMYYVNDGVYGSFNCILYDHAVVRPLPQREPIPNEKLYPSSV 355

Query: 341 VGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEI-MVNGSQFH 399
            GP C+  D I     +   + G+ L  E  GAY  V + ++N         +V+G   H
Sbjct: 356 WGPTCDGLDQIVERYYLPEMQVGEWLLFEDMGAYTVVGTSSFNGFQSPTIYYVVSGLPDH 415

Query: 400 IIRPRMTFQ 408
           ++R   + +
Sbjct: 416 VVRELKSQK 424


>3n29_A Carboxynorspermidine decarboxylase; lyase; HET: PLP; 1.90A
           {Campylobacter jejuni subsp}
          Length = 418

 Score =  316 bits (812), Expect = 4e-87
 Identities = 60/415 (14%), Positives = 129/415 (31%), Gaps = 35/415 (8%)

Query: 1   MSAFKYFEGSLH---AENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCY 57
           M+  +     L+    ++         +QTP Y      + KN    ++  +     V  
Sbjct: 15  MTGGQQMGRDLYDDDDKDHPFTMFYEKIQTPAYILEEDKLRKNCELLASVGEKSGAKVLL 74

Query: 58  ALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQS 117
           ALK  +    +K +     G       E +   A     + I         DEI      
Sbjct: 75  ALKGFAFSGAMKIVGEYLKGCTCSGLWEAK--FAKEYMDKEIHTYSPAFKEDEIGEIASL 132

Query: 118 GIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQ 177
             +     S ++      +     +K  +  R N + +    +  +   +  + GI    
Sbjct: 133 SHH-IVFNSLAQFHKFQSK----TQKNSLGLRCNVEFSLAPKELYNPCGRYSRLGIRAKD 187

Query: 178 IHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVG 237
             ++   A       I G+  H   +    ++     K+  +           ++ ++ G
Sbjct: 188 FENVDLNA-------IEGLHFHALCEES-ADALEAVLKVFEEK---FGKWIGQMKWVNFG 236

Query: 238 GGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSA 297
           GG  I      +        +L   +      ++ LEPG  +    G LV  V+ I ++ 
Sbjct: 237 GGHHITK----KGYDVEKLIALCKNFSDKYGVQVYLEPGEAVGWQTGNLVASVVDIIENE 292

Query: 298 DKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHA---------DIVGPICETG 348
            +  ++   +        +     E+      A       +          + G  C  G
Sbjct: 293 KQIAILDTSSEAHMPDTIIMPYTSEVLNARILATRENEKISDLKENEFAYLLTGNTCLAG 352

Query: 349 DFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVN-GSQFHIIR 402
           D +         + GD +       Y  V++ T+N   L   ++++  ++  +IR
Sbjct: 353 DVMGEYAFDKKLKIGDKIVFLDQIHYTIVKNTTFNGIRLPNLMLLDHKNELQMIR 407


>1knw_A Diaminopimelate decarboxylase; pyridoxal-phosphate,
           decarboxylation, lysine, TIM-barrel, lyase; HET: PLP
           MES; 2.10A {Escherichia coli} SCOP: b.49.2.3 c.1.6.1
           PDB: 1ko0_A*
          Length = 425

 Score =  309 bits (793), Expect = 6e-85
 Identities = 125/433 (28%), Positives = 193/433 (44%), Gaps = 37/433 (8%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
               +  L AEN  L +L      P + Y    I +              +V +A KA S
Sbjct: 5   LFSTDTDLTAEN--LLRLPAEFGCPVWVYDAQIIRRQIAALKQFD-----VVRFAQKACS 57

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVP----AERIVFSGVGKTIDEIDLALQSGI 119
           N  +++ +   G  +D VS GE+ RALAA        + IVF+        ++   +  I
Sbjct: 58  NIHILRLMREQGVKVDSVSLGEIERALAAGYNPQTHPDDIVFTADVIDQATLERVSELQI 117

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
              N  S   L  L Q          +  RVNP       +K +TG +  K GI    + 
Sbjct: 118 PV-NAGSVDMLDQLGQV----SPGHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLP 172

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           +          +++ G+ MHIGS +D    +    ++   + +Q+   G ++Q I  GGG
Sbjct: 173 AALDVIQR-HHLQLVGIHMHIGSGVD----YAHLEQVCGAMVRQVIEFGQDLQAISAGGG 227

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYF------GNLQCKIILEPGRFLVADVGILVTKVISI 293
           L + Y        +  Y  L +              K+ +EPGRFLVA  G+L+T+V S+
Sbjct: 228 LSVPYQQGEEAVDTEHYYGLWNAAREQIARHLGHPVKLEIEPGRFLVAQSGVLITQVRSV 287

Query: 294 KKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLH---IHADIVGPICETGDF 350
           K+   + FV++D   ND MRP +Y +YH I+ +        H   +   + GP+CE+GD 
Sbjct: 288 KQMGSRHFVLVDAGFNDLMRPAMYGSYHHISALAADGRSLEHAPTVETVVAGPLCESGDV 347

Query: 351 IALNR-----KIALP--RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRP 403
                       ALP  + GD L +  TGAYGA  S  YNSR L+PE++ +  Q  +IR 
Sbjct: 348 FTQQEGGNVETRALPEVKAGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGQARLIRR 407

Query: 404 RMTFQELIELDSI 416
           R T +EL+ L+ +
Sbjct: 408 RQTIEELLALELL 420


>2p3e_A Diaminopimelate decarboxylase; southeast collaboratory for
           structural genomics, riken spring-8 center, riken
           genomic sciences center; 1.99A {Aquifex aeolicus VF5}
          Length = 420

 Score =  307 bits (786), Expect = 4e-84
 Identities = 176/411 (42%), Positives = 250/411 (60%), Gaps = 4/411 (0%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
            +Y +G L  E VSL++LA    TP Y YS+  I++ +  +  AF     ++CYA+KAN 
Sbjct: 11  LEYRDGELFIEGVSLKELAQTFGTPLYVYSSNFIKERFEAYRKAFPD--ALICYAVKANF 68

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N  ++K L  LG+G DIVS GEL  A  A +P ERIV++GVGKT  E+  A+ S I  FN
Sbjct: 69  NPHLVKLLGELGAGADIVSGGELYLAKKAGIPPERIVYAGVGKTEKELTDAVDSEILMFN 128

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VES  EL  LN+ A  LGKKA IA RVNPD++  TH  I+TG ++ KFG+ I +    Y 
Sbjct: 129 VESRQELDVLNEIAGKLGKKARIAIRVNPDVDPKTHPYIATGMQKSKFGVDIREAQKEYE 188

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
           YAS L  ++I G+  HIGSQI  I  + +A + +  L + L   G +I+++D+GGGLGI 
Sbjct: 189 YASKLENLEIVGIHCHIGSQILDISPYREAVEKVVSLYESLTQKGFDIKYLDIGGGLGIK 248

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVI 303
           Y  + + P+  D A L+     N++ KIILEPGR ++ + GIL+T+V  +K    K F+I
Sbjct: 249 YKPEDKEPAPQDLADLLKDLLENVKAKIILEPGRSIMGNAGILITQVQFLKDKGSKHFII 308

Query: 304 LDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPG 363
           +D  MND +RP++Y+AYH I  +      +  + ADIVGPICETGDF+AL+R+I   + G
Sbjct: 309 VDAGMNDLIRPSIYNAYHHIIPVETKERKK--VVADIVGPICETGDFLALDREIEEVQRG 366

Query: 364 DLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
           + L +   GAYG   S  YN R    E++V      +IR R  +  ++E  
Sbjct: 367 EYLAVLSAGAYGFAMSSHYNMRPRAAEVLVENGSVKLIRKRENYDYIVEPS 417


>2qgh_A Diaminopimelate decarboxylase; lyase; HET: PLP LYS; 2.30A
           {Helicobacter pylori} PDB: 3c5q_A*
          Length = 425

 Score =  291 bits (745), Expect = 2e-79
 Identities = 162/399 (40%), Positives = 236/399 (59%), Gaps = 2/399 (0%)

Query: 16  VSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLG 75
            + E+L    +TPFY Y    I++ +L +  AF G  +++CYALKANSN +++  LAHL 
Sbjct: 22  FNYEELFQTHKTPFYLYDFDKIKQAFLNYKEAFKGRKSLICYALKANSNLSILSLLAHLE 81

Query: 76  SGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQ 135
           SG D VS GE++RAL A +   RIVFSGVGK+  EI+ AL+  I   NVES  ELKT+  
Sbjct: 82  SGADCVSIGEIQRALKAGIKPYRIVFSGVGKSAFEIEQALKLNILFLNVESFMELKTIET 141

Query: 136 RAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISG 195
            A SLG KA I+ R+NP+I+A TH  ISTG KE+KFG+   +   ++ +A     ++   
Sbjct: 142 IAQSLGIKARISIRINPNIDAKTHPYISTGLKENKFGVGEKEALEMFLWAKKSAFLEPVS 201

Query: 196 VDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSD 255
           V  HIGSQ+  +E   +A + +  + + L + G +++  DVGGG+G+  + +       D
Sbjct: 202 VHFHIGSQLLDLEPIIEASQKVAKIAKSLIALGIDLRFFDVGGGIGV-SYENEETIKLYD 260

Query: 256 YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPT 315
           YA  I      L   II EPGR +VA+ G L+T+V+  KK+ +K FVI+D  MNDF+RP+
Sbjct: 261 YAQGILNALQGLDLTIICEPGRSIVAESGELITQVLYEKKAQNKRFVIVDAGMNDFLRPS 320

Query: 316 LYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYG 375
           LY A H I  I    G  +    D+VGP+CE+ D    +  +    PGD + IEK GAYG
Sbjct: 321 LYHAKHAIRVITPSKGREISP-CDVVGPVCESSDTFLKDAHLPELEPGDKIAIEKVGAYG 379

Query: 376 AVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
           +  +  YNSR  + E+ +   +  +IR R   ++L  L+
Sbjct: 380 SSMASQYNSRPKLLELALEDHKIRVIRKREALEDLWRLE 418


>1twi_A Diaminopimelate decarboxylase; antibiotic resistance, lysine
           biosynthesis, structural genomics, NYSGXRC, PSI; HET:
           LYS PLP; 2.00A {Methanocaldococcus jannaschii} SCOP:
           b.49.2.3 c.1.6.1 PDB: 1tuf_A*
          Length = 434

 Score =  279 bits (713), Expect = 1e-75
 Identities = 153/430 (35%), Positives = 232/430 (53%), Gaps = 16/430 (3%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFD------GMDTMVCY 57
            +  +G    +     +LA    TP Y  S   I+ NY  +  AF       G + +V Y
Sbjct: 7   VEIKDGRFFIDGYDAIELAEKFGTPLYVMSEEQIKINYNRYIEAFKRWEEETGKEFIVAY 66

Query: 58  ALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQS 117
           A KAN+N A+ + LA LG G D+VS GEL  A  + VP+++IVF+G  KT +EI + +++
Sbjct: 67  AYKANANLAITRLLAKLGCGADVVSGGELYIAKLSNVPSKKIVFNGNCKTKEEIIMGIEA 126

Query: 118 GIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQ 177
            I  FNV+S SEL  +N+ A  LG+ A +AFR+NP++N  TH KISTG K++KFG+ +  
Sbjct: 127 NIRAFNVDSISELILINETAKELGETANVAFRINPNVNPKTHPKISTGLKKNKFGLDVES 186

Query: 178 IHSLYAYAST--LPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHID 235
             ++ A      +  V + GV  HIGSQ+  I  F +  + + D   +L+  G  I+ ++
Sbjct: 187 GIAMKAIKMALEMEYVNVVGVHCHIGSQLTDISPFIEETRKVMDFVVELKEEGIEIEDVN 246

Query: 236 VGGGLGIAYHSDHRPPSSSDYA-----SLIHQYFGNLQCKIILEPGRFLVADVGILVTKV 290
           +GGGLGI Y+ D + P+  D A     +++          +ILEPGR LVA  G L+ KV
Sbjct: 247 LGGGLGIPYYKDKQIPTQKDLADAIINTMLKYKDKVEMPNLILEPGRSLVATAGYLLGKV 306

Query: 291 ISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDF 350
             IK++    +V++D  MND MRP +Y+AYH I          +     I G +CE+ D 
Sbjct: 307 HHIKETPVTKWVMIDAGMNDMMRPAMYEAYHHIINCKVKNEKEV---VSIAGGLCESSDV 363

Query: 351 IALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
              +R++     GD+L I   GAYG   +  YN+R     ++ +     +IR R T+ +L
Sbjct: 364 FGRDRELDKVEVGDVLAIFDVGAYGISMANNYNARGRPRMVLTSKKGVFLIRERETYADL 423

Query: 411 IELDSIPAWL 420
           I  D +P  L
Sbjct: 424 IAKDIVPPHL 433


>2o0t_A Diaminopimelate decarboxylase; PLP binding enzyme, lysine
           biosynthesis, structural genomics, TB structural
           genomics consortium; HET: LLP; 2.33A {Mycobacterium
           tuberculosis H37RV} PDB: 1hkv_A* 1hkw_A
          Length = 467

 Score =  273 bits (698), Expect = 6e-74
 Identities = 115/439 (26%), Positives = 200/439 (45%), Gaps = 24/439 (5%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
            +  +   G +    + L +LA    TP +              + AF G    V YA K
Sbjct: 16  RNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVIDEDDFRSRCRETAAAF-GSGANVHYAAK 74

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A     V + ++  G  LD+ + GEL  AL A  P ERI   G  K++ E+  A+++G+ 
Sbjct: 75  AFLCSEVARWISEEGLCLDVCTGGELAVALHASFPPERITLHGNNKSVSELTAAVKAGVG 134

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
              V+S +E++ L+  A   G    +  R+   + A+TH+ IST  ++ KFG+ +    +
Sbjct: 135 HIVVDSMTEIERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHEDQKFGLSVASGAA 194

Query: 181 LYAYASTL--PGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQ-----LRSNGHNIQH 233
           + A         +++ G+  HIGSQI  ++ F  A   +  L +             I  
Sbjct: 195 MAAVRRVFATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVGEFGPEKTAQIAT 254

Query: 234 IDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCK-------IILEPGRFLVADVGIL 286
           +D+GGGLGI+Y     PP  ++ A+ +     +           +++EPGR +     I 
Sbjct: 255 VDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVVEPGRAIAGPGTIT 314

Query: 287 VTKVISI-----KKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIV 341
           + +V ++       +A + +V +D  M+D +R  LY A +++  +V+   D   + A +V
Sbjct: 315 LYEVGTVKDVDVSATAHRRYVSVDGGMSDNIRTALYGAQYDV-RLVSRVSDAPPVPARLV 373

Query: 342 GPICETGDFIALNRKIALP-RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHI 400
           G  CE+GD I  +  +    RPGDL+ +  TGAY    S  YN       + V+     +
Sbjct: 374 GKHCESGDIIVRDTWVPDDIRPGDLVAVAATGAYCYSLSSRYNMVGRPAVVAVHAGNARL 433

Query: 401 IRPRMTFQELI--ELDSIP 417
           +  R T  +L+  E+  +P
Sbjct: 434 VLRRETVDDLLSLEVRGVP 452


>2oo0_A ODC, ornithine decarboxylase; beta-alpha barrel, sheet, lyase; HET:
           PLP; 1.90A {Homo sapiens}
          Length = 471

 Score =  270 bits (690), Expect = 5e-73
 Identities = 91/433 (21%), Positives = 166/433 (38%), Gaps = 35/433 (8%)

Query: 4   FKYFEGSLHAENVSLEKLAHVV----QTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
             + +    A+++  +K+  V     +  FY      I K +L +  A   +     YA+
Sbjct: 21  CHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVT--PFYAV 78

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           K N ++A++KTLA  G+G D  S+ E++   +  VP ERI+++   K + +I  A  +G+
Sbjct: 79  KCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGV 138

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
                +SE EL  + +             +    +   T    +  +   KFG  +    
Sbjct: 139 QMMTFDSEVELMKVAR----------AHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSR 188

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            L    +    + + GV  H+GS     E+F +A    R +       G ++  +D+GGG
Sbjct: 189 -LLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGG 247

Query: 240 LGIAYHSDHRPP--SSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIK--- 294
              +     +    +     +L   +  +   +II EPGR+ VA    L   +I+ K   
Sbjct: 248 FPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVL 307

Query: 295 -----------KSADKTFVILDVAMNDFMRPTLYDAYHEINYIVN-PAGDRLHIHADIVG 342
                       S       ++  +       LYD  H    +   P  D  +  + I G
Sbjct: 308 KEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWG 367

Query: 343 PICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMV-NGSQFHII 401
           P C+  D I     +     GD +  E  GAY    + T+N         V +G  + ++
Sbjct: 368 PTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLM 427

Query: 402 RPRMTFQELIELD 414
           +         E++
Sbjct: 428 QQFQNPDFPPEVE 440


>3mt1_A Putative carboxynorspermidine decarboxylase prote; PSI2, MCSG,
           structural genomics; 2.50A {Sinorhizobium meliloti}
          Length = 365

 Score =  265 bits (678), Expect = 1e-71
 Identities = 54/388 (13%), Positives = 118/388 (30%), Gaps = 31/388 (7%)

Query: 24  VVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSE 83
           +++TP+Y      + +N    ++  +        ALK  +  +V   +     G    S 
Sbjct: 1   MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSL 60

Query: 84  GELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKK 143
            E+R                 G    +  ++    I      S S+L+    +A      
Sbjct: 61  FEVRLGRERFGKETHAYSVAYGDNEIDEVVSHADKI---IFNSISQLERFADKA----AG 113

Query: 144 APIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQ 203
                R+NP +++++       +   + G                   +I+G  +H   +
Sbjct: 114 IARGLRLNPQVSSSSFDLADPARPFSRLGEWDVPKVERVMD-------RINGFMIHNNCE 166

Query: 204 IDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQY 263
                 F +    + +    L      +  + +GGG+               +++ +  +
Sbjct: 167 NKDFGLFDRMLGEIEERFGAL---IARVDWVSLGGGIHFTGDDYPVDA----FSARLRAF 219

Query: 264 FGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDF-MRPTLYDAYHE 322
                 +I LEPG   +     L   V+    +  K   I+D ++    +   +Y    +
Sbjct: 220 SDRYGVQIYLEPGEASITKSTTLEVTVLDTLYN-GKNLAIVDSSIEAHMLDLLIYRETAK 278

Query: 323 INYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTY 382
           +                I G  C  GD     R     + GD +  +    Y  V+   +
Sbjct: 279 VLPNEGSH------SYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWF 332

Query: 383 NSRLLIPEIMVN-GSQFHIIRPRMTFQE 409
           N   +    +         +R   T+ +
Sbjct: 333 NGVKMPAIAIRELDGSVRTVR-EFTYAD 359


>3nzp_A Arginine decarboxylase; alpha-beta protein, structural genomics,
           PSI-2, protein STRU initiative; HET: PLP; 3.00A
           {Campylobacter jejuni subsp}
          Length = 619

 Score =  265 bits (678), Expect = 2e-71
 Identities = 70/358 (19%), Positives = 128/358 (35%), Gaps = 38/358 (10%)

Query: 4   FKYFEGSL---HAENVSLEKLAHVV-----QTPFYCYSTTAIEKNYLTFSNAFD------ 49
           F    G +   + +  ++  +   +     + P        I+K        F+      
Sbjct: 14  FIIKNGKVCINYEKKPAIIDIVKELRDDGYKGPLLLRFPHLIQKQIENIYGNFNKARKEF 73

Query: 50  --GMDTMVCYALKANSNQAVIKTLAHLGS----GLDIVSEGELRRALAAPVPAERIVFSG 103
                    Y LK N     +K L  LG     GL+  S+ EL  A+A       I  +G
Sbjct: 74  GYKGGFNAVYPLKVNQYPGFVKNLVKLGKDYNYGLEAGSKAELLLAMAYNNEGAPITVNG 133

Query: 104 VGKTIDEIDLALQSGIYC----FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTH 159
                + I++   +          +E  +EL+ +   A    K  P         +A   
Sbjct: 134 FKDR-ELINIGFIAAEMGHNITLTIEGLNELEAIIDIAKERFKPKPNIGLRVRLHSAGVG 192

Query: 160 KKISTGKKEDKFGIPIHQIHSLYAYASTLP-GVKISGVDMHIGSQIDQIESFHKAFKLLR 218
               +G    KFG+   ++              + + +  H+GSQI +I    KA     
Sbjct: 193 IWAKSGGINSKFGLTSTELIEAVNLLKENKLLEQFTMIHFHLGSQITEIHPLKKALNEAG 252

Query: 219 DLTQQLRS-NGHNIQHIDVGGGLGIAY----HSDHRPPSSSDYASLIHQY-------FGN 266
           ++  +LR     N++ I++GGGL + Y    +   R  +  +YA+ +            +
Sbjct: 253 NIYTELRKMGAKNLKAINLGGGLAVEYSQFKNEKSRNYTLREYANDVVFILKNIAEQKKD 312

Query: 267 LQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEIN 324
           L+  I +E GRF+ A+  +L+  V+ +         ++    N  +   LYD Y  I 
Sbjct: 313 LEPDIFIESGRFVAANHAVLIAPVLELFSQEYAENKLILKKQNPKLIDELYDLYKSIK 370


>2yxx_A Diaminopimelate decarboxylase; TM1517, TIM beta/alpha barrel fold,
           lyase, structural genomics, NPPSFA; HET: PLP; 1.70A
           {Thermotoga maritima MSB8}
          Length = 386

 Score =  251 bits (642), Expect = 2e-67
 Identities = 131/396 (33%), Positives = 216/396 (54%), Gaps = 18/396 (4%)

Query: 18  LEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSG 77
           L K+A +  TP Y Y    + K        F+G++ +  +A+KAN+N  ++K L   G G
Sbjct: 4   LRKVAEIHGTPTYVYFEETLRKRSRLVKEVFEGVNLLPTFAVKANNNPVLLKILREEGFG 63

Query: 78  LDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRA 137
           +D+V++GEL  A  A VP+  +V++G GK+ D+++  L+  +   NV+S  E++   +  
Sbjct: 64  MDVVTKGELLAAKLAGVPSHTVVWNGNGKSRDQMEHFLREDVRIVNVDSFEEMEIWRELN 123

Query: 138 VSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVD 197
               +      RVNP+++A TH  ISTG K+ KFGIP+  + S          + I G+ 
Sbjct: 124 P---EGVEYFIRVNPEVDAKTHPHISTGLKKHKFGIPLEDLDSFMERF---RSMNIRGLH 177

Query: 198 MHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYA 257
           +HIGSQI ++E F +AF  +   +++     +  + I++GGG GI Y  +    SS    
Sbjct: 178 VHIGSQITRVEPFVEAFSKVVRASER-----YGFEEINIGGGWGINYSGEELDLSSYREK 232

Query: 258 SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLY 317
            +          ++I+E GR++VA  G L+ +V+ +K+  +K FV++D  MN  +RP LY
Sbjct: 233 VVPDLKR---FKRVIVEIGRYIVAPSGYLLLRVVLVKRRHNKAFVVVDGGMNVLIRPALY 289

Query: 318 DAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAV 377
            AYH I  +         + AD+VGP+CE+GD IA +R++    PGD++ +E  GAYG  
Sbjct: 290 SAYHRIFVLGKQGK---EMRADVVGPLCESGDVIAYDRELPEVEPGDIIAVENAGAYGYT 346

Query: 378 QSGTYNSRLLIPEIMVN-GSQFHIIRPRMTFQELIE 412
            S  YNS     E++V    +  +IR R T  ++ +
Sbjct: 347 MSNNYNSTTRPAEVLVRENGRISLIRRRETEMDIFK 382


>7odc_A Protein (ornithine decarboxylase); pyridoxal-5'-phosphate, PLP,
           group IV decarboxylase, polyamines, parasitical,
           chemotherapy target, putrescine; HET: PLP; 1.60A {Mus
           musculus} SCOP: b.49.2.3 c.1.6.1 PDB: 2on3_A 1d7k_A*
          Length = 424

 Score =  249 bits (637), Expect = 7e-67
 Identities = 89/426 (20%), Positives = 163/426 (38%), Gaps = 35/426 (8%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQ----TPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
               +    A+++  +K+  V        FY      I K +L +  A   +     YA+
Sbjct: 11  CHILDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVT--PFYAV 68

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           K N ++A++ TLA +G+G D  S+ E++      VPAER++++   K + +I  A  +G+
Sbjct: 69  KCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQIKYAASNGV 128

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
                +SE EL           K A    +    +   T    +  +   KFG  +    
Sbjct: 129 QMMTFDSEIELM----------KVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSR 178

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            L    +    + + GV  H+GS     ++F +A    R +       G ++  +D+GGG
Sbjct: 179 -LLLERAKELNIDVIGVSFHVGSGCTDPDTFVQAVSDARCVFDMATEVGFSMHLLDIGGG 237

Query: 240 LGIAYHSDHRPP--SSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSA 297
              +  +  +    +S    +L   +  +   +II EPGR+ VA    L   +I+ K   
Sbjct: 238 FPGSEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVW 297

Query: 298 DKT--------------FVILDVAMNDFMRPTLYDAYHEINYIVN-PAGDRLHIHADIVG 342
            +                  ++  +       LYD  H    +   P  D  +  + I G
Sbjct: 298 KEQPGSDDEDESNEQTFMYYVNDGVYGSFNCILYDHAHVKALLQKRPKPDEKYYSSSIWG 357

Query: 343 PICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMV-NGSQFHII 401
           P C+  D I     +     GD +  E  GAY    + T+N         V +   + ++
Sbjct: 358 PTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRPMWQLM 417

Query: 402 RPRMTF 407
           +   + 
Sbjct: 418 KQIQSH 423


>3btn_A Antizyme inhibitor 1; TIM-like A/B barrel domain and A sheet
           domain, structural genomics, israel structural
           proteomics center, ISPC; 2.05A {Mus musculus}
          Length = 448

 Score =  244 bits (622), Expect = 4e-65
 Identities = 88/459 (19%), Positives = 155/459 (33%), Gaps = 43/459 (9%)

Query: 1   MSAF---KYFEGSLHAENVSLEKLA--HVVQ------TPFYCYSTTAIEKNYLTFSNAFD 49
           M  F     +   L  E  +L  +   +V +        F+      I K +  +     
Sbjct: 1   MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQTVVA 60

Query: 50  GMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTID 109
            +     Y +K NS  AV++ LA LG+G    S+ E+       V  E I+F+   K + 
Sbjct: 61  QIK--PFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIFTSPCKQVS 118

Query: 110 EIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKED 169
           +I  A + G+     ++E ELK          K A         ++  T   I       
Sbjct: 119 QIKYAAKVGVNIMTCDNEIELK----------KIARNHPNAKVLLHIATEDNIGGEDGNM 168

Query: 170 KFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGH 229
           KFG  +     L   A  L  V+I GV  H+ S   + + +  A    R +       G 
Sbjct: 169 KFGTTLKNCRHLLECAKELD-VQIIGVKFHVSSACKEYQVYVHALSDARCVFDMAGEFGF 227

Query: 230 NIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTK 289
            +  +D+GGG                    I+   G+   +II EPG + V+    L   
Sbjct: 228 TMNMLDIGGGFTGTEIQLEEVNHVISPLLDIYFPEGS-GIQIISEPGSYYVSSAFTLAVN 286

Query: 290 VISIKKSADKTFVI-------LDVAMNDFMRPTLYDAYHEINY---------IVNPAGDR 333
           +I+ K   +  F          + A   +M   +Y ++                    D 
Sbjct: 287 IIAKKVVENDKFSSGVEKNGSDEPAFVYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDE 346

Query: 334 LHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLL--IPEI 391
               + + GP C+  D I  +  +     GD L  +  GA    +   +N      I  +
Sbjct: 347 PLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYFM 406

Query: 392 MVNGSQFHIIRPRMTFQELIELDSIPAWLQKTPKQSSEN 430
           M     + +    +T   +++         +  ++ S +
Sbjct: 407 MSFSDWYEMQDAGITSDAMMKNFFFAPSCIQLSQEDSFS 445


>2plj_A Lysine/ornithine decarboxylase; type IV decarboxylase, beta/alpha
           barrel, beta barrel, lyase; HET: P3T; 1.70A {Vibrio
           vulnificus CMCP6} PDB: 2plk_A*
          Length = 419

 Score =  235 bits (601), Expect = 1e-62
 Identities = 85/397 (21%), Positives = 144/397 (36%), Gaps = 19/397 (4%)

Query: 11  LHAENVSL-EKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           L AE + L E        P        I + Y    NA   +   + YALK   +  V++
Sbjct: 38  LSAEEIHLIEASVEQFGAPLLLLDCDVIRQQYRALKNALPNVT--LHYALKPLPHPVVVR 95

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
           TL   G+  D+ + GE+    +  VPA+  + +   K   +I  AL  G   F V++ +E
Sbjct: 96  TLLAEGASFDLATTGEVELVASEGVPADLTIHTHPIKRDADIRDALAYGCNVFVVDNLNE 155

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           L+                  V   +  +     +      KFG    Q   +   A    
Sbjct: 156 LEKFKA----------YRDDVELLVRLSFRNSEAFADLSKKFGCSPEQALVIIETAKE-W 204

Query: 190 GVKISGVDMHIGSQIDQIESFHKAF-KLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDH 248
            ++I G+  H+GSQ      + +A       + Q +      +  +D+GGG  + Y    
Sbjct: 205 NIRIKGLSFHVGSQTTNPNKYVEAIHTCRHVMEQVVERGLPALSTLDIGGGFPVNYTQQV 264

Query: 249 RPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAM 308
            P                    ++ EPGRF+ A     V  V+   +   + +  LD  +
Sbjct: 265 MPIDQFCAPINEALSLLPETVHVLAEPGRFICAPAVTSVASVMGQAEREGQIWYYLDDGI 324

Query: 309 NDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYI 368
                  ++D        +   G+   I + + GP C++ D IA N  +     GDL+  
Sbjct: 325 YGSFSGLMFDDARYPLTTIKQGGEL--IPSVLSGPTCDSVDVIAENILLPKLNNGDLVIG 382

Query: 369 EKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRM 405
              GAY +  +  +N       I +N  +F     RM
Sbjct: 383 RTMGAYTSATATDFNFFKRAQTIALN--EFVASSERM 417


>2j66_A BTRK, decarboxylase; butirosin, AHBA biosynthesis, lyase; HET: PLP;
           1.65A {Bacillus circulans}
          Length = 428

 Score =  235 bits (600), Expect = 1e-62
 Identities = 114/421 (27%), Positives = 184/421 (43%), Gaps = 16/421 (3%)

Query: 11  LHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKT 70
           ++ +   +  L    +TPFY Y    IE +Y    +  +        +LKAN+N  + K 
Sbjct: 1   MNLDQAEITALTKRFETPFYLYDGDFIEAHYRQLRSRTNP-AIQFYLSLKANNNIHLAKL 59

Query: 71  LAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESEL 130
               G G+++ S GEL  A  A   AE I+FSG GK   E+++A+QSGIYC   ES  EL
Sbjct: 60  FRQWGLGVEVASAGELALARHAGFSAENIIFSGPGKKRSELEIAVQSGIYCIIAESVEEL 119

Query: 131 KTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPG 190
             + + A    K A +A R+NPD  +     I  G    +FG+    + ++     +L  
Sbjct: 120 FYIEELAEKENKTARVAIRINPD-KSFGSTAIKMGGVPRQFGMDESMLDAVMDAVRSLQF 178

Query: 191 VKISGVDMHIGSQIDQIESFHKAFKLLRDLTQ-QLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            K  G+ ++ G+Q    +S  ++ K   DL +      G   + I++GGG G+ Y S  +
Sbjct: 179 TKFIGIHVYTGTQNLNTDSIIESMKYTVDLGRNIYERYGIVCECINLGGGFGVPYFSHEK 238

Query: 250 PPSSSDYASLIHQYFGNL------QCKIILEPGRFLVADVGILVTKVISIKKSADKTFVI 303
                     +  Y          Q   I+E GR+L+A   + VT+V+  K S  + FVI
Sbjct: 239 ALDIGKITRTVSDYVQEARDTRFPQTTFIIESGRYLLAQAAVYVTEVLYRKASKGEVFVI 298

Query: 304 LDVAMNDFMRPTLYDAYHEINY------IVNPAGDRLHIHADIVGPICETGDFIALNRKI 357
           +D  M+     T        NY      +   +G R      I GP+C   D +  +  +
Sbjct: 299 VDGGMHHHAASTFRGRSMRSNYPMEYIPVREDSGRRELEKVTIAGPLCTPEDCLGKDVHV 358

Query: 358 ALPRPGDLLYIEKTGAYGAVQSGT-YNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
               PGDL+ +  +GAYG   S   +       EI+     + +IR + T  +++     
Sbjct: 359 PALYPGDLVCVLNSGAYGLSFSPVHFLGHPTPIEILKRNGSYELIRRKGTADDIVATQLQ 418

Query: 417 P 417
            
Sbjct: 419 T 419


>3nzq_A ADC, biosynthetic arginine decarboxylase; alpha-beta protein,
           structural genomics, PSI-2, protein STRU initiative;
           3.10A {Escherichia coli}
          Length = 666

 Score =  235 bits (600), Expect = 2e-62
 Identities = 75/362 (20%), Positives = 131/362 (36%), Gaps = 35/362 (9%)

Query: 9   GSLHAENVSLEKLAHVV-----QTPFYCYSTTAIEKNYLTFSNAFD--------GMDTMV 55
             +    V L +L         + P        ++    + + AF           D  +
Sbjct: 63  PDVPEARVDLAQLVKTREAQGQRLPALFCFPQILQHRLRSINAAFKRARESYGYNGDYFL 122

Query: 56  CYALKANSNQAVIKTLAHLGS--GLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDL 113
            Y +K N ++ VI++L H G   GL+  S+ EL   LA       ++     K  + I L
Sbjct: 123 VYPIKVNQHRRVIESLIHSGEPLGLEAGSKAELMAVLAHAGMTRSVIVCNGYKDREYIRL 182

Query: 114 ALQSGIYCF----NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKED 169
           AL            +E  SE+  +   A  L     +  R        + K  S+G ++ 
Sbjct: 183 ALIGEKMGHKVYLVIEKMSEIAIVLDEAERLNVVPRLGVRARLASQG-SGKWQSSGGEKS 241

Query: 170 KFGIPIHQIHSLYAYASTLPG-VKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNG 228
           KFG+   Q+  L            +  +  H+GSQ+  I       +       +L   G
Sbjct: 242 KFGLAATQVLQLVETLREAGRLDSLQLLHFHLGSQMANIRDIATGVRESARFYVELHKLG 301

Query: 229 HNIQHIDVGGGLGIAYHSDHRPPSSS------DYASLIHQYFGNL-------QCKIILEP 275
            NIQ  DVGGGLG+ Y         S      +YA+ I    G+           +I E 
Sbjct: 302 VNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNIIWAIGDACEENGLPHPTVITES 361

Query: 276 GRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLH 335
           GR + A   +LV+ +I ++++               ++  +++ + E++        R  
Sbjct: 362 GRAVTAHHTVLVSNIIGVERNEYTVPTAPAEDAPRALQS-MWETWQEMHEPGTRRSLREW 420

Query: 336 IH 337
           +H
Sbjct: 421 LH 422


>3n2o_A ADC, biosynthetic arginine decarboxylase; lyase; HET: PLP; 2.30A
           {Vibrio vulnificus}
          Length = 648

 Score =  231 bits (590), Expect = 2e-61
 Identities = 71/364 (19%), Positives = 128/364 (35%), Gaps = 40/364 (10%)

Query: 12  HAENVSLEKLAHVV-----QTPFYCYST----TAIEKNYLTFSNAFDGMD----TMVCYA 58
           +A  + L K+   +       P            +      F+ A +        ++ Y 
Sbjct: 44  NAHQIQLSKIVKQLEERQLNVPVLVRFPQILHQRVHSICDAFNQAIEEYQYPNKYLLVYP 103

Query: 59  LKANSNQAVIKTLAHLGS-------GLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEI 111
           +K N  + V+  +    +       GL+  S+ EL   LA    A  ++     K  + I
Sbjct: 104 IKVNQQREVVDEILASQAQLETKQLGLEAGSKPELLAVLAMAQHASSVIVCNGYKDREYI 163

Query: 112 DLALQSGIYCFNV----ESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKK 167
            LAL        V    E  SEL  + + A SLG    +  R+            ++G +
Sbjct: 164 RLALIGEKLGHKVFIVLEKMSELDLVLREAKSLGVTPRLGIRIRLASQGAGK-WQASGGE 222

Query: 168 EDKFGIPIHQIHSLYAYASTLPG-VKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRS 226
           + KFG+   Q+ ++ +          +  V  H+GSQ+  I               +LR+
Sbjct: 223 KSKFGLSASQVLNVISRLKKENQLDTLQLVHFHLGSQMANIRDVRNGVNESARFYCELRT 282

Query: 227 NGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASL-------------IHQYFGNLQCKIIL 273
            G NI + DVGGGL I Y       S+S    L             + + +      II 
Sbjct: 283 LGANITYFDVGGGLAIDYDGTRSQSSNSMNYGLVEYARNIVNTVGDVCKDYKQPMPVIIS 342

Query: 274 EPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDR 333
           E GR L A   +L++ VI  +    +T    +      +   ++ ++  ++   +     
Sbjct: 343 ESGRSLTAHHAVLISNVIGTETYKPETVTEPE-EDFPLLLNNMWRSWLNLHNGTDARALI 401

Query: 334 LHIH 337
              +
Sbjct: 402 EIYN 405


>2nva_A Arginine decarboxylase, A207R protein; PLP, TIM barrel, eukaryotic
           ODC- like, lyase; HET: PL2; 1.80A {Paramecium bursaria
           chlorella virus 1} PDB: 2nv9_A*
          Length = 372

 Score =  217 bits (552), Expect = 5e-57
 Identities = 78/379 (20%), Positives = 146/379 (38%), Gaps = 15/379 (3%)

Query: 17  SLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGS 76
           ++ K        FY  S   +E     ++  F  +     YA+K N+++ ++KT+     
Sbjct: 7   NILKAHPHQTKSFYVSSPKIVEDLIDQWTILFPRVT--PHYAVKCNNDEVLLKTMCDKNV 64

Query: 77  GLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQR 136
             D  S  E+++ +   V   RI+F+   KTID++  A   G+     +S  EL  ++  
Sbjct: 65  NFDCASSSEIKKVIQIGVSPSRIIFAHTMKTIDDLIFAKDQGVDIATFDSSFELDKIHT- 123

Query: 137 AVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGV 196
                            +        +T +  +KFG    +I  L  YA     +++ G+
Sbjct: 124 ---------YHPNCKMILRIRCDDPNATVQLGNKFGANEDEIRHLLEYAKQ-LDIEVIGI 173

Query: 197 DMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPS-SSD 255
             H+GS     E++++A K  ++   +  S GH    +D+GGGL             S  
Sbjct: 174 SFHVGSGSRNPEAYYRAIKSSKEAFNEAISVGHKPYILDIGGGLHADIDEGELSTYMSDY 233

Query: 256 YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPT 315
               I  +F      I+ EPGRF      +L T+VI  +          + +        
Sbjct: 234 INDAIKDFFPEDTVTIVAEPGRFFAEHYSVLATQVIGKRVRDGLYEYFFNESTYGGFSNV 293

Query: 316 LYDAYHEINYIV-NPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAY 374
           +++       ++ +   D  ++ + + G  C+  D I  N  +     GD +Y    GAY
Sbjct: 294 IFEKSVPTPQLLRDVPDDEEYVPSVLYGCTCDGVDVINHNVALPELHIGDWVYFPSWGAY 353

Query: 375 GAVQSGTYNSRLLIPEIMV 393
             V + ++N         +
Sbjct: 354 TNVLTTSFNGFGEYDVYYI 372


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 55.3 bits (133), Expect = 2e-08
 Identities = 62/320 (19%), Positives = 102/320 (31%), Gaps = 112/320 (35%)

Query: 71  LAH-------LGSGLDIVSEGELRRALAAP-------VPAERIVFSGVGKTIDE-IDLAL 115
           LAH       LG      + GELR  L          V A  +  +    + +       
Sbjct: 246 LAHYVVTAKLLG-----FTPGELRSYLKGATGHSQGLVTA--VAIAET-DSWESFFVSVR 297

Query: 116 QS-------GIYC---FNVESESELKTLNQRAVSLGKKAP---IAFR------VNPDINA 156
           ++       G+ C   +   S      L + ++   +  P   ++        V   +N 
Sbjct: 298 KAITVLFFIGVRCYEAYPNTS-LPPSIL-EDSLENNEGVPSPMLSISNLTQEQVQDYVNK 355

Query: 157 -NTH----KKIS----TGKKEDKF---GIPIHQIHSLYAYASTLPGVKI-SGVDMHIGSQ 203
            N+H    K++      G         G P     SLY    TL   K  SG+D    S+
Sbjct: 356 TNSHLPAGKQVEISLVNG--AKNLVVSGPPQ----SLYGLNLTLRKAKAPSGLDQ---SR 406

Query: 204 I--DQ-----------IES-FHKAFKLLRDLTQQLRSN--GHNIQHIDVGGGLGIA-YH- 245
           I   +           + S FH    LL   +  +  +   +N+   +    + I  Y  
Sbjct: 407 IPFSERKLKFSNRFLPVASPFHS--HLLVPASDLINKDLVKNNVS-FN-AKDIQIPVYDT 462

Query: 246 ---SDHRPPSSSDYASLIHQYFGN-------LQCKI--ILE--PGRFLVADVGILVTKVI 291
              SD R  S S    ++              Q K   IL+  PG    + +G+L  +  
Sbjct: 463 FDGSDLRVLSGSISERIVDCIIRLPVKWETTTQFKATHILDFGPGG--ASGLGVLTHR-- 518

Query: 292 SIKKSADKT--FVILDVAMN 309
             K   D T   VI+   ++
Sbjct: 519 -NK---DGTGVRVIVAGTLD 534



 Score = 41.5 bits (97), Expect = 4e-04
 Identities = 84/533 (15%), Positives = 141/533 (26%), Gaps = 249/533 (46%)

Query: 2   SAFKYFEGS-LHAENVSLEKLAHVVQTPFYCYSTTAIEK------NYLTFSNAFDGMDTM 54
                FE   L   ++      H +       + T + K      NY             
Sbjct: 86  LCLTEFENCYLEGNDI------HALAAKLLQENDTTLVKTKELIKNY------------- 126

Query: 55  VCYALKANSNQAVIKTLAHLGSGL-DIVSEGELRRALAAPVPAERIVFSGVGKT---IDE 110
                +  + +   K      S L   V EG  +  L A       +F G G T    +E
Sbjct: 127 --ITARIMAKRPFDK---KSNSALFRAVGEGNAQ--LVA-------IFGGQGNTDDYFEE 172

Query: 111 IDLALQSGIYC--------FNVESESE-LKTLNQRAVSLGKKAPIAFRV-----NPD--- 153
               L+  +Y           ++  +E L  L +  +   K       +     NP    
Sbjct: 173 ----LRD-LYQTYHVLVGDL-IKFSAETLSELIRTTLDAEKVFTQGLNILEWLENPSNTP 226

Query: 154 -----INANTHKKISTGKKEDKFGIPIHQIHSLYAYAST---L---PG---VKISGVDMH 199
                ++      IS          P+  +  L  Y  T   L   PG     + G   H
Sbjct: 227 DKDYLLSI----PIS---------CPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGH 273

Query: 200 IGSQ-------I---DQIESFHKAFK----LL---------------------------- 217
             SQ       I   D  ESF  + +    +L                            
Sbjct: 274 --SQGLVTAVAIAETDSWESFFVSVRKAITVLFFIGVRCYEAYPNTSLPPSILEDSLENN 331

Query: 218 ----------RDLTQ-QLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGN 266
                      +LTQ Q++       +++          + H P       SL+     N
Sbjct: 332 EGVPSPMLSISNLTQEQVQD------YVNK--------TNSHLPAGKQVEISLV-----N 372

Query: 267 LQCKIILEPGR--FLVAD-----VGILVTKVISIKKSA--DKT----------FVILDVA 307
                    G    +V+       G L   +   K  +  D++          F      
Sbjct: 373 ---------GAKNLVVSGPPQSLYG-LNLTLRKAKAPSGLDQSRIPFSERKLKFS----- 417

Query: 308 MNDFM---RPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGD 364
            N F+    P     +H  + +V PA D           I +  D +  N         D
Sbjct: 418 -NRFLPVASP-----FHS-HLLV-PASDL----------INK--DLVKNNVSF---NAKD 454

Query: 365 L---LYIEKTGAYGAVQSGTYNSRLLIPEI-------MVN---GSQF---HII 401
           +   +Y    G+   ++  + +   +   I        V     +QF   HI+
Sbjct: 455 IQIPVYDTFDGS--DLRVLSGS---ISERIVDCIIRLPVKWETTTQFKATHIL 502



 Score = 35.7 bits (82), Expect = 0.023
 Identities = 43/304 (14%), Positives = 77/304 (25%), Gaps = 134/304 (44%)

Query: 185 ASTLPGVKISGVDMHIGSQIDQIE-------SFHKAFKLLRD-LTQQLRSNGHNIQHIDV 236
            ST P        +  GS    +E       +       L++   + L          D 
Sbjct: 4   YSTRPLT------LSHGS----LEHVLLVPTASFFIASQLQEQFNKILPEPTEGFAADD- 52

Query: 237 GGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFL--VADVGILVTKVISIK 294
                         P++   A L+               G+FL  V+           ++
Sbjct: 53  -------------EPTTP--AELV---------------GKFLGYVSS---------LVE 73

Query: 295 KSADKTFV-ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLH-----IHADIVGPICETG 348
            S    F  +L++ + +F          E  Y+    G+ +H     +  +    + +T 
Sbjct: 74  PSKVGQFDQVLNLCLTEF----------ENCYL---EGNDIHALAAKLLQENDTTLVKTK 120

Query: 349 DFI--------ALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQ--- 397
           + I           R         L          AV  G  N++L+     + G Q   
Sbjct: 121 ELIKNYITARIMAKRPFDKKSNSALF--------RAVGEG--NAQLV----AIFGGQGNT 166

Query: 398 ----------FHIIRP-------RM--TFQELIELDS-----------IPAWLQKTPKQS 427
                     +                T  ELI               I  WL+      
Sbjct: 167 DDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNILEWLENPSNTP 226

Query: 428 SENY 431
            ++Y
Sbjct: 227 DKDY 230


>3llx_A Predicted amino acid aldolase or racemase; structural genomics,
           joint center for structural genomics, JCSG, protein
           structure initiative; HET: LLP TRS; 1.50A {Idiomarina
           loihiensis}
          Length = 376

 Score = 50.3 bits (119), Expect = 8e-07
 Identities = 22/225 (9%), Positives = 56/225 (24%), Gaps = 12/225 (5%)

Query: 25  VQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLG-SGLDIVSE 83
             TP+       ++ N        + + + +   LK          L     +   + + 
Sbjct: 12  PDTPYLLIDEAKLKSNINYLKQRVESLGSHLRPHLKTLRTLEAAGYLLDSKSAPATVSTL 71

Query: 84  GELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY-CFNVESESELKTLNQRAVSLGK 142
            E      A               +  +    Q GI     +++ ++ + +   A   G+
Sbjct: 72  AEAEAYAKAGYTDLLYAVGIAPAKLKRVAALRQQGINLHILLDNITQAQAVVDYAAEFGQ 131

Query: 143 KAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGS 202
              +   ++ D +              K         +          +  +G      +
Sbjct: 132 DFSVFIEIDSDDHRGGI----------KPSDSKLLTIAKTLGEHFTGLMTHAGGSYACNT 181

Query: 203 QIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSD 247
           +        +    +R     L + G +     VG      +  D
Sbjct: 182 EQGLKNFAKQECDAVRIARNNLETAGIHCAITSVGSTPTAHFGED 226


>3gwq_A D-serine deaminase; YP_556991.1, structural genomics, joint center
           for structural genomics, JCSG, protein structure
           initiative; HET: MSE; 2.00A {Burkholderia xenovorans
           LB400}
          Length = 426

 Score = 41.9 bits (97), Expect = 3e-04
 Identities = 45/348 (12%), Positives = 90/348 (25%), Gaps = 26/348 (7%)

Query: 25  VQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGS-GLDIVSE 83
           V  P        +E N              +    K      + +     G+ G+ + + 
Sbjct: 44  VSLPAAVLYADRVEHNLKWMQAFVAEYGVKLAPHGKTTMAPQLFRRQLETGAWGITLATA 103

Query: 84  GELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN---VESESELKTLNQRAVSL 140
            ++R A    V    +    VG+    +   L S         V+S   ++ L +   S+
Sbjct: 104 HQVRAAYHGGVSRVLMANQLVGRRNMMMVAELLSDPEFEFFCLVDSVEGVEQLGEFFKSV 163

Query: 141 GKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHI 200
            K+  +   +         +  +              + ++  Y  TL    +   +  +
Sbjct: 164 NKQLQVLLELGVPGGRTGVRDAA---------QRNAVLEAITRYPDTLKLAGVELYEGVL 214

Query: 201 GSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLI 260
             + +  E    A  + R+L +Q R           G G             +S+   + 
Sbjct: 215 KEEHEVREFLQSAVAVTRELVEQERFARAPAVL--SGAGSAWYDVVAEEFVKASETGKVE 272

Query: 261 HQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAY 320
                       L PG +L  DVGI       I         + +  +          + 
Sbjct: 273 VV----------LRPGCYLTHDVGIYRKAQTDIFARNPVAKKMGEGLLPALQLWAYVQSI 322

Query: 321 HEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYI 368
            E +  +   G R     D   P               +         
Sbjct: 323 PEPDRAIIGLGKR-DSAFDAGMPEPARHYRPGNEAPRDIAASEGWEIF 369


>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate
           synthase; menaquinone, THDP, metal, Mg, vitamin K2,
           carboxylase, magnesium; HET: AKG; 1.95A {Escherichia
           coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A*
          Length = 556

 Score = 32.7 bits (73), Expect = 0.17
 Identities = 11/62 (17%), Positives = 21/62 (33%)

Query: 101 FSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHK 160
           F  + + +     A    +     ++  EL+T    A        I   VN    A T +
Sbjct: 488 FYLMPQNVHFEHAAAMFELKYHRPQNWQELETAFADAWRTPTTTVIEMVVNDTDGAQTLQ 547

Query: 161 KI 162
           ++
Sbjct: 548 QL 549


>3keg_A FMN-dependent NADH-azoreductase 1; Y131F azoreductase, methyl RED,
           flavoprotein, oxidoreductase; HET: FMN MRE GOL; 2.10A
           {Pseudomonas aeruginosa} PDB: 2v9c_A*
          Length = 212

 Score = 32.5 bits (73), Expect = 0.20
 Identities = 26/129 (20%), Positives = 41/129 (31%), Gaps = 16/129 (12%)

Query: 24  VVQTPFYCYSTTAIEKNYL--------TFSNAFDGMDTMVCYALKANSNQAVIKTLAHLG 75
           V+ TP Y +S  +  K ++        TF    D         L+        + L    
Sbjct: 92  VISTPMYNFSVPSGLKAWIDQIVRLGVTFDFVLDNGVAQFRPLLRGK------RALIVTS 145

Query: 76  SGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQ 135
            G      G   +A+    P  R     +G  IDE+ +    G        E       Q
Sbjct: 146 RGGHGFGPGGENQAMNHADPWLRTALGFIG--IDEVTVVAAEGEESGGRSFEDSCDEAEQ 203

Query: 136 RAVSLGKKA 144
           R ++L + A
Sbjct: 204 RLLALARSA 212


>3c8o_A Regulator of ribonuclease activity A; RRAA, PAO1, RNAse E
           regulater, hydrolase regulator; HET: PGE PG4; 1.90A
           {Pseudomonas aeruginosa}
          Length = 162

 Score = 31.2 bits (71), Expect = 0.46
 Identities = 15/63 (23%), Positives = 23/63 (36%), Gaps = 5/63 (7%)

Query: 314 PTLYDAYHEINYIVNPAGDRLHIHADIVGPICET----GDFIALNRKIALPRPGDLLYIE 369
           P L DAY E+  +V P            G I  T     D   +  ++     G +L ++
Sbjct: 6   PDLCDAYPELVQVVEPMFSNFGGRDSFGGEIV-TIKCFEDNSLVKEQVDKDGKGKVLVVD 64

Query: 370 KTG 372
             G
Sbjct: 65  GGG 67


>1vi4_A Regulator of ribonuclease acivity A protein 1; structural genomics,
           unknown function; 1.87A {Vibrio cholerae} SCOP: c.8.7.1
          Length = 174

 Score = 31.1 bits (70), Expect = 0.54
 Identities = 14/69 (20%), Positives = 23/69 (33%), Gaps = 6/69 (8%)

Query: 308 MNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPI----CETGDFIALNRKIALPRPG 363
           M D   P L D Y     ++N         +   G I    C   D   +   ++    G
Sbjct: 4   MRDIT-PDLCDKYESQVTLLNLPLQNFGQRSAFWGEIVTVRCY-HDNSKVRDVLSQNGKG 61

Query: 364 DLLYIEKTG 372
            +L ++  G
Sbjct: 62  KVLVVDGHG 70


>1q5x_A Regulator of RNAse E activity A; 3-layer sandwich, alpha-beta
           structure, parallel beta sheet, antiparallel beta sheet,
           hydrolase inhibitor; 2.00A {Escherichia coli} SCOP:
           c.8.7.1
          Length = 161

 Score = 30.6 bits (69), Expect = 0.67
 Identities = 15/67 (22%), Positives = 21/67 (31%), Gaps = 5/67 (7%)

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPI----CETGDFIALNRKIALPRPGDL 365
            +    L D Y E   +V P        A   G I    C   D   L   +     G +
Sbjct: 2   KYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCF-EDNGLLYDLLEQNGRGRV 60

Query: 366 LYIEKTG 372
           L ++  G
Sbjct: 61  LVVDGGG 67


>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate
           synthase; menaquinone biosynthesis, sephchc synthase,
           structural genomics; 2.60A {Listeria monocytogenes}
          Length = 578

 Score = 29.4 bits (65), Expect = 1.7
 Identities = 15/73 (20%), Positives = 23/73 (31%), Gaps = 3/73 (4%)

Query: 93  PVPAERIVFSGVGKTIDEID---LALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFR 149
           P   E   F  +  T  E+D    A          +S  EL+    +A        I  +
Sbjct: 498 PQANEPKYFESLFGTSTELDFRFAAAFYDADYHEAKSVDELEEAIDKASYHKGLDIIEVK 557

Query: 150 VNPDINANTHKKI 162
            N   N   H+ +
Sbjct: 558 TNRHENKANHQAL 570


>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate
           synthase; transferase, metal-binding; HET: TPP; 2.35A
           {Bacillus subtilis}
          Length = 604

 Score = 29.0 bits (64), Expect = 2.0
 Identities = 13/73 (17%), Positives = 21/73 (28%), Gaps = 3/73 (4%)

Query: 93  PVPAERIVFSGVGKTIDEID---LALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFR 149
           P  +E+  F  +  T   +D    A   G       S  E KT             I  +
Sbjct: 518 PQASEKTHFEDLFGTPTGLDFKHAAALYGGTYSCPASWDEFKTAYAPQADKPGLHLIEIK 577

Query: 150 VNPDINANTHKKI 162
            +       H+ +
Sbjct: 578 TDRQSRVQLHRDM 590


>3cvo_A Methyltransferase-like protein of unknown function; YP_167254.1,
           structural genomics, joint center for structural
           genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter
           pomeroyi dss-3}
          Length = 202

 Score = 28.8 bits (64), Expect = 2.3
 Identities = 23/148 (15%), Positives = 44/148 (29%), Gaps = 24/148 (16%)

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVG--GGLG 241
            A+ LPG  ++ V+           ++ +  K              NI   D+G  G  G
Sbjct: 45  VAAELPGKHVTSVESD--------RAWARMMKAWLAANPPAEGTEVNIVWTDIGPTGDWG 96

Query: 242 IAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTF 301
                        DY   + +  G     ++L  GRF V         + +         
Sbjct: 97  HPVSDAKWRSYP-DYPLAVWRTEGFRHPDVVLVDGRFRVGCA------LATAFSITRPVT 149

Query: 302 VILDVAMNDFMRPTLYDAYHEINYIVNP 329
           ++ D    D+ +       H++   +  
Sbjct: 150 LLFD----DYSQR---RWQHQVEEFLGA 170


>2pcn_A S-adenosylmethionine:2-demethylmenaquinone methyltransferase; beta,
           beta alpha domain, 2-dimethylmenaquinone
           methyltransferase; 1.90A {Geobacillus kaustophilus
           HTA426}
          Length = 161

 Score = 28.4 bits (63), Expect = 3.1
 Identities = 9/63 (14%), Positives = 19/63 (30%), Gaps = 5/63 (7%)

Query: 314 PTLYDAYHEINYIVNPA----GDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
             L D + +   +        G +      I        D + +   +    PG +L ++
Sbjct: 4   ADLCDQFLDELQVCELPFQSYGGKRMFSGPIATVDVF-EDNVLVREALETVPPGTVLVVD 62

Query: 370 KTG 372
             G
Sbjct: 63  GKG 65


>3i08_A Neurogenic locus notch homolog protein 1; SEA domain, LIN-12 notch
           repeat, LNR, heterodimerization domain, HD, activator,
           ANK repeat, calcium; 3.20A {Homo sapiens}
          Length = 220

 Score = 28.5 bits (63), Expect = 3.3
 Identities = 6/36 (16%), Positives = 19/36 (52%)

Query: 192 KISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSN 227
           +++   + +   +   +  + +F  LR+L++ L +N
Sbjct: 124 RLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTN 159


>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate,
           flavoprotein, lyase, thiamine pyrophosphate; HET: TZD
           ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3
           c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A*
           2jib_A*
          Length = 568

 Score = 28.1 bits (61), Expect = 4.0
 Identities = 11/38 (28%), Positives = 18/38 (47%)

Query: 118 GIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDIN 155
           G   +   + +ELK   + AV+ GK   I   ++PD  
Sbjct: 513 GGKGYVANTPAELKAALEEAVASGKPCLINAMIDPDAG 550


>2pq7_A Predicted HD superfamily hydrolase; 104161995, HD domain,
           structural genomics, joint center for structural
           genomics, JCSG; HET: MSE; 1.45A {Uncultured
           thermotogales bacterium} SCOP: a.211.1.1
          Length = 220

 Score = 27.8 bits (61), Expect = 5.4
 Identities = 6/37 (16%), Positives = 17/37 (45%)

Query: 198 MHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHI 234
           M++   +++I    +   ++R+  +      H+I H 
Sbjct: 2   MNLTELMERIPHLREILNIVREAFKDYDDPAHDISHT 38


>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme,
           megasynthase, fatty acid synthesis; 3.2A {Sus scrofa}
           PDB: 2vz9_A*
          Length = 2512

 Score = 27.4 bits (60), Expect = 5.7
 Identities = 9/46 (19%), Positives = 19/46 (41%), Gaps = 3/46 (6%)

Query: 217 LRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQ 262
           + +  QQL+     ++ +  GG   IA+HS      +      + +
Sbjct: 658 MSEFLQQLKREDVFVKEVRTGG---IAFHSYFMESIAPTLLRQLRK 700


>1uoc_A POP2; hydrolase, DEDD nuclease, mRNA degradation, poly(A) tail,
           transcription regulation, repressor, phosphorylation.;
           2.3A {Saccharomyces cerevisiae} SCOP: c.55.3.9
          Length = 289

 Score = 27.2 bits (60), Expect = 7.8
 Identities = 8/44 (18%), Positives = 16/44 (36%), Gaps = 5/44 (11%)

Query: 229 HNIQHIDVGGGLGIAY-----HSDHRPPSSSDYASLIHQYFGNL 267
            ++  I       + +      +D  P +  D+   +HQY  N 
Sbjct: 154 DSVTWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNF 197


>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller,
           endocytosis/exocytosis complex; 7.90A {Bos taurus} SCOP:
           i.23.1.1 PDB: 1xi5_A
          Length = 1630

 Score = 27.0 bits (60), Expect = 8.3
 Identities = 14/59 (23%), Positives = 26/59 (44%), Gaps = 5/59 (8%)

Query: 97  ERIVFSGVGKTIDEIDLAL--QSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPD 153
           + + F    K I    +AL   + +Y +++E ES+   +  R  SL     I +R +  
Sbjct: 106 DDVTF---WKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAK 161


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.320    0.137    0.397 

Gapped
Lambda     K      H
   0.267   0.0467    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 3,682,415
Number of extensions: 173360
Number of successful extensions: 625
Number of sequences better than 10.0: 1
Number of HSP's gapped: 551
Number of HSP's successfully gapped: 45
Length of query: 431
Length of database: 5,693,230
Length adjustment: 95
Effective length of query: 336
Effective length of database: 3,390,050
Effective search space: 1139056800
Effective search space used: 1139056800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 58 (26.8 bits)