HHsearch alignment for GI: 254780372 and conserved domain: TIGR01103

>TIGR01103 fliP flagellar biosynthetic protein FliP; InterPro: IPR005837 This model describes bacterial flagellar biogenesis protein fliP, which is one of the genes within the motility locus on the bacterial chromosome that is involved in structure and function of bacterial flagellum. It was demonstrated that mutants in fliP locus were non-flagellated and non-motile, while revertants were flagellated and motile. In Escherichia coli and related proteins the fliP protein probably plays a role in the transport of flagellar proteins. FliP is a protein of about 30 Kd which contains three or four transmembrane regions. Proteins evolutionary related to fliP have been found in a wide range of bacteria (mopC, hrcR, hrpW, spaP, yscR, etc.) and are involved in a variety of signal-peptide independent secretion systems. ; GO: 0009306 protein secretion, 0016020 membrane.
Probab=100.00  E-value=0  Score=662.51  Aligned_cols=199  Identities=54%  Similarity=0.992  Sum_probs=194.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHH
Q ss_conf             99999999999999974899999999999530202243379999999999999878999999997508433488799999
Q gi|254780372|r   45 IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTA  124 (246)
Q Consensus        45 llt~LsL~P~ilim~TsFtrIvIVLsilRnALG~QQ~PPN~Vl~gLALfLT~fVM~Pv~~~i~~~a~~P~~~~~i~~~~a  124 (246)
T Consensus         1 LLT~lS~aP~iL~lmTSF~RivIVl~~lR~ALglq~~PpNqvL~gLALFLT~FvMaPtF~~iy~~a~~PL~~~qI~~~~A   80 (202)
T TIGR01103         1 LLTVLSLAPAILILMTSFTRIVIVLSLLRRALGLQSTPPNQVLLGLALFLTFFVMAPTFDRIYDDALQPLLDNQISLQEA   80 (202)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCCCCCHHHH
T ss_conf             74899998899999977899999999998530268998658899899999999725068889998615400276688999


Q ss_pred             HHHHHHHHHHHHHHHCCHH---HHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999889999999629989---9999998506567765446734586689989998999999999999999999999999
Q gi|254780372|r  125 IQRVAEPFWVFMRNNTREK---DLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMI  201 (246)
Q Consensus       125 ~~~~~~Plr~FM~~~t~~~---dl~~f~~~a~~~~~~~~~~~~~~~~~~vLiPAF~iSEL~~aF~iGfliylPFlvIDlv  201 (246)
T Consensus        81 ~~~~~~P~r~FM~~q~~~~r~~dl~LF~~~A~~~~~~--v~~~~~vP~~vl~PAF~~sELk~AF~IGfliflPFLiiDlv  158 (202)
T TIGR01103        81 YQKAAEPLREFMLRQTRDKRHEDLALFMRLAKIPKPV--VQTLEEVPLRVLVPAFILSELKTAFQIGFLIFLPFLIIDLV  158 (202)
T ss_pred             HHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCC--CCCCCCCCCEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9998899999757765004726899999997168621--04611166253378999999898998859999999999999


Q ss_pred             HHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999997555427348999999999999742899999998751
Q gi|254780372|r  202 VATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF  245 (246)
Q Consensus       202 Va~iLmamGMmMl~P~~iSlPfKlllFV~vdGW~ll~~~Lv~sy  245 (246)
T Consensus       159 VASvLMaMGMmMLPP~~ISLPFKl~LFVLVDGW~Ll~~sL~~SF  202 (202)
T TIGR01103       159 VASVLMAMGMMMLPPVSISLPFKLLLFVLVDGWNLLVGSLVQSF  202 (202)
T ss_pred             HHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999742240457310330068888888877899986541259