HHsearch alignment for GI: 254780372 and conserved domain: PRK12796

>PRK12796 spaP surface presentation of antigens protein SpaP; Provisional.
Probab=100.00  E-value=0  Score=584.67  Aligned_cols=210  Identities=25%  Similarity=0.582  Sum_probs=196.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             48999999999999999999999748999999999995302022433799999999999998789999999975084334
Q gi|254780372|r   37 TWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMN  116 (246)
Q Consensus        37 ~~~iqll~llt~LsL~P~ilim~TsFtrIvIVLsilRnALG~QQ~PPN~Vl~gLALfLT~fVM~Pv~~~i~~~a~~P~~~  116 (246)
T Consensus         2 s~~lqil~lltvlsl~P~ilim~TsFtrivIVLs~lR~ALG~QQ~PPn~Vl~gLALfLT~fVM~Pv~~~~~~~~~~~~~~   81 (219)
T PRK12796          2 SNDISLIALLAFFTLLPFIIASGTCFIKFSIVFVMVRNALGLQQVPSNMTLNGIALLLSMFVMMPVAQDAYVYFQNEPVD   81 (219)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             82699999999999999999999746999999999998727677983899999999999999999999999988606778


Q ss_pred             --CCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCC--CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             --887999999999889999999629989999999850656776544--6734586689989998999999999999999
Q gi|254780372|r  117 --NQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDI--TKNDHIEYRILIPSFMISELRRSFEIGFLII  192 (246)
Q Consensus       117 --~~i~~~~a~~~~~~Plr~FM~~~t~~~dl~~f~~~a~~~~~~~~~--~~~~~~~~~vLiPAF~iSEL~~aF~iGfliy  192 (246)
T Consensus        82 ~~~~~~~~~~~~~~~~p~~~fm~~~t~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~vLiPAF~iSEL~~AF~IGflly  161 (219)
T PRK12796         82 FNNIASVVKFVDEGLGGYKDYLIKYSDPELVRFFERAQLKRSYGDEAEAADRDKPSLFSLLPAYALSEIKSAFKIGFYLY  161 (219)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             55467899999976589999999808999999999973526665455657865565367618999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             999999999999999975554273489999999999997428999999987519
Q gi|254780372|r  193 LPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI  246 (246)
Q Consensus       193 lPFlvIDlvVa~iLmamGMmMl~P~~iSlPfKlllFV~vdGW~ll~~~Lv~sy~  246 (246)
T Consensus       162 lPFlvIDlvVAsvLmamGMmMlpP~~ISLPfKlllFVlvDGW~ll~~~Lv~Sy~  215 (219)
T PRK12796        162 LPFVVVDLVVSSVLLALGMMMMSPVTISVPIKLILFVAMDGWTLLSKGLILQYL  215 (219)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             999999999999999821200580587666788898631619999999999998