BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780372|ref|YP_003064785.1| flagellar biosynthesis protein
FliP [Candidatus Liberibacter asiaticus str. psy62]
         (246 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780372|ref|YP_003064785.1| flagellar biosynthesis protein FliP [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040049|gb|ACT56845.1| flagellar biosynthesis protein FliP [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 246

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 246/246 (100%), Positives = 246/246 (100%)

Query: 1   MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVT 60
           MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVT
Sbjct: 1   MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVT 60

Query: 61  CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT 120
           CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT
Sbjct: 61  CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT 120

Query: 121 ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE 180
           ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE
Sbjct: 121 ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE 180

Query: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVEN 240
           LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVEN
Sbjct: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVEN 240

Query: 241 LVKSFI 246
           LVKSFI
Sbjct: 241 LVKSFI 246


>gi|315121841|ref|YP_004062330.1| flagellar biosynthesis protein FliP [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495243|gb|ADR51842.1| flagellar biosynthesis protein FliP [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 246

 Score =  434 bits (1117), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/246 (85%), Positives = 232/246 (94%)

Query: 1   MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVT 60
           MIRY FF  F V PE VFA+SSLHD+M IP +LS+STWIVRTFG+FTILSI PILLIMVT
Sbjct: 1   MIRYLFFGFFFVVPESVFAQSSLHDIMEIPPNLSVSTWIVRTFGLFTILSIVPILLIMVT 60

Query: 61  CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT 120
           CFPRFIIVFSILRTGMGMGS+PPNLVIISLALFMTFYVMSPTLDRSIEMG+QPL++N+IT
Sbjct: 61  CFPRFIIVFSILRTGMGMGSIPPNLVIISLALFMTFYVMSPTLDRSIEMGVQPLISNKIT 120

Query: 121 ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE 180
           ET AI+R+AEPFW+FM+NNTREKDL LFM+MA S+H+NTDI K+DHIEYRILIPSFMISE
Sbjct: 121 ETVAIKRIAEPFWIFMKNNTREKDLFLFMEMAKSTHKNTDIKKDDHIEYRILIPSFMISE 180

Query: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVEN 240
           LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK+IFFVLIDGW LLVEN
Sbjct: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKIIFFVLIDGWGLLVEN 240

Query: 241 LVKSFI 246
           LV+SF+
Sbjct: 241 LVRSFV 246


>gi|86356318|ref|YP_468210.1| flagellar biosynthesis protein FliP [Rhizobium etli CFN 42]
 gi|86280420|gb|ABC89483.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CFN
           42]
          Length = 245

 Score =  326 bits (836), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 154/246 (62%), Positives = 200/246 (81%), Gaps = 3/246 (1%)

Query: 1   MIRY-CFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           MIR+  F A  +  PEL  A+    D++N+P D S++ WI+RTFG+ T+LS+AP +LIMV
Sbjct: 1   MIRFIVFLAAMMAVPELAVAQQLPTDLLNVPVDGSVAAWIIRTFGLLTVLSVAPGILIMV 60

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T FPRF+I FSILR+GMG+ S P N++++SL+LFMTFYVMSPT D++ + G+QPL+ NQI
Sbjct: 61  TSFPRFVIAFSILRSGMGLSSTPSNMILLSLSLFMTFYVMSPTFDQAWQNGVQPLLANQI 120

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
            ET A+QR+AEPF  FM  NTR+KDL+LF+D+A    R  +I   D I+YR+LIP+FMIS
Sbjct: 121 NETEAVQRIAEPFRTFMAANTRDKDLALFVDLAR--ERGQNIQTTDPIDYRVLIPAFMIS 178

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           E+RR FEIGFL++LPFL+ID+IVATI MAMGMMMLPPTSISLPFK++FFVLIDGW+LLV 
Sbjct: 179 EIRRGFEIGFLVVLPFLVIDLIVATITMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVG 238

Query: 240 NLVKSF 245
           +LV+SF
Sbjct: 239 SLVRSF 244


>gi|116250488|ref|YP_766326.1| flagellar biosynthesis protein FliP [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|241203112|ref|YP_002974208.1| flagellar biosynthesis protein FliP [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|115255136|emb|CAK06210.1| putative flagellar biosynthetic protein FliP [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|240857002|gb|ACS54669.1| flagellar biosynthetic protein FliP [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 245

 Score =  326 bits (835), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 199/246 (80%), Gaps = 3/246 (1%)

Query: 1   MIRY-CFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           MIR   F A  +  PEL  A+    D++N+P D S++ WI+RTFG+ TILS+AP +LIMV
Sbjct: 1   MIRLIVFLAAMMAVPELAVAQQLPTDLLNVPVDGSVAAWIIRTFGLLTILSVAPGILIMV 60

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T FPRFII FSILR+GMG+ S P N++++SL+LFMTFYVMSPT D++ + G+QPL+ NQI
Sbjct: 61  TSFPRFIIAFSILRSGMGLSSTPSNMILLSLSLFMTFYVMSPTFDQAWQNGVQPLLANQI 120

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
            ET A+QR+AEPF  FM  NTR+KDL+LF+D+A    R  +I   D I+YR+LIP+FMIS
Sbjct: 121 NETEAVQRIAEPFRTFMAANTRDKDLALFVDLAR--ERGQNIQTTDPIDYRVLIPAFMIS 178

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           E+RR FEIGFL++LPFL+ID+IVATI MAMGMMMLPPTSISLPFK++FFVLIDGW+LLV 
Sbjct: 179 EIRRGFEIGFLVVLPFLVIDLIVATITMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVG 238

Query: 240 NLVKSF 245
           +LV+SF
Sbjct: 239 SLVRSF 244


>gi|190890369|ref|YP_001976911.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
 gi|190695648|gb|ACE89733.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
 gi|327193042|gb|EGE59954.1| flagellar biosynthesis transmembrane protein [Rhizobium etli
           CNPAF512]
          Length = 245

 Score =  325 bits (834), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 154/246 (62%), Positives = 200/246 (81%), Gaps = 3/246 (1%)

Query: 1   MIRYC-FFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           MIR+  F A  +  PEL  A+    D++N+P D S++ WI+RTFG+ T+LS+AP +LIMV
Sbjct: 1   MIRFIIFLAAMMAVPELAVAQQLPTDLLNVPVDGSVAAWIIRTFGLLTVLSVAPGILIMV 60

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T FPRF+I FSILR+GMG+ S P N++++SL+LFMTFYVMSPT D++ + G+QPL+ NQI
Sbjct: 61  TSFPRFVIAFSILRSGMGISSTPSNMILLSLSLFMTFYVMSPTFDQAWQNGVQPLLANQI 120

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
            ET A+QR+AEPF  FM  NTR+KDL+LF+D+A    R  +I   D I+YR+LIP+FMIS
Sbjct: 121 NETEAVQRIAEPFRTFMAANTRDKDLALFVDLAR--ERGQNIQTTDPIDYRVLIPAFMIS 178

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           E+RR FEIGFL++LPFL+ID+IVATI MAMGMMMLPPTSISLPFK++FFVLIDGW+LLV 
Sbjct: 179 EIRRGFEIGFLVVLPFLVIDLIVATITMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVG 238

Query: 240 NLVKSF 245
           +LV+SF
Sbjct: 239 SLVRSF 244


>gi|209547934|ref|YP_002279851.1| flagellar biosynthesis protein FliP [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533690|gb|ACI53625.1| flagellar biosynthetic protein FliP [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 245

 Score =  325 bits (832), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 198/246 (80%), Gaps = 3/246 (1%)

Query: 1   MIRY-CFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           MIR   F A  +  PEL  A+    D++N+P D S++ WI+RTFG+ TILS+AP +LIMV
Sbjct: 1   MIRLIVFLAAMMAVPELAVAQQLPTDLLNVPVDGSVAAWIIRTFGLLTILSVAPGILIMV 60

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T FPRFII FSILR+GMG+ S P N++++SL+LFMTFYVMSPT D++ + G+QPL+ NQI
Sbjct: 61  TSFPRFIIAFSILRSGMGLSSTPSNMILLSLSLFMTFYVMSPTFDQAWQNGVQPLLANQI 120

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
            ET A+QR+AEPF  FM  NTR+KDL+LF+D+A    R   I   D I+YR+LIP+FMIS
Sbjct: 121 NETEAVQRIAEPFRTFMAANTRDKDLALFVDLAR--ERGQTIQTTDPIDYRVLIPAFMIS 178

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           E+RR FEIGFL++LPFL+ID+IVATI MAMGMMMLPPTSISLPFK++FFVLIDGW+LLV 
Sbjct: 179 EIRRGFEIGFLVVLPFLVIDLIVATITMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVG 238

Query: 240 NLVKSF 245
           +LV+SF
Sbjct: 239 SLVRSF 244


>gi|218460348|ref|ZP_03500439.1| flagellar biosynthesis protein FliP [Rhizobium etli Kim 5]
          Length = 245

 Score =  324 bits (831), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 154/246 (62%), Positives = 199/246 (80%), Gaps = 3/246 (1%)

Query: 1   MIRYC-FFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           MIR+  F    +  PEL  A+    D++N+P D S++ WI+RTFG+ TILS+AP +LIMV
Sbjct: 1   MIRFIIFLTAMMAVPELAVAQQLPTDLLNVPVDGSVAAWIIRTFGLLTILSVAPGILIMV 60

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T FPRF+I FSILR+GMG+ S P N++++SL+LFMTFYVMSPT D++ + G+QPL+ NQI
Sbjct: 61  TSFPRFVIAFSILRSGMGLSSTPSNMILLSLSLFMTFYVMSPTFDQAWQSGVQPLLANQI 120

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
            ET A+QR+AEPF  FM  NTR+KDL+LF+D+A    R   I  +D I+YR+LIP+FMIS
Sbjct: 121 NETEAVQRIAEPFRTFMAANTRDKDLALFVDLAR--ERGQTIQTSDPIDYRVLIPAFMIS 178

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           E+RR FEIGFL++LPFL+ID+IVATI MAMGMMMLPPTSISLPFK++FFVLIDGW+LLV 
Sbjct: 179 EIRRGFEIGFLVVLPFLVIDLIVATITMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVG 238

Query: 240 NLVKSF 245
           +LV+SF
Sbjct: 239 SLVRSF 244


>gi|222084871|ref|YP_002543400.1| flagellar biosynthesis transmembrane protein [Agrobacterium
           radiobacter K84]
 gi|221722319|gb|ACM25475.1| flagellar biosynthesis transmembrane protein [Agrobacterium
           radiobacter K84]
          Length = 252

 Score =  309 bits (792), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 147/239 (61%), Positives = 194/239 (81%), Gaps = 6/239 (2%)

Query: 11  LVTPELVFAKSSLH----DVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFI 66
           +++PEL  A+        D++N P + S++ WI+RTFG+ TILSIAP +LIMVT FPRFI
Sbjct: 15  ILSPELAMAQQLSQQIPTDLLNTPVNGSVAAWIIRTFGLLTILSIAPGILIMVTSFPRFI 74

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           I FSILR+GMG+ + P N++++SLALFMTFYVMSPT D++ + G QPL+ NQI+E  A+ 
Sbjct: 75  IAFSILRSGMGLATTPSNMILLSLALFMTFYVMSPTFDQAWKDGAQPLLANQISEADAVM 134

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           R+AEPF  FM NNTR+KD+ LF+D+A    R   +  ++ I+YR+LIP+FMISE+RR FE
Sbjct: 135 RIAEPFRTFMANNTRDKDIKLFVDLAQ--ERGQTVVIDNKIDYRVLIPAFMISEIRRGFE 192

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGFL++LPFL+ID+IV+TIVMAMGMMMLPPTSISLPFK++FFVLIDGW+LLV +LV+SF
Sbjct: 193 IGFLVVLPFLVIDLIVSTIVMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVGSLVRSF 251


>gi|15887892|ref|NP_353573.1| flagellar biosynthesis protein FliP [Agrobacterium tumefaciens str.
           C58]
 gi|2494560|sp|Q44344|FLIP_AGRT5 RecName: Full=Flagellar biosynthetic protein fliP
 gi|1086567|gb|AAB68974.1| FliP [Agrobacterium tumefaciens]
 gi|2459720|gb|AAB71796.1| FliP [Agrobacterium tumefaciens]
 gi|15155484|gb|AAK86358.1| flagellar biosynthetic protein [Agrobacterium tumefaciens str. C58]
          Length = 245

 Score =  306 bits (785), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 147/246 (59%), Positives = 193/246 (78%), Gaps = 3/246 (1%)

Query: 1   MIRYCF-FALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           MIR+    A+ L  P L  A+    D+ N   D S++ WI+RTFG+ T+LS+AP +LIMV
Sbjct: 1   MIRFLVTIAVLLALPGLANAQQFPSDLFNTQIDGSVAAWIIRTFGLLTVLSVAPGILIMV 60

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T FPRF+I FSILR+GMG+ S P N++++S+A+FMTFYVMSPT D++   G+QPL+ NQI
Sbjct: 61  TSFPRFVIAFSILRSGMGLASTPSNMILLSMAMFMTFYVMSPTFDKAWTDGVQPLLQNQI 120

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
            E  A+QR+AEPF  FM  NTR+KDL LF+D+A    R   +  ++ ++YR+L+P+FM+S
Sbjct: 121 NEQQAVQRIAEPFRTFMNANTRDKDLKLFVDIAR--ERGQVVMTDNVVDYRVLVPAFMLS 178

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           E+RR FEIGFLIILPFL+ID+IVATI MAMGMMMLPPTSISLPFK++FFVLIDGW+LLV 
Sbjct: 179 EIRRGFEIGFLIILPFLVIDLIVATITMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVG 238

Query: 240 NLVKSF 245
           +LV+SF
Sbjct: 239 SLVRSF 244


>gi|222147577|ref|YP_002548534.1| flagellar biosynthesis protein FliP [Agrobacterium vitis S4]
 gi|221734565|gb|ACM35528.1| flagellar biosynthetic protein [Agrobacterium vitis S4]
          Length = 245

 Score =  306 bits (783), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 193/246 (78%), Gaps = 3/246 (1%)

Query: 1   MIR-YCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           MIR     A  +  PEL  A+    + +  P D S++ WI+RTFG+ T+LS+AP +LIMV
Sbjct: 1   MIRTLILIAAMIAAPELAQAQQLPSNFLTAPVDGSVAAWIIRTFGLLTVLSVAPGILIMV 60

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T FPRF+I FSILR+GMG+ S P N+++ SLALFMTFYVM+P +D++   G++PL++NQI
Sbjct: 61  TSFPRFVIAFSILRSGMGLSSTPSNMILTSLALFMTFYVMTPVMDQAWRDGVRPLLDNQI 120

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           TE  A+ R+AEPF  FM NNTREKDL LF+D+A+   + T +     ++YR+LIP+FM+S
Sbjct: 121 TEAEAVPRIAEPFRGFMSNNTREKDLRLFIDLANERGQTTVV--EGKVDYRVLIPAFMLS 178

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           E+RR FEIGFLIILPFL+IDMIV+TI MAMGMMMLPPTSISLPFK++FFVLIDGW+LLV 
Sbjct: 179 EIRRGFEIGFLIILPFLVIDMIVSTITMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVG 238

Query: 240 NLVKSF 245
           +LV+SF
Sbjct: 239 SLVRSF 244


>gi|325291933|ref|YP_004277797.1| flagellar biosynthesis protein FliP [Agrobacterium sp. H13-3]
 gi|325059786|gb|ADY63477.1| flagellar biosynthesis protein FliP [Agrobacterium sp. H13-3]
          Length = 245

 Score =  302 bits (774), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 192/246 (78%), Gaps = 3/246 (1%)

Query: 1   MIRYCF-FALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           MIR+    A+ +  P L  A+    D+ N   D S++ WI+RTFG+ T+LS+AP +LIMV
Sbjct: 1   MIRFLVTIAVLVALPGLANAQQFPTDLFNTQIDGSVAAWIIRTFGLLTVLSVAPGILIMV 60

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T FPRF+I FSILR+GMG+ S P N++++S+A+FMTFYVMSPT D++   G+QPL+ NQI
Sbjct: 61  TSFPRFVIAFSILRSGMGLASTPSNMILLSMAMFMTFYVMSPTFDKAWTDGVQPLLQNQI 120

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
            E  AI R+AEPF  FM  NTR+KDL LF+D+A    R   +  ++ ++YR+L+P+FM+S
Sbjct: 121 NEQQAIGRIAEPFRTFMNANTRDKDLKLFVDIAR--ERGQVVMTDNVVDYRVLVPAFMLS 178

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           E+RR FEIGFLIILPFL+ID+IVATI MAMGMMMLPPTSISLPFK++FFVLIDGW+LLV 
Sbjct: 179 EIRRGFEIGFLIILPFLVIDLIVATITMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVG 238

Query: 240 NLVKSF 245
           +LV+SF
Sbjct: 239 SLVRSF 244


>gi|307318918|ref|ZP_07598349.1| flagellar biosynthetic protein FliP [Sinorhizobium meliloti AK83]
 gi|12057226|gb|AAB81419.2| FliP [Sinorhizobium meliloti]
 gi|306895332|gb|EFN26087.1| flagellar biosynthetic protein FliP [Sinorhizobium meliloti AK83]
          Length = 245

 Score =  299 bits (765), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 197/247 (79%), Gaps = 3/247 (1%)

Query: 1   MIRYCFFALFLVT-PELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           M+R+  F + ++    +  A+S   D++N P D S+++WI+RTFG+ T+LS+AP +LIMV
Sbjct: 1   MLRFATFIIAMMAMSGIAGAQSFPADILNTPVDGSVASWIIRTFGLLTVLSVAPGILIMV 60

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T FPRF+I F+ILR+GMG+ + P N++++SLALFMTFYVM+PT DR+   GI PL+ N+I
Sbjct: 61  TSFPRFVIAFAILRSGMGLATTPSNMIMVSLALFMTFYVMAPTFDRAWRDGIDPLLKNEI 120

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           +ET AIQR++EPF  FM  NTR+KDL LF+D+A    +   +  ++ ++ R ++P+FMIS
Sbjct: 121 SETDAIQRMSEPFREFMLANTRDKDLQLFIDIAR--EKGQTVVVDEKVDLRAVVPAFMIS 178

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           E+RR FEIGFLI+LPFL+ID+IVATI MAMGMMMLPPT+ISLPFK++FFVLIDGW+LLV 
Sbjct: 179 EIRRGFEIGFLIMLPFLVIDLIVATITMAMGMMMLPPTAISLPFKILFFVLIDGWNLLVG 238

Query: 240 NLVKSFI 246
           +LV+SFI
Sbjct: 239 SLVRSFI 245


>gi|15964421|ref|NP_384774.1| flagellar biosynthesis protein FliP [Sinorhizobium meliloti 1021]
 gi|307311563|ref|ZP_07591204.1| flagellar biosynthetic protein FliP [Sinorhizobium meliloti BL225C]
 gi|17380428|sp|P37827|FLIP_RHIME RecName: Full=Flagellar biosynthetic protein fliP
 gi|15073598|emb|CAC45240.1| Flagellar biosynthetic transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|306899580|gb|EFN30209.1| flagellar biosynthetic protein FliP [Sinorhizobium meliloti BL225C]
          Length = 245

 Score =  298 bits (762), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 197/247 (79%), Gaps = 3/247 (1%)

Query: 1   MIRYCFFALFLVT-PELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           M+R+  F + ++    +  A+S   D++N P D S+++WI+RTFG+ T+LS+AP +LIMV
Sbjct: 1   MLRFATFIIAMMAMSGIAGAQSFPADILNTPVDGSVASWIIRTFGLLTVLSVAPGILIMV 60

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T FPRF+I F+ILR+GMG+ + P N++++SLALFMTFYVM+PT DR+   GI PL+ N+I
Sbjct: 61  TSFPRFVIAFAILRSGMGLATTPSNMIMVSLALFMTFYVMAPTFDRAWRDGIDPLLKNEI 120

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           +ET A+QR++EPF  FM  NTR+KDL LF+D+A    +   +  ++ ++ R ++P+FMIS
Sbjct: 121 SETDAMQRMSEPFREFMVANTRDKDLQLFIDIAR--EKGQTVVVDEKVDLRAVVPAFMIS 178

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           E+RR FEIGFLI+LPFL+ID+IVATI MAMGMMMLPPT+ISLPFK++FFVLIDGW+LLV 
Sbjct: 179 EIRRGFEIGFLIMLPFLVIDLIVATITMAMGMMMLPPTAISLPFKILFFVLIDGWNLLVG 238

Query: 240 NLVKSFI 246
           +LV+SFI
Sbjct: 239 SLVRSFI 245


>gi|150395491|ref|YP_001325958.1| flagellar biosynthesis protein FliP [Sinorhizobium medicae WSM419]
 gi|150027006|gb|ABR59123.1| flagellar biosynthetic protein FliP [Sinorhizobium medicae WSM419]
          Length = 245

 Score =  297 bits (760), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 140/247 (56%), Positives = 196/247 (79%), Gaps = 3/247 (1%)

Query: 1   MIRYCFFALFLVT-PELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           M+R+  F + ++    +  A+    D++N P D S+++WI+RTFG+ T+LS+AP +LIMV
Sbjct: 1   MLRFATFIIAMMAMSGIAGAQGFPADILNTPVDGSVASWIIRTFGLLTVLSVAPGILIMV 60

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T FPRF+I F+ILR+GMG+ + P N++++SLALFMTFYVM+PT DR+   GI PL+ N+I
Sbjct: 61  TSFPRFVIAFAILRSGMGLATTPSNMIMVSLALFMTFYVMAPTFDRAWRDGIDPLLKNEI 120

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           +ET A+QR++EPF  FM  NTR+KDL LF+D+A    +   +  ++ ++ R ++P+FMIS
Sbjct: 121 SETEAMQRMSEPFREFMLANTRDKDLQLFIDIAQ--EKGQTVVVDEKVDLRAVVPAFMIS 178

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           E+RR FEIGFLI+LPFL+ID+IVATI MAMGMMMLPPT+ISLPFK++FFVLIDGW+LLV 
Sbjct: 179 EIRRGFEIGFLIMLPFLVIDLIVATITMAMGMMMLPPTAISLPFKILFFVLIDGWNLLVG 238

Query: 240 NLVKSFI 246
           +LV+SFI
Sbjct: 239 SLVRSFI 245


>gi|227820864|ref|YP_002824834.1| flagellar biosynthesis protein FliP [Sinorhizobium fredii NGR234]
 gi|227339863|gb|ACP24081.1| flagellar biosynthetic protein FliP [Sinorhizobium fredii NGR234]
          Length = 245

 Score =  296 bits (759), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 138/227 (60%), Positives = 186/227 (81%), Gaps = 2/227 (0%)

Query: 19  AKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           A+S   D++N P D S+++WI+RTFG+ T+LS+AP +LIMVT FPRF+I F+ILR+GMG+
Sbjct: 20  AQSFPADILNTPVDGSVASWIIRTFGLLTVLSVAPGILIMVTSFPRFVIAFAILRSGMGL 79

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            + P N++++SLALFMTFYVM+PT DR+   GI PL+ N+I+ET A+ RV+EPF  FM  
Sbjct: 80  ATTPSNMIMVSLALFMTFYVMAPTFDRAWREGIDPLLKNEISETEALPRVSEPFREFMLA 139

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
           NTR+KDL LF+D+A    +   +  +D ++ R ++P+FMISE+RR FEIGFLI+LPFL+I
Sbjct: 140 NTRDKDLQLFIDIAR--EKGQTVVVDDKVDLRAVVPAFMISEIRRGFEIGFLIMLPFLVI 197

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D+IV+TI MAMGMMMLPPTSISLPFK++FFVLIDGW+LLV +LV+SF
Sbjct: 198 DLIVSTITMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVGSLVRSF 244


>gi|218658525|ref|ZP_03514455.1| flagellar biosynthesis protein FliP [Rhizobium etli IE4771]
          Length = 238

 Score =  296 bits (757), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 177/206 (85%), Gaps = 2/206 (0%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           +RTFG+ TILS+AP +LIMVT FPRF+I FSILR+GMG+ S P N++++SL+LFMTFYVM
Sbjct: 34  IRTFGLLTILSVAPGILIMVTSFPRFVIAFSILRSGMGLSSTPSNMILLSLSLFMTFYVM 93

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SPT D++ + G+QPL+ NQI ET A+QR+AEPF  FM  NTR+KDL+LF+D+A    R  
Sbjct: 94  SPTFDQAWQSGVQPLLANQINETEAVQRIAEPFRTFMAANTRDKDLALFVDLAR--ERGQ 151

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           +I  +D I+YR+LIP+FMISE+RR FEIGFL++LPFL+ID+IVATI MAMGMMMLPPTSI
Sbjct: 152 NIQTSDPIDYRVLIPAFMISEIRRGFEIGFLVVLPFLVIDLIVATITMAMGMMMLPPTSI 211

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++FFVLIDGW+LLV +LV+SF
Sbjct: 212 SLPFKILFFVLIDGWNLLVGSLVRSF 237


>gi|163758021|ref|ZP_02165109.1| putative flagellar biosynthetic protein FliP [Hoeflea phototrophica
           DFL-43]
 gi|162284310|gb|EDQ34593.1| putative flagellar biosynthetic protein FliP [Hoeflea phototrophica
           DFL-43]
          Length = 245

 Score =  292 bits (747), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 136/228 (59%), Positives = 186/228 (81%), Gaps = 2/228 (0%)

Query: 19  AKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           A++    ++  P D S+++WI+RTFG+ T+LS+AP +LIMVT FPRFII F+ILR GMG+
Sbjct: 20  AQALDPGLLQAPLDGSVASWIIRTFGLLTVLSVAPGILIMVTSFPRFIIAFAILRAGMGL 79

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            + P N++++SLALFMTFYVM+PT DR+ E G+ PL+ +QITE  AIQ +A+PF  FM  
Sbjct: 80  ATTPANMILVSLALFMTFYVMAPTFDRAWENGVTPLLEDQITEEEAIQLIADPFRDFMLV 139

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
           NTR KDL+LF+D+A    ++T+   +  I+ R+L+P+FMISE+RR FEIGFL++LPFL+I
Sbjct: 140 NTRPKDLALFVDLATERGQSTE--TDGKIDMRVLVPAFMISEIRRGFEIGFLVVLPFLVI 197

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           D++VATI MAMGMMMLPPT+ISLPFK++FFVLIDGW+LLV +LV+SF+
Sbjct: 198 DLVVATITMAMGMMMLPPTAISLPFKILFFVLIDGWNLLVGSLVRSFV 245


>gi|110632650|ref|YP_672858.1| flagellar biosynthesis protein FliP [Mesorhizobium sp. BNC1]
 gi|110283634|gb|ABG61693.1| flagellar biosynthetic protein FliP [Chelativorans sp. BNC1]
          Length = 246

 Score =  281 bits (718), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 137/215 (63%), Positives = 173/215 (80%), Gaps = 2/215 (0%)

Query: 31  ADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISL 90
           A+ S   +I++ FG+ T+LSIAP +LIMVT F RF+IVFSILRTG+G+ S P NL+++SL
Sbjct: 33  ANGSTIGYIIQIFGLLTVLSIAPGILIMVTSFTRFVIVFSILRTGIGLPSTPANLILVSL 92

Query: 91  ALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMD 150
           ALFMTFYVM+PT DR+   G++PLM NQI ETTA++R+AEPF  FM  N RE+D +LF D
Sbjct: 93  ALFMTFYVMAPTFDRAWSEGVRPLMANQIDETTAVERIAEPFRAFMSANVREEDYTLFAD 152

Query: 151 MAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMG 210
           +A  + R       D  + R+LIP+FMISE+RR FEIGFLI+LPFL+ID+IVATI MAMG
Sbjct: 153 LA--AERGGIQQTTDQADLRVLIPAFMISEIRRGFEIGFLIVLPFLVIDLIVATITMAMG 210

Query: 211 MMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MMMLPPT ISLPFK++FFVLIDGW+LLV +LV+SF
Sbjct: 211 MMMLPPTVISLPFKILFFVLIDGWNLLVGSLVRSF 245


>gi|121601713|ref|YP_989394.1| flagellar biosynthesis protein FliP [Bartonella bacilliformis
           KC583]
 gi|120613890|gb|ABM44491.1| flagellar biosynthetic protein FliP [Bartonella bacilliformis
           KC583]
          Length = 247

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 173/212 (81%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S+S WIV+ FG+ T+LS+AP LL+MVT F RF I FS+LR+G+G+ + PPNLV+ISLALF
Sbjct: 39  SVSGWIVQLFGLLTVLSVAPGLLMMVTSFTRFAIAFSLLRSGLGLQTTPPNLVMISLALF 98

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTFYVM+PT + + E G+QPLM N+ITE  AI ++++PF  FM +  REKDL LF+D++ 
Sbjct: 99  MTFYVMAPTFNAAWEQGVQPLMKNEITEQQAIDKISQPFREFMISQVREKDLDLFVDLSD 158

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            S +   +     I++RIL+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMM
Sbjct: 159 PSFQ---VRTGADIDFRILVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMM 215

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPPT ISLPFK++FFVLIDGW+LLV +L++SF
Sbjct: 216 LPPTVISLPFKILFFVLIDGWNLLVGSLIRSF 247


>gi|260466613|ref|ZP_05812801.1| flagellar biosynthetic protein FliP [Mesorhizobium opportunistum
           WSM2075]
 gi|259029619|gb|EEW30907.1| flagellar biosynthetic protein FliP [Mesorhizobium opportunistum
           WSM2075]
          Length = 243

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 133/242 (54%), Positives = 183/242 (75%), Gaps = 9/242 (3%)

Query: 10  FLVTPELVFAKSSLHDVMNI------PADLSISTWIVRTFGIFTILSIAPILLIMVTCFP 63
           FL+   L+ A +S+     +       AD +   +I++ FG+ T+LS+AP LLIMVT F 
Sbjct: 4   FLLAAALIGATTSIAAAQQLDLGGIGKADGTTVGYIIQMFGLLTVLSVAPGLLIMVTSFT 63

Query: 64  RFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETT 123
           RF+I FSILR G+G+ S P NL++ISL+LFMTFYVM+PT D++   G++PLM+NQI++T 
Sbjct: 64  RFVIAFSILRAGIGLQSTPANLILISLSLFMTFYVMAPTFDQAWNTGVKPLMDNQISQTE 123

Query: 124 AIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRR 183
           A  ++++PF  FM +N R+KD  LF D+A    R   +++ D ++ RIL+P+FMISE+RR
Sbjct: 124 AFDKISDPFRTFMLHNVRDKDFDLFADLAR--ERGQTVSR-DTVDLRILVPAFMISEIRR 180

Query: 184 SFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVK 243
            FEIGFLI+LPFL+ID+IVATI MAMGMMMLPPT +SLPFK++FFVLIDGW+LLV +LV+
Sbjct: 181 GFEIGFLIVLPFLVIDLIVATITMAMGMMMLPPTVVSLPFKILFFVLIDGWNLLVGSLVR 240

Query: 244 SF 245
           SF
Sbjct: 241 SF 242


>gi|319409181|emb|CBI82825.1| Flagellar biosynthetic protein fliP [Bartonella schoenbuchensis R1]
          Length = 253

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 190/252 (75%), Gaps = 11/252 (4%)

Query: 2   IRYCFFALFLVTPEL--VFAK-SSLHDVMNI-----PADLSISTWIVRTFGIFTILSIAP 53
           + + F  L LVT +   VFA+ ++L     +     P D  IS  IV+ FG+ T+LS+AP
Sbjct: 5   VGFVFMMLLLVTTDATDVFAQQTNLASTGGLSGLLAPTDGKISGRIVQLFGLLTVLSVAP 64

Query: 54  ILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQP 113
            LLIMVT F RF+I FS+LR+G+G+ + P NLV+ISLALFMTFYVM+PT + + E G+QP
Sbjct: 65  GLLIMVTSFTRFVIAFSLLRSGLGLQTTPSNLVMISLALFMTFYVMAPTFNTAWEQGVQP 124

Query: 114 LMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILI 173
           L+ N+I+E  AI+++++PF  FM +  REKDL LF+D++  S    ++     I++R+L+
Sbjct: 125 LIKNEISEQKAIEKISQPFREFMISQVREKDLDLFVDLSDPSF---NVKTGADIDFRVLV 181

Query: 174 PSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDG 233
           P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMMLPPT ISLPFK++FFVLIDG
Sbjct: 182 PAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMMLPPTVISLPFKILFFVLIDG 241

Query: 234 WSLLVENLVKSF 245
           W+LLV +L++SF
Sbjct: 242 WNLLVGSLIRSF 253


>gi|319898643|ref|YP_004158736.1| flagellar biosynthetic protein fliP [Bartonella clarridgeiae 73]
 gi|319402607|emb|CBI76152.1| Flagellar biosynthetic protein fliP [Bartonella clarridgeiae 73]
          Length = 250

 Score =  271 bits (692), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 136/243 (55%), Positives = 186/243 (76%), Gaps = 9/243 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADL------SISTWIVRTFGIFTILSIAPILLIMVTCF 62
           + L+T    FA+    + +N  A L      SIS  IV+ FG+ T+LS+AP LLIMVT F
Sbjct: 11  ILLLTTTGAFAQRVGTENVNSLAGLFFSPGVSISGRIVQLFGLLTVLSVAPGLLIMVTSF 70

Query: 63  PRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITET 122
            RF I FS+LRTG+G+ + P NLV+ISLALFM+FYVM+PT + + E G+QPL+NN+I+E 
Sbjct: 71  TRFAIAFSLLRTGLGLQTTPSNLVMISLALFMSFYVMAPTFNTAWEQGVQPLVNNKISEQ 130

Query: 123 TAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELR 182
            AI+++++PF  FM +  REKDL LF+D++ SS +   +     +++R+LIP+FMISELR
Sbjct: 131 QAIEKISQPFREFMISQVREKDLDLFVDLSDSSLQ---VKTGADVDFRVLIPAFMISELR 187

Query: 183 RSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLV 242
           R FEIGFLI+LPFL+ID++VAT+ M+MGMMMLPPT ISLPFK++FFVLIDGW+LLV +L+
Sbjct: 188 RGFEIGFLIVLPFLVIDLVVATLTMSMGMMMLPPTVISLPFKILFFVLIDGWNLLVGSLI 247

Query: 243 KSF 245
           +SF
Sbjct: 248 RSF 250


>gi|319781675|ref|YP_004141151.1| flagellar biosynthetic protein FliP [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167563|gb|ADV11101.1| flagellar biosynthetic protein FliP [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 243

 Score =  270 bits (691), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 173/215 (80%), Gaps = 3/215 (1%)

Query: 31  ADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISL 90
           AD +   +I++ FG+ T+LS+AP LLIMVT F RF+I FSILR G+G+ S P NL++ISL
Sbjct: 31  ADGTTVGYIIQMFGLLTVLSVAPGLLIMVTSFTRFVIAFSILRAGIGLQSTPANLILISL 90

Query: 91  ALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMD 150
           +LFMTFYVM+PT D++   G++PLM+NQIT+T A  ++++PF  FM +N R+KD  LF D
Sbjct: 91  SLFMTFYVMAPTFDQAWNTGVKPLMDNQITQTEAFDKISDPFRTFMLHNVRDKDFDLFAD 150

Query: 151 MAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMG 210
           +A    R   +++ D ++ RIL+P+FMISE+RR FEIGFLI+LPFL+ID+IVATI MAMG
Sbjct: 151 LAR--ERGQTVSR-DTVDLRILVPAFMISEIRRGFEIGFLIVLPFLVIDLIVATITMAMG 207

Query: 211 MMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MMMLPPT +SLPFK++FFVLIDGW+LLV +LV+SF
Sbjct: 208 MMMLPPTVVSLPFKILFFVLIDGWNLLVGSLVRSF 242


>gi|13472582|ref|NP_104149.1| flagellar biosynthesis protein FliP [Mesorhizobium loti MAFF303099]
 gi|14023328|dbj|BAB49935.1| flagellar biosynthesis protein; FliP [Mesorhizobium loti
           MAFF303099]
          Length = 243

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 126/215 (58%), Positives = 172/215 (80%), Gaps = 3/215 (1%)

Query: 31  ADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISL 90
           AD +   +I++ FG+ T+LS+AP LLIMVT F RF+I FSILR G+G+ S P NL++ISL
Sbjct: 31  ADGATVGYIIQMFGLLTVLSVAPGLLIMVTSFTRFVIAFSILRAGIGLQSTPANLILISL 90

Query: 91  ALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMD 150
           +LFMTFYVM+PT D++   G++PLM+NQI++T A +++++PF  FM +N R+KD  LF D
Sbjct: 91  SLFMTFYVMAPTFDQAWNTGVKPLMDNQISQTEAFEKISDPFRTFMLHNVRDKDFDLFAD 150

Query: 151 MAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMG 210
           +A    +   +   + ++ RIL+P+FMISE+RR FEIGFLI+LPFL+ID+IVATI MAMG
Sbjct: 151 LARERGQ---VVAKETVDLRILVPAFMISEIRRGFEIGFLIVLPFLVIDLIVATITMAMG 207

Query: 211 MMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MMMLPPT +SLPFK++FFVLIDGW+LLV +LV+SF
Sbjct: 208 MMMLPPTVVSLPFKILFFVLIDGWNLLVGSLVRSF 242


>gi|319403967|emb|CBI77555.1| Flagellar biosynthetic protein fliP [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 250

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 138/253 (54%), Positives = 189/253 (74%), Gaps = 11/253 (4%)

Query: 1   MIRYCFFAL--FLVTPELVFA-KSSLHDVMNIPA-----DLSISTWIVRTFGIFTILSIA 52
           M R   F L  FL+   + FA K+   +   I       + SIS  IV+ FG+ TILS+A
Sbjct: 1   MKRLGGFVLMIFLLATTVAFAQKTGAENASGIAGLFSYPEGSISGRIVQLFGLLTILSVA 60

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P LLIMVT F RF I FS+LRTG+G+ + P NLV+ISLALFM+FYVM+PT + + E G+Q
Sbjct: 61  PGLLIMVTSFTRFAIAFSLLRTGLGLQTTPSNLVMISLALFMSFYVMAPTFNTAWEEGVQ 120

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           PL+NN+I+E  AI+++++PF  FM +  REKDL LF++++ SS +   +     I++R+L
Sbjct: 121 PLVNNKISEQQAIEKISQPFREFMISQVREKDLDLFVNLSDSSLQ---VKTGSDIDFRVL 177

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMMLPPT ISLPFK++FFVL+D
Sbjct: 178 VPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMMLPPTVISLPFKILFFVLVD 237

Query: 233 GWSLLVENLVKSF 245
           GW+LLV +L++SF
Sbjct: 238 GWNLLVGSLIRSF 250


>gi|319405407|emb|CBI79026.1| Flagellar biosynthetic protein fliP [Bartonella sp. AR 15-3]
          Length = 250

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 187/244 (76%), Gaps = 11/244 (4%)

Query: 9   LFLVTPELVFAK-------SSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTC 61
           + L+T  + FA+       SSL  + + P   SIS  IV+ FG+ TILS+AP LLIMVT 
Sbjct: 11  ILLLTTTVAFAQKTGPENASSLAGLFSYPEG-SISGRIVQFFGLLTILSVAPGLLIMVTS 69

Query: 62  FPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITE 121
           F RF I FS+LRTG+G+ + P NLV+ISLALFM+FYVM+PT + + E G+QPL++N+I+E
Sbjct: 70  FTRFAIAFSLLRTGLGLQTTPSNLVMISLALFMSFYVMAPTFNTAWEQGVQPLVSNKISE 129

Query: 122 TTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISEL 181
             AI+++++PF  FM +  REKDL LF+D++  S +   +     +++R+LIP+FMISEL
Sbjct: 130 QQAIEKISQPFREFMISQVREKDLDLFVDLSDPSLQ---VKTGSDVDFRVLIPAFMISEL 186

Query: 182 RRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENL 241
           RR FEIGFLI+LPFL+ID++VAT+ M+MGMMMLPPT ISLPFK++FFVLIDGW+LLV +L
Sbjct: 187 RRGFEIGFLIVLPFLVIDLVVATLTMSMGMMMLPPTVISLPFKILFFVLIDGWNLLVGSL 246

Query: 242 VKSF 245
           V+SF
Sbjct: 247 VRSF 250


>gi|319406982|emb|CBI80619.1| Flagellar biosynthetic protein fliP [Bartonella sp. 1-1C]
          Length = 250

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 137/254 (53%), Positives = 190/254 (74%), Gaps = 13/254 (5%)

Query: 1   MIRYCFFAL--FLVTPELVFAK-------SSLHDVMNIPADLSISTWIVRTFGIFTILSI 51
           M R+  F L  FL+   + FA+       S L  + + P   SIS  IV+ FG+ TILS+
Sbjct: 1   MKRFGGFVLMIFLLATTVAFAQKTGAENASGLAGLFSYPQG-SISGRIVQLFGLLTILSV 59

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP LLIMVT F RF I FS+LRTG+G+ + P NLV+ISLALFM+FYVM+PT + + E G+
Sbjct: 60  APGLLIMVTSFTRFAIAFSLLRTGLGLQTTPSNLVMISLALFMSFYVMAPTFNTAWEDGV 119

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
            PL+NN+I+E  AI+++++PF  FM +  REKDL LF++++ SS +   +     +++R+
Sbjct: 120 HPLVNNKISEQQAIEKISQPFREFMISQVREKDLDLFVNLSDSSLQ---VKTGSDVDFRV 176

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMMLPPT ISLPFK++FFVL+
Sbjct: 177 LVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMMLPPTVISLPFKILFFVLV 236

Query: 232 DGWSLLVENLVKSF 245
           DGW+LLV +L++SF
Sbjct: 237 DGWNLLVGSLIRSF 250


>gi|114706620|ref|ZP_01439521.1| flagellar biosynthesis protein P [Fulvimarina pelagi HTCC2506]
 gi|114538012|gb|EAU41135.1| flagellar biosynthesis protein P [Fulvimarina pelagi HTCC2506]
          Length = 264

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 175/246 (71%), Gaps = 9/246 (3%)

Query: 7   FALFLVTPELVFAKSSLHDVMNIP-ADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRF 65
           F L  V    +   SSL D+  IP  D +IS  I++ FGI T+LSIAP LL+MVT F R 
Sbjct: 20  FGLGTVAQAQIADPSSLADL--IPQGDGTISGRIIQLFGIVTVLSIAPGLLVMVTAFTRI 77

Query: 66  IIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAI 125
           +I  SI+RTG+G+ + P NL+IISLALFMTF+VMSPT DR+   G+QPL+ N+I E  A 
Sbjct: 78  VIALSIMRTGLGLQTTPANLIIISLALFMTFFVMSPTFDRAWNDGLQPLLENEIDEEEAF 137

Query: 126 QRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRN------TDITKNDHIEYRILIPSFMIS 179
            R+A+PF  FM    R  DL LF D+A  + R+              IE R+LIP+FMIS
Sbjct: 138 YRIADPFKEFMLTQVRPSDLQLFGDIASVTDRDRVQPEEQGAADERDIELRVLIPAFMIS 197

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           ELRR FEIGFLI+LPFL+IDMIVAT+ M+MGMMMLPPT ISLPFK++FFVLIDGW+LLV 
Sbjct: 198 ELRRGFEIGFLIVLPFLVIDMIVATLTMSMGMMMLPPTIISLPFKILFFVLIDGWNLLVG 257

Query: 240 NLVKSF 245
           +LV+SF
Sbjct: 258 SLVRSF 263


>gi|118589975|ref|ZP_01547379.1| flagellar biosynthesis protein [Stappia aggregata IAM 12614]
 gi|118437472|gb|EAV44109.1| flagellar biosynthesis protein [Stappia aggregata IAM 12614]
          Length = 247

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 129/219 (58%), Positives = 168/219 (76%), Gaps = 1/219 (0%)

Query: 29  IPA-DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVI 87
           +PA + S S  I++   + T+LS+AP +LIMVT F RF+I FS LR+G+G+ + P NL++
Sbjct: 29  LPAGEGSASGRIIQMIALLTVLSLAPGILIMVTSFTRFVIAFSFLRSGIGLQTTPGNLIL 88

Query: 88  ISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSL 147
           ISLALFMTFYVM+PT D++ E G+QPLMNN+I+E  A  R+  PF  FM +  RE+DL L
Sbjct: 89  ISLALFMTFYVMAPTFDKAWEQGVQPLMNNEISEEEAYVRITTPFRDFMLSQVREEDLVL 148

Query: 148 FMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVM 207
           F D+A     + +    + ++ R+LIP+FMISELRR FEIGFLI LPFL+IDMIVATI M
Sbjct: 149 FDDLAAGRVTDNEAASAEEVDLRVLIPAFMISELRRGFEIGFLIALPFLVIDMIVATITM 208

Query: 208 AMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           +MGMMMLPPT ISLPFK +FFVLIDGW+LLV +LV+SF+
Sbjct: 209 SMGMMMLPPTVISLPFKALFFVLIDGWNLLVGSLVRSFL 247


>gi|256059603|ref|ZP_05449801.1| flagellar biosynthesis protein FliP [Brucella neotomae 5K33]
 gi|261323570|ref|ZP_05962767.1| flagellar biosynthetic protein FliP [Brucella neotomae 5K33]
 gi|261299550|gb|EEY03047.1| flagellar biosynthetic protein FliP [Brucella neotomae 5K33]
          Length = 246

 Score =  262 bits (669), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 125/212 (58%), Positives = 168/212 (79%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           + S  IV+ FG+ T+LSIAP LLIMVT F RF I FS+LR+G+G+ + P ++V+ISLALF
Sbjct: 37  AASGQIVQLFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTFYVM+PT DR+   G+QPLM N+IT+  A   +++PF  FM    R+KDL LF D+A 
Sbjct: 97  MTFYVMAPTFDRAWNNGVQPLMRNEITQEAAFGEISQPFREFMMAQVRDKDLRLFEDLAD 156

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            S R +D   +  +++R+L+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMM
Sbjct: 157 PSFRTSD---DGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPPT ISLPFK++FFVLIDGW++LV +L++SF
Sbjct: 214 LPPTVISLPFKILFFVLIDGWNILVGSLIRSF 245


>gi|256158112|ref|ZP_05456030.1| flagellar biosynthesis protein FliP [Brucella ceti M490/95/1]
 gi|256252934|ref|ZP_05458470.1| flagellar biosynthesis protein FliP [Brucella ceti B1/94]
 gi|261220025|ref|ZP_05934306.1| flagellar biosynthetic protein FliP [Brucella ceti B1/94]
 gi|265996629|ref|ZP_06109186.1| flagellar biosynthetic protein FliP [Brucella ceti M490/95/1]
 gi|260918609|gb|EEX85262.1| flagellar biosynthetic protein FliP [Brucella ceti B1/94]
 gi|262550926|gb|EEZ07087.1| flagellar biosynthetic protein FliP [Brucella ceti M490/95/1]
          Length = 246

 Score =  260 bits (665), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 167/212 (78%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           + S  IV+ FG+ T+LSIAP LLIMVT F RF I FS+LR+G+G+ + P ++V+ISLALF
Sbjct: 37  AASGQIVQLFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTFYVM+P  DR+   G+QPLM N+IT+  A   +++PF  FM    R+KDL LF D+A 
Sbjct: 97  MTFYVMAPAFDRAWNNGVQPLMRNEITQEAAFGEISQPFREFMMAQVRDKDLRLFEDLAD 156

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            S R +D   +  +++R+L+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMM
Sbjct: 157 PSFRTSD---DGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPPT ISLPFK++FFVLIDGW++LV +L++SF
Sbjct: 214 LPPTVISLPFKILFFVLIDGWNILVGSLIRSF 245


>gi|23499922|ref|NP_699362.1| flagellar biosynthesis protein FliP [Brucella suis 1330]
 gi|148558353|ref|YP_001257218.1| flagellar biosynthesis protein FliP [Brucella ovis ATCC 25840]
 gi|161620242|ref|YP_001594128.1| flagellar biosynthesis protein FliP [Brucella canis ATCC 23365]
 gi|163844351|ref|YP_001622006.1| flagellar biosynthesis protein FliP [Brucella suis ATCC 23445]
 gi|225628631|ref|ZP_03786665.1| flagellar biosynthetic protein FliP [Brucella ceti str. Cudo]
 gi|225686018|ref|YP_002733990.1| flagellar biosynthesis protein FliP [Brucella melitensis ATCC
           23457]
 gi|254695296|ref|ZP_05157124.1| flagellar biosynthesis protein FliP [Brucella abortus bv. 3 str.
           Tulya]
 gi|254702582|ref|ZP_05164410.1| flagellar biosynthesis protein FliP [Brucella suis bv. 3 str. 686]
 gi|254706286|ref|ZP_05168114.1| flagellar biosynthesis protein FliP [Brucella pinnipedialis
           M163/99/10]
 gi|254711420|ref|ZP_05173231.1| flagellar biosynthesis protein FliP [Brucella pinnipedialis B2/94]
 gi|254712020|ref|ZP_05173831.1| flagellar biosynthesis protein FliP [Brucella ceti M644/93/1]
 gi|254715089|ref|ZP_05176900.1| flagellar biosynthesis protein FliP [Brucella ceti M13/05/1]
 gi|256014948|ref|YP_003104957.1| flagellar biosynthesis protein [Brucella microti CCM 4915]
 gi|256111937|ref|ZP_05452888.1| flagellar biosynthesis protein FliP [Brucella melitensis bv. 3 str.
           Ether]
 gi|256262859|ref|ZP_05465391.1| flagellar transporter FliP [Brucella melitensis bv. 2 str. 63/9]
 gi|260568510|ref|ZP_05838979.1| flagellar transporter FliP [Brucella suis bv. 4 str. 40]
 gi|261215665|ref|ZP_05929946.1| flagellar biosynthetic protein FliP [Brucella abortus bv. 3 str.
           Tulya]
 gi|261216798|ref|ZP_05931079.1| flagellar biosynthetic protein FliP [Brucella ceti M13/05/1]
 gi|261313730|ref|ZP_05952927.1| flagellar biosynthetic protein FliP [Brucella pinnipedialis
           M163/99/10]
 gi|261319028|ref|ZP_05958225.1| flagellar biosynthetic protein FliP [Brucella pinnipedialis B2/94]
 gi|261319665|ref|ZP_05958862.1| flagellar biosynthetic protein FliP [Brucella ceti M644/93/1]
 gi|261753162|ref|ZP_05996871.1| flagellar biosynthetic protein FliP [Brucella suis bv. 3 str. 686]
 gi|265993384|ref|ZP_06105941.1| flagellar biosynthetic protein FliP [Brucella melitensis bv. 3 str.
           Ether]
 gi|23463499|gb|AAN33367.1| flagellar biosynthetic protein FliP [Brucella suis 1330]
 gi|148369638|gb|ABQ62510.1| flagellar biosynthetic protein FliP [Brucella ovis ATCC 25840]
 gi|161337053|gb|ABX63357.1| flagellar biosynthetic protein FliP [Brucella canis ATCC 23365]
 gi|163675074|gb|ABY39184.1| flagellar biosynthetic protein FliP [Brucella suis ATCC 23445]
 gi|225616477|gb|EEH13525.1| flagellar biosynthetic protein FliP [Brucella ceti str. Cudo]
 gi|225642123|gb|ACO02036.1| flagellar biosynthetic protein FliP [Brucella melitensis ATCC
           23457]
 gi|255997608|gb|ACU49295.1| flagellar biosynthesis protein [Brucella microti CCM 4915]
 gi|260155175|gb|EEW90256.1| flagellar transporter FliP [Brucella suis bv. 4 str. 40]
 gi|260917272|gb|EEX84133.1| flagellar biosynthetic protein FliP [Brucella abortus bv. 3 str.
           Tulya]
 gi|260921887|gb|EEX88455.1| flagellar biosynthetic protein FliP [Brucella ceti M13/05/1]
 gi|261292355|gb|EEX95851.1| flagellar biosynthetic protein FliP [Brucella ceti M644/93/1]
 gi|261298251|gb|EEY01748.1| flagellar biosynthetic protein FliP [Brucella pinnipedialis B2/94]
 gi|261302756|gb|EEY06253.1| flagellar biosynthetic protein FliP [Brucella pinnipedialis
           M163/99/10]
 gi|261742915|gb|EEY30841.1| flagellar biosynthetic protein FliP [Brucella suis bv. 3 str. 686]
 gi|262764254|gb|EEZ10286.1| flagellar biosynthetic protein FliP [Brucella melitensis bv. 3 str.
           Ether]
 gi|263092694|gb|EEZ16903.1| flagellar transporter FliP [Brucella melitensis bv. 2 str. 63/9]
 gi|326410341|gb|ADZ67405.1| flagellar biosynthesis protein FliP [Brucella melitensis M28]
 gi|326553633|gb|ADZ88272.1| flagellar biosynthesis protein FliP [Brucella melitensis M5-90]
          Length = 246

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 167/212 (78%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           + S  IV+ FG+ T+LSIAP LLIMVT F RF I FS+LR+G+G+ + P ++V+ISLALF
Sbjct: 37  AASGQIVQLFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTFYVM+P  DR+   G+QPLM N+IT+  A   +++PF  FM    R+KDL LF D+A 
Sbjct: 97  MTFYVMAPAFDRAWNNGVQPLMRNEITQEAAFGEISQPFREFMMAQVRDKDLRLFEDLAD 156

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            S R +D   +  +++R+L+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMM
Sbjct: 157 PSFRTSD---DGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPPT ISLPFK++FFVLIDGW++LV +L++SF
Sbjct: 214 LPPTVISLPFKILFFVLIDGWNILVGSLIRSF 245


>gi|62317108|ref|YP_222961.1| flagellar biosynthesis protein FliP [Brucella abortus bv. 1 str.
           9-941]
 gi|83269100|ref|YP_418391.1| flagellar biosynthesis protein FliP [Brucella melitensis biovar
           Abortus 2308]
 gi|189022373|ref|YP_001932114.1| flagellar biosynthesis protein FliP [Brucella abortus S19]
 gi|237816670|ref|ZP_04595662.1| flagellar biosynthetic protein FliP [Brucella abortus str. 2308 A]
 gi|254691406|ref|ZP_05154660.1| flagellar biosynthesis protein FliP [Brucella abortus bv. 6 str.
           870]
 gi|254698391|ref|ZP_05160219.1| flagellar biosynthesis protein FliP [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731838|ref|ZP_05190416.1| flagellar biosynthesis protein FliP [Brucella abortus bv. 4 str.
           292]
 gi|256256592|ref|ZP_05462128.1| flagellar biosynthesis protein FliP [Brucella abortus bv. 9 str.
           C68]
 gi|260544347|ref|ZP_05820168.1| flagellar transporter FliP [Brucella abortus NCTC 8038]
 gi|260757020|ref|ZP_05869368.1| flagellar biosynthetic protein FliP [Brucella abortus bv. 6 str.
           870]
 gi|260759608|ref|ZP_05871956.1| flagellar biosynthetic protein FliP [Brucella abortus bv. 4 str.
           292]
 gi|260762850|ref|ZP_05875182.1| flagellar biosynthetic protein FliP [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882830|ref|ZP_05894444.1| flagellar biosynthetic protein FliP [Brucella abortus bv. 9 str.
           C68]
 gi|297249948|ref|ZP_06933649.1| flagellar biosynthetic protein FliP [Brucella abortus bv. 5 str.
           B3196]
 gi|62197301|gb|AAX75600.1| FliP, flagellar biosynthetic protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82939374|emb|CAJ12324.1| Flagellar transport protein FliP:Type III secretion system inner
           membrane P protein [Brucella melitensis biovar Abortus
           2308]
 gi|189020947|gb|ACD73668.1| Flagellar transport protein FliP [Brucella abortus S19]
 gi|237787483|gb|EEP61699.1| flagellar biosynthetic protein FliP [Brucella abortus str. 2308 A]
 gi|260097618|gb|EEW81492.1| flagellar transporter FliP [Brucella abortus NCTC 8038]
 gi|260669926|gb|EEX56866.1| flagellar biosynthetic protein FliP [Brucella abortus bv. 4 str.
           292]
 gi|260673271|gb|EEX60092.1| flagellar biosynthetic protein FliP [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260677128|gb|EEX63949.1| flagellar biosynthetic protein FliP [Brucella abortus bv. 6 str.
           870]
 gi|260872358|gb|EEX79427.1| flagellar biosynthetic protein FliP [Brucella abortus bv. 9 str.
           C68]
 gi|297173817|gb|EFH33181.1| flagellar biosynthetic protein FliP [Brucella abortus bv. 5 str.
           B3196]
          Length = 246

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 167/212 (78%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           + S  IV+ FG+ T+LSIAP LLIMVT F RF I FS+LR+G+G+ + P ++V+ISLALF
Sbjct: 37  AASGQIVQLFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTFYVM+P  DR+   G+QPLM N+IT+  A   +++PF  FM    R+KDL LF D+A 
Sbjct: 97  MTFYVMAPAFDRAWNNGVQPLMRNEITQEAAFGEISQPFREFMMAQVRDKDLCLFEDLAD 156

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            S R +D   +  +++R+L+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMM
Sbjct: 157 PSFRTSD---DGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPPT ISLPFK++FFVLIDGW++LV +L++SF
Sbjct: 214 LPPTVISLPFKILFFVLIDGWNILVGSLIRSF 245


>gi|254720604|ref|ZP_05182415.1| flagellar biosynthesis protein FliP [Brucella sp. 83/13]
 gi|265985644|ref|ZP_06098379.1| flagellar biosynthetic protein FliP [Brucella sp. 83/13]
 gi|306838566|ref|ZP_07471403.1| flagellar biosynthetic protein FliP [Brucella sp. NF 2653]
 gi|264664236|gb|EEZ34497.1| flagellar biosynthetic protein FliP [Brucella sp. 83/13]
 gi|306406352|gb|EFM62594.1| flagellar biosynthetic protein FliP [Brucella sp. NF 2653]
          Length = 246

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 166/212 (78%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           + S  IV+ FG+ T+LSIAP LLIMVT F RF I FS+LR+G+G+ + P ++V+ISLALF
Sbjct: 37  AASGQIVQLFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTFYVM+P  DR+   G+QPLM N+IT+  A   +++PF  FM    R+KDL LF D+A 
Sbjct: 97  MTFYVMAPAFDRAWNNGVQPLMRNEITQEAAFGEISQPFREFMMAQVRDKDLRLFEDLAD 156

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            S R  D   +  +++R+L+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMM
Sbjct: 157 PSFRTGD---DGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPPT ISLPFK++FFVLIDGW++LV +L++SF
Sbjct: 214 LPPTVISLPFKILFFVLIDGWNILVGSLIRSF 245


>gi|306846272|ref|ZP_07478833.1| flagellar biosynthetic protein FliP [Brucella sp. BO1]
 gi|306273267|gb|EFM55136.1| flagellar biosynthetic protein FliP [Brucella sp. BO1]
          Length = 246

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 166/212 (78%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           + S  IV+ FG+ T+LSIAP LLIMVT F RF I FS+LR+G+G+ + P ++V+ISLALF
Sbjct: 37  AASGQIVQLFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTFYVM+P  DR+ + G+QPLM N+IT+  A   +++PF  FM    R KDL LF D+A 
Sbjct: 97  MTFYVMAPAFDRAWDNGVQPLMRNEITQEAAFGEISQPFREFMMAQVRGKDLRLFEDLAD 156

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            S R  D   +  +++R+L+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMM
Sbjct: 157 PSFRTGD---DGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPPT ISLPFK++FFVLIDGW++LV +L++SF
Sbjct: 214 LPPTVISLPFKILFFVLIDGWNILVGSLIRSF 245


>gi|239834436|ref|ZP_04682764.1| flagellar biosynthetic protein FliP [Ochrobactrum intermedium LMG
           3301]
 gi|239822499|gb|EEQ94068.1| flagellar biosynthetic protein FliP [Ochrobactrum intermedium LMG
           3301]
          Length = 246

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 166/212 (78%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           + S  IV+ FG+ T+LSIAP +LIMVT F RF I FS+LR+G+G+ + P ++V+ISLALF
Sbjct: 37  AASGQIVQLFGLLTVLSIAPGILIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTFYVM+P  DR+   G+QPLM N+IT+  A   +++PF  FM    R+KDL LF D+A 
Sbjct: 97  MTFYVMAPAFDRAWNNGVQPLMRNEITQQAAFTEISQPFREFMLGQVRDKDLRLFEDLAD 156

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            S R  D   +  +++R+L+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMM
Sbjct: 157 PSFRTGD---DGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPPT ISLPFK++FFVLIDGW++LV +L++SF
Sbjct: 214 LPPTVISLPFKILFFVLIDGWNILVGSLIRSF 245


>gi|153011518|ref|YP_001372732.1| flagellar biosynthesis protein FliP [Ochrobactrum anthropi ATCC
           49188]
 gi|151563406|gb|ABS16903.1| flagellar biosynthetic protein FliP [Ochrobactrum anthropi ATCC
           49188]
          Length = 246

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 166/212 (78%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           + S  IV+ FG+ T+LSIAP LLIMVT F RF I FS+LR+G+G+ + P ++V+ISLALF
Sbjct: 37  AASGQIVQLFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTFYVM+P  DR+   G+QPLM N+IT+  A   +++PF  FM    R+KDL LF D+A 
Sbjct: 97  MTFYVMAPAFDRAWNNGVQPLMRNEITQEAAFGEISQPFREFMMGQVRDKDLRLFEDLAD 156

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            S R  D   +  +++R+L+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMM
Sbjct: 157 PSFRTGD---DGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPPT ISLPFK++FFVLIDGW++LV +L++SF
Sbjct: 214 LPPTVISLPFKILFFVLIDGWNILVGSLIRSF 245


>gi|256029950|ref|ZP_05443564.1| flagellar biosynthesis protein FliP [Brucella pinnipedialis
           M292/94/1]
 gi|265986969|ref|ZP_06099526.1| flagellar biosynthetic protein FliP [Brucella pinnipedialis
           M292/94/1]
 gi|264659166|gb|EEZ29427.1| flagellar biosynthetic protein FliP [Brucella pinnipedialis
           M292/94/1]
          Length = 246

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 167/212 (78%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           + S  IV+ FG+ T+LSIAP LLIMVT F RF I FS+LR+G+G+ + P ++V+ISLALF
Sbjct: 37  AASGQIVQLFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTFYVM+P  DR+   G+QPLM N+IT+  A   +++PF  FM    R+KDL LF D+A 
Sbjct: 97  MTFYVMAPAFDRAWNNGVQPLMPNEITQEAAFGEISQPFREFMMAQVRDKDLRLFEDLAD 156

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            S R +D   +  +++R+L+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMM
Sbjct: 157 PSFRTSD---DGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPPT ISLPFK++FFVLIDGW++LV +L++SF
Sbjct: 214 LPPTVISLPFKILFFVLIDGWNILVGSLIRSF 245


>gi|254502570|ref|ZP_05114721.1| flagellar biosynthetic protein FliP [Labrenzia alexandrii DFL-11]
 gi|222438641|gb|EEE45320.1| flagellar biosynthetic protein FliP [Labrenzia alexandrii DFL-11]
          Length = 246

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 128/215 (59%), Positives = 164/215 (76%)

Query: 31  ADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISL 90
            + S S  +++   + T+LS+AP +LIMVT F RF+I FS LR+G+G+ + P NL++ISL
Sbjct: 31  GEGSASGRVIQMIILLTVLSLAPGILIMVTSFIRFVIAFSFLRSGIGLQTTPGNLILISL 90

Query: 91  ALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMD 150
           ALFMTFYVM+PT DR+ E G++PLMNN+ITE  A  ++ EPF  FM +  REKDL LF D
Sbjct: 91  ALFMTFYVMAPTFDRAWEDGVRPLMNNEITEEEAYVKITEPFREFMLSQVREKDLVLFDD 150

Query: 151 MAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMG 210
           +A     +      + +E R+LIP+FMISELRR FEIGFLI LPFL+IDMIVATI M+MG
Sbjct: 151 LAAGRVTDGSADSAEEVELRVLIPAFMISELRRGFEIGFLIALPFLVIDMIVATITMSMG 210

Query: 211 MMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MMMLPPT ISLPFK +FF+LIDGW+LLV +LV+SF
Sbjct: 211 MMMLPPTVISLPFKALFFILIDGWNLLVGSLVRSF 245


>gi|294853182|ref|ZP_06793854.1| flagellar biosynthetic protein FliP [Brucella sp. NVSL 07-0026]
 gi|294818837|gb|EFG35837.1| flagellar biosynthetic protein FliP [Brucella sp. NVSL 07-0026]
          Length = 246

 Score =  258 bits (659), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 166/212 (78%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           + S  IV+ FG+ T+LSIAP LLIMVT F RF I FS+LR+G+G+ + P ++V+ISLALF
Sbjct: 37  AASGQIVQLFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTFYVM+P  DR+   G+QPLM N+IT+  A   +++PF  FM    R+KDL LF D+  
Sbjct: 97  MTFYVMAPAFDRAWNNGVQPLMRNEITQEAAFGEISQPFREFMMAQVRDKDLRLFEDLVD 156

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            S R +D   +  +++R+L+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMM
Sbjct: 157 PSFRTSD---DGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPPT ISLPFK++FFVLIDGW++LV +L++SF
Sbjct: 214 LPPTVISLPFKILFFVLIDGWNILVGSLIRSF 245


>gi|17989425|ref|NP_542058.1| flagellar biosynthesis protein FliP [Brucella melitensis bv. 1 str.
           16M]
 gi|256043079|ref|ZP_05446023.1| flagellar biosynthesis protein FliP [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260564309|ref|ZP_05834794.1| flagellar transporter FliP [Brucella melitensis bv. 1 str. 16M]
 gi|265989517|ref|ZP_06102074.1| flagellar biosynthetic protein FliP [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17985302|gb|AAL54322.1| flagellar biosynthetic protein flip [Brucella melitensis bv. 1 str.
           16M]
 gi|260151952|gb|EEW87045.1| flagellar transporter FliP [Brucella melitensis bv. 1 str. 16M]
 gi|263000186|gb|EEZ12876.1| flagellar biosynthetic protein FliP [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 246

 Score =  258 bits (659), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 166/212 (78%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           + S  IV+ FG+ T+LSIAP LLIMVT F RF I FS+LR+G+G+ + P ++V+ISLALF
Sbjct: 37  AASGQIVQLFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTFYVM+P  DR+   G+QPLM N+I +  A   +++PF  FM    R+KDL LF D+A 
Sbjct: 97  MTFYVMAPAFDRAWNNGVQPLMRNEIMQEAAFGEISQPFREFMMAQVRDKDLRLFEDLAD 156

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            S R +D   +  +++R+L+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMM
Sbjct: 157 PSFRTSD---DGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPPT ISLPFK++FFVLIDGW++LV +L++SF
Sbjct: 214 LPPTVISLPFKILFFVLIDGWNILVGSLIRSF 245


>gi|90418387|ref|ZP_01226299.1| flagellar biosynthetic protein fliP [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90338059|gb|EAS51710.1| flagellar biosynthetic protein fliP [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 257

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/233 (57%), Positives = 173/233 (74%), Gaps = 8/233 (3%)

Query: 21  SSLHDVMNI-PA-DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           S L D+  + PA D + S  IV+ FGI TILSIAP LL+MVT F R +I  SILRTG+G+
Sbjct: 24  SGLPDLAALLPAGDSTASGRIVQLFGIVTILSIAPGLLVMVTSFTRIVIALSILRTGLGL 83

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            + P NL++ISL+LFMTF+VM+PT DR+   G+QPL+NN+ITE  A  R++EPF  FM  
Sbjct: 84  QTTPANLILISLSLFMTFFVMAPTFDRAWNDGLQPLLNNEITEEEAFYRISEPFKDFMLT 143

Query: 139 NTREKDLSLFMDMAHSSHR------NTDITKNDHIEYRILIPSFMISELRRSFEIGFLII 192
             R +DL+LF D+A ++ R               ++ R LIP+FMISELRR FEIGFLI+
Sbjct: 144 QVRPEDLTLFGDIAAATSRERVEPEEQGAADERDVDLRELIPAFMISELRRGFEIGFLIV 203

Query: 193 LPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPFL+IDMIVAT+ M+MGMMMLPPT ISLPFK++FF+LIDGW++LV +LV+SF
Sbjct: 204 LPFLVIDMIVATLTMSMGMMMLPPTIISLPFKILFFILIDGWNMLVGSLVRSF 256


>gi|328545499|ref|YP_004305608.1| flagellar transport protein FliP [polymorphum gilvum SL003B-26A1]
 gi|326415240|gb|ADZ72303.1| Flagellar transport protein FliP [Polymorphum gilvum SL003B-26A1]
          Length = 246

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 159/215 (73%)

Query: 31  ADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISL 90
            + S S  IV+   + T+LS+AP +LIMVT F RF +  S LR+G+G+ + P NL++ISL
Sbjct: 31  GEGSASGRIVQIIALLTVLSVAPGILIMVTSFTRFAVALSFLRSGIGLQTTPGNLILISL 90

Query: 91  ALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMD 150
           ALFMTFYVM+PT DR+   G+ PLMNN+I E  A  R+ EPF  FM +  RE+DL LF D
Sbjct: 91  ALFMTFYVMAPTFDRAWTQGVVPLMNNEIDEQEAYGRITEPFREFMLSQVREQDLVLFDD 150

Query: 151 MAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMG 210
           +A     +T       +E R+LIP+FMISELRR FEIGFLI LPFL+IDMIVATI M+MG
Sbjct: 151 LAAGRLTDTPAASPREVELRVLIPAFMISELRRGFEIGFLIALPFLVIDMIVATITMSMG 210

Query: 211 MMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MMMLPPT ISLPFK +FF+LIDGW+LLV +LV+SF
Sbjct: 211 MMMLPPTVISLPFKALFFILIDGWNLLVGSLVRSF 245


>gi|306841043|ref|ZP_07473767.1| flagellar biosynthetic protein FliP [Brucella sp. BO2]
 gi|306288932|gb|EFM60232.1| flagellar biosynthetic protein FliP [Brucella sp. BO2]
          Length = 204

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 163/205 (79%), Gaps = 3/205 (1%)

Query: 41  RTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMS 100
           + FG+ T+LSIAP LLIMVT F RF I FS+LR+G+G+ + P ++V+ISLALFMTFYVM+
Sbjct: 2   QLFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALFMTFYVMA 61

Query: 101 PTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTD 160
           P  DR+   G+QPLM N+IT+  A   +++PF  FM    R+KDL LF D+A  S R +D
Sbjct: 62  PAFDRAWNNGVQPLMRNEITQEAAFGEISQPFREFMMAQVRDKDLRLFEDLADPSFRTSD 121

Query: 161 ITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSIS 220
              +  +++R+L+P+FMISELRR FEIGFLI+LPFL+ID++VAT+ M+MGMMMLPPT IS
Sbjct: 122 ---DGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMMLPPTVIS 178

Query: 221 LPFKVIFFVLIDGWSLLVENLVKSF 245
           LPFK++FFVLIDGW++LV +L++SF
Sbjct: 179 LPFKILFFVLIDGWNILVGSLIRSF 203


>gi|170741215|ref|YP_001769870.1| flagellar biosynthesis protein FliP [Methylobacterium sp. 4-46]
 gi|168195489|gb|ACA17436.1| flagellar biosynthetic protein FliP [Methylobacterium sp. 4-46]
          Length = 262

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 123/221 (55%), Positives = 166/221 (75%), Gaps = 2/221 (0%)

Query: 25  DVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPN 84
           D +  P + + S  I++   + T+LS+AP LL+MVT F RF++  S LR+G+G+ S P N
Sbjct: 43  DALLPPGNGAASGRIIQMVALLTVLSVAPGLLVMVTSFTRFVVALSFLRSGLGLQSTPAN 102

Query: 85  LVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKD 144
           L ++SL+LFMTFYVM+PT DR+ + G++PL  N+I+E  A  +V +PF  FM+++ REKD
Sbjct: 103 LFMVSLSLFMTFYVMAPTFDRAWQEGVRPLTENRISEEDAFGKVVDPFREFMQSHVREKD 162

Query: 145 LSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVAT 204
           L  F D+A  +    +    + ++ RILIP+FMISELRR FEIGFLI LPFL+IDMIVAT
Sbjct: 163 LQTFADLASRNFPKAE--AGEKVDLRILIPAFMISELRRGFEIGFLIALPFLVIDMIVAT 220

Query: 205 IVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +VM+MGMMMLPPT ISLPFKV+FFVLIDGW+LLV  LV+S+
Sbjct: 221 VVMSMGMMMLPPTVISLPFKVLFFVLIDGWNLLVSGLVRSY 261


>gi|163850069|ref|YP_001638112.1| flagellar biosynthesis protein FliP [Methylobacterium extorquens
           PA1]
 gi|163661674|gb|ABY29041.1| flagellar biosynthetic protein FliP [Methylobacterium extorquens
           PA1]
          Length = 260

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 123/221 (55%), Positives = 163/221 (73%), Gaps = 2/221 (0%)

Query: 25  DVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPN 84
           D +  P + + S  I++   + T+LS+AP LL+MVT F RF + FS LR+G+G+ S P N
Sbjct: 41  DALLPPGNGAASGRIIQLVALLTVLSLAPGLLVMVTSFTRFAVAFSFLRSGLGLQSTPAN 100

Query: 85  LVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKD 144
           L ++SLALFMTFYVM+PT DR+   G++PL  N+I+E  A  ++ +PF  FM  + R KD
Sbjct: 101 LFLVSLALFMTFYVMAPTFDRAWNEGVKPLQENRISEEEAFGKIVDPFREFMTQHVRPKD 160

Query: 145 LSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVAT 204
           L  F D+A  +    +    + I+ RILIP+FMISELRR FEIGFLI+LPFL+ID+IV+T
Sbjct: 161 LQTFTDLASRTFPKAE--AGEKIDLRILIPAFMISELRRGFEIGFLIVLPFLVIDIIVST 218

Query: 205 IVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IVM+MGMMMLPPT ISLPFKV+FF+LIDGW+LLV  LV+SF
Sbjct: 219 IVMSMGMMMLPPTVISLPFKVLFFILIDGWNLLVSGLVRSF 259


>gi|240137203|ref|YP_002961672.1| flagellar biosynthesis protein FliP [Methylobacterium extorquens
           AM1]
 gi|240007169|gb|ACS38395.1| flagellar biosynthesis protein FliP [Methylobacterium extorquens
           AM1]
          Length = 260

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 123/221 (55%), Positives = 163/221 (73%), Gaps = 2/221 (0%)

Query: 25  DVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPN 84
           D +  P + + S  I++   + T+LS+AP LL+MVT F RF + FS LR+G+G+ S P N
Sbjct: 41  DALLPPGNGAASGRIIQLVALLTVLSLAPGLLVMVTSFTRFAVAFSFLRSGLGLQSTPAN 100

Query: 85  LVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKD 144
           L ++SLALFMTFYVM+PT DR+   G++PL  N+I+E  A  ++ +PF  FM  + R KD
Sbjct: 101 LFLVSLALFMTFYVMAPTFDRAWNEGVKPLQENRISEEEAFGKIVDPFREFMTQHVRPKD 160

Query: 145 LSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVAT 204
           L  F D+A  +    +    + I+ RILIP+FMISELRR FEIGFLI+LPFL+ID+IV+T
Sbjct: 161 LQTFTDLASRTFPKAE--AGEKIDLRILIPAFMISELRRGFEIGFLIVLPFLVIDIIVST 218

Query: 205 IVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IVM+MGMMMLPPT ISLPFKV+FF+LIDGW+LLV  LV+SF
Sbjct: 219 IVMSMGMMMLPPTVISLPFKVLFFILIDGWNLLVSGLVRSF 259


>gi|218528672|ref|YP_002419488.1| flagellar biosynthesis protein FliP [Methylobacterium
           chloromethanicum CM4]
 gi|218520975|gb|ACK81560.1| flagellar biosynthetic protein FliP [Methylobacterium
           chloromethanicum CM4]
          Length = 260

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 123/221 (55%), Positives = 163/221 (73%), Gaps = 2/221 (0%)

Query: 25  DVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPN 84
           D +  P + + S  I++   + T+LS+AP LL+MVT F RF + FS LR+G+G+ S P N
Sbjct: 41  DALLPPGNGAASGRIIQLVALLTVLSLAPGLLVMVTSFTRFAVAFSFLRSGLGLQSTPAN 100

Query: 85  LVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKD 144
           L ++SLALFMTFYVM+PT DR+   G++PL  N+I+E  A  ++ +PF  FM  + R KD
Sbjct: 101 LFLVSLALFMTFYVMAPTFDRAWNEGVKPLQENRISEEEAFGKIVDPFREFMTQHVRPKD 160

Query: 145 LSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVAT 204
           L  F D+A  +    +    + I+ RILIP+FMISELRR FEIGFLI+LPFL+ID+IV+T
Sbjct: 161 LQTFTDLASRTFPKAE--AGEKIDLRILIPAFMISELRRGFEIGFLIVLPFLVIDIIVST 218

Query: 205 IVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IVM+MGMMMLPPT ISLPFKV+FF+LIDGW+LLV  LV+SF
Sbjct: 219 IVMSMGMMMLPPTVISLPFKVLFFILIDGWNLLVSGLVRSF 259


>gi|188579873|ref|YP_001923318.1| flagellar biosynthesis protein FliP [Methylobacterium populi BJ001]
 gi|179343371|gb|ACB78783.1| flagellar biosynthetic protein FliP [Methylobacterium populi BJ001]
          Length = 253

 Score =  250 bits (639), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 123/221 (55%), Positives = 162/221 (73%), Gaps = 2/221 (0%)

Query: 25  DVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPN 84
           D +  P + + S  I++   + T+LS+AP LL+M+T F RF + FS LR+G+G+ S P N
Sbjct: 34  DALLPPGNGAASGRIIQLVALLTVLSLAPGLLVMMTSFTRFAVAFSFLRSGLGLQSTPAN 93

Query: 85  LVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKD 144
           L ++SLALFMTFYVM+PT DR+   G++PL  N+I E  A  ++ EPF  FM  + R KD
Sbjct: 94  LFLVSLALFMTFYVMAPTFDRAWNEGVKPLQENRIGEEEAFGKIVEPFREFMTQHVRPKD 153

Query: 145 LSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVAT 204
           L  F D+A  +    +    + I+ RILIP+FMISELRR FEIGFLI+LPFL+ID+IV+T
Sbjct: 154 LQTFTDLASRNFPKAE--AGEKIDLRILIPAFMISELRRGFEIGFLIVLPFLVIDIIVST 211

Query: 205 IVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IVM+MGMMMLPPT ISLPFKV+FF+LIDGW+LLV  LV+SF
Sbjct: 212 IVMSMGMMMLPPTVISLPFKVLFFILIDGWNLLVSGLVRSF 252


>gi|254559215|ref|YP_003066310.1| flagellar biosynthesis protein FliP [Methylobacterium extorquens
           DM4]
 gi|254266493|emb|CAX22257.1| flagellar biosynthesis protein FliP [Methylobacterium extorquens
           DM4]
          Length = 260

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 162/221 (73%), Gaps = 2/221 (0%)

Query: 25  DVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPN 84
           D +  P + + S  I++   + T+LS+AP LL+MVT F RF +  S LR+G+G+ S P N
Sbjct: 41  DALLPPGNGAASGRIIQLVALLTVLSLAPGLLVMVTSFTRFAVALSFLRSGLGLQSTPAN 100

Query: 85  LVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKD 144
           L ++SLALFMTFYVM+PT DR+   G++PL  N+I+E  A  ++ +PF  FM  + R KD
Sbjct: 101 LFLVSLALFMTFYVMAPTFDRAWNEGVKPLQENRISEEEAFGKIVDPFREFMTQHVRPKD 160

Query: 145 LSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVAT 204
           L  F D+A  +    +    + I+ RILIP+FMISELRR FEIGFLI+LPFL+ID+IV+T
Sbjct: 161 LQTFTDLASRTFPKAE--AGEKIDLRILIPAFMISELRRGFEIGFLIVLPFLVIDIIVST 218

Query: 205 IVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IVM+MGMMMLPPT ISLPFKV+FF+LIDGW+LLV  LV+SF
Sbjct: 219 IVMSMGMMMLPPTVISLPFKVLFFILIDGWNLLVSGLVRSF 259


>gi|170748101|ref|YP_001754361.1| flagellar biosynthetic protein FliP [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654623|gb|ACB23678.1| flagellar biosynthetic protein FliP [Methylobacterium radiotolerans
           JCM 2831]
          Length = 245

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 133/248 (53%), Positives = 173/248 (69%), Gaps = 7/248 (2%)

Query: 1   MIRYCFFA--LFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIM 58
           M+R  F A  L LV         SL  V+  P + S+S  +++   + T+LSIAP LL+M
Sbjct: 1   MLRRVFLASPLLLVATAATAQSFSLDQVLP-PGNGSVSGRMIQLIALMTVLSIAPGLLVM 59

Query: 59  VTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQ 118
           VT F RF++  S LR+G+G+ S P NLV+ISL+LFMTFYVM PT DR+ + G++PL  N+
Sbjct: 60  VTSFTRFVVALSFLRSGLGLQSAPANLVLISLSLFMTFYVMGPTFDRAWQDGVRPLTENR 119

Query: 119 ITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSS-HRNTDITKNDHIEYRILIPSFM 177
           ITE  A  +V  PF  FM  + R KDL  F ++A S+  +  D  + D    RILIP+FM
Sbjct: 120 ITEEEAFAKVTAPFRDFMLAHVRPKDLDTFAEIAASNLSKAPDGGRTD---LRILIPAFM 176

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
           ISELRR FEIGFLI LPFL+IDM++A +VM+MGMMMLPPT ISLPFK++FFVLIDGW++L
Sbjct: 177 ISELRRGFEIGFLIALPFLVIDMVIAVLVMSMGMMMLPPTVISLPFKILFFVLIDGWNML 236

Query: 238 VENLVKSF 245
           V  LVKS+
Sbjct: 237 VSGLVKSY 244


>gi|254473298|ref|ZP_05086695.1| flagellar biosynthetic protein FliP [Pseudovibrio sp. JE062]
 gi|211957414|gb|EEA92617.1| flagellar biosynthetic protein FliP [Pseudovibrio sp. JE062]
          Length = 251

 Score =  248 bits (632), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 173/242 (71%), Gaps = 4/242 (1%)

Query: 5   CFFALFLVTPELVFAKSSLHDVMNIPA-DLSISTWIVRTFGIFTILSIAPILLIMVTCFP 63
             FALF V P     + +L D++  PA   S S  I++   I T+LS+AP +LIMVT F 
Sbjct: 12  SLFALFWVAPASA-QEINLSDLL--PAGQASASGRIIQYVMILTVLSLAPGILIMVTSFT 68

Query: 64  RFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETT 123
           RF++  S LR+G+G+ + P N+++ISLALFMTFYVM+PT D + + G+QPL+  +I+E  
Sbjct: 69  RFVVALSFLRSGIGLQTTPANIILISLALFMTFYVMAPTFDAAWKNGLQPLIKEEISEEV 128

Query: 124 AIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRR 183
           A + + +PF  FM +N REKDL LF D+A S+         + ++ R+LIP+FMISELRR
Sbjct: 129 AYEEMTKPFRRFMLDNVREKDLVLFDDLAVSAFNYEKDAPVEELDLRVLIPAFMISELRR 188

Query: 184 SFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVK 243
            FEIGFLI LPF++IDMIVATI M+MGMMMLPPT ISLPFKV+FFVLIDGW LL   L++
Sbjct: 189 GFEIGFLIALPFVVIDMIVATITMSMGMMMLPPTVISLPFKVLFFVLIDGWYLLTGGLIR 248

Query: 244 SF 245
           SF
Sbjct: 249 SF 250


>gi|182680542|ref|YP_001834688.1| flagellar biosynthetic protein FliP [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182636425|gb|ACB97199.1| flagellar biosynthetic protein FliP [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 246

 Score =  248 bits (632), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 164/216 (75%), Gaps = 1/216 (0%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P + ++S  I++   + TILS+AP LL+MVT F RF I  S LR+G+G+ S P NLV+IS
Sbjct: 31  PGNGTVSGRIIQLVALLTILSVAPGLLVMVTSFTRFAIALSFLRSGLGLQSTPANLVLIS 90

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LFMTFYVMSP  +++ + G++P+M+NQ+TE  A  ++ +PF  FM    R KDL LF 
Sbjct: 91  LSLFMTFYVMSPVFEKAWDGGVKPMMDNQLTEQEAFPKIIQPFREFMSGQVRGKDLKLFT 150

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           D+A  +  + D T ++ IE RILIP+FMISELRR FE+GFLI+LPFL+IDMI + I M+M
Sbjct: 151 DLAKENFPSVDQTGSE-IELRILIPAFMISELRRGFEMGFLIVLPFLVIDMITSAITMSM 209

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPPT I+LP KV+FF+LIDGW++L+ +LV+S+
Sbjct: 210 GMMMLPPTVIALPVKVLFFILIDGWNMLIGSLVRSY 245


>gi|296445179|ref|ZP_06887139.1| flagellar biosynthetic protein FliP [Methylosinus trichosporium
           OB3b]
 gi|296257353|gb|EFH04420.1| flagellar biosynthetic protein FliP [Methylosinus trichosporium
           OB3b]
          Length = 243

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 159/212 (75%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           + S  IV+   + T+LSIAP LLIMVT F RF I  S LR+G+G+ S P NLV+ISLALF
Sbjct: 34  AASGKIVQLLAVLTVLSIAPGLLIMVTSFTRFAIALSFLRSGLGLQSTPANLVLISLALF 93

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTFYVM+PT + + + G++PLM+ +ITE  A +++++PF  FM  N REKD+ LF  ++ 
Sbjct: 94  MTFYVMAPTFEAAWQDGLKPLMDQKITEVEAFEKISQPFRKFMIANVREKDIKLFDSLSR 153

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                 D    D +  ++L P+FMISELRR FEIGFLI+LPFL+IDMIVA + M+MGMMM
Sbjct: 154 EPRPAGDY---DKLGLQVLAPAFMISELRRGFEIGFLIVLPFLVIDMIVAVVTMSMGMMM 210

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPPT+ISLP KV+FF+LIDGW+LLV +L++S+
Sbjct: 211 LPPTAISLPVKVLFFILIDGWNLLVGSLIRSY 242


>gi|217976231|ref|YP_002360378.1| flagellar biosynthetic protein FliP [Methylocella silvestris BL2]
 gi|217501607|gb|ACK49016.1| flagellar biosynthetic protein FliP [Methylocella silvestris BL2]
          Length = 247

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 161/216 (74%), Gaps = 3/216 (1%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P   + ++ I++   + T+LSIAP +L+M T F RF++  S LR+G+G+ S P NL++IS
Sbjct: 34  PGGGAAASRIIQLVVLLTVLSIAPGILVMTTSFTRFVVALSFLRSGIGLQSTPANLILIS 93

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LFMTFYVM+PT +R+ + G++PLM+N++TE  A  ++ EPF  FM +  REKDL LF 
Sbjct: 94  LSLFMTFYVMAPTFERAWDAGVKPLMDNKLTEEQAFGKIVEPFRDFMMSQVREKDLKLFE 153

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           D+A    +    +     E R LIP+FMISELRR FEIGFLI LPFL+IDMIV+T+ M+M
Sbjct: 154 DLAGEKFKTKSQSTG---EIRTLIPAFMISELRRGFEIGFLIALPFLVIDMIVSTLTMSM 210

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP+ I+LP K++FF+LIDGW+LL+ +L++S+
Sbjct: 211 GMMMLPPSVIALPIKILFFILIDGWNLLIGSLIRSY 246


>gi|304392500|ref|ZP_07374440.1| flagellar biosynthetic protein FliP [Ahrensia sp. R2A130]
 gi|303295130|gb|EFL89490.1| flagellar biosynthetic protein FliP [Ahrensia sp. R2A130]
          Length = 259

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 127/260 (48%), Positives = 171/260 (65%), Gaps = 17/260 (6%)

Query: 1   MIRYCFFALFLVTPELVFAKSS----------LHDVMNIPADLSISTWIVRTFGIFTILS 50
           MI     AL L  P   +A++S          L          S+S  I++ FG+ T+LS
Sbjct: 1   MIAGLLLALVLTGP--AYAQTSPDVLGDLSRLLGSGTEATGSPSVSGQIIQLFGLVTVLS 58

Query: 51  IAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMG 110
           +AP +LI+VT F RFII FSILR G+G+ S P NL++ISL+LFMTF+VMS T   + + G
Sbjct: 59  LAPGILIVVTSFTRFIIAFSILRMGLGLQSTPANLILISLSLFMTFHVMSATFQTAWDKG 118

Query: 111 IQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDIT-----KND 165
             PL   +ITE  A+ ++ EPF  FM  N R +D++LF D+ +       +        D
Sbjct: 119 AGPLSRGEITEAQAVTQIIEPFRTFMLANVRGEDIALFTDLQNERAVADGVAVPETAAAD 178

Query: 166 HIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKV 225
            +    L+P+FMISE+RR FEIGFLI+LPFL+ID+IVATIVMAMGMMMLPPT ++LPFK+
Sbjct: 179 EVAITALVPAFMISEIRRGFEIGFLILLPFLVIDLIVATIVMAMGMMMLPPTVVALPFKI 238

Query: 226 IFFVLIDGWSLLVENLVKSF 245
           +FFVLIDGW+LLV +L++SF
Sbjct: 239 LFFVLIDGWNLLVGSLLRSF 258


>gi|27381978|ref|NP_773507.1| flagellar biosynthesis protein FliP [Bradyrhizobium japonicum USDA
           110]
 gi|27355148|dbj|BAC52132.1| flagellar biosynthetic protein [Bradyrhizobium japonicum USDA 110]
          Length = 246

 Score =  238 bits (608), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 170/232 (73%), Gaps = 2/232 (0%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILR 73
           PE+ FA+    + +  P + S S  I++   + T+LS+AP LLIMVT F RF +  S LR
Sbjct: 16  PEMAFAQIPDLNSLLPPGNGSTSGRIIQLMALITVLSVAPGLLIMVTSFTRFAVALSFLR 75

Query: 74  TGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFW 133
           +G+G+ + P NLV++SLALFMTFYVM+PT DR+ E G+QPLM N+I+E  A  ++ +PF 
Sbjct: 76  SGLGLQTTPANLVLVSLALFMTFYVMAPTFDRAWETGVQPLMKNEISEEEAYLKITDPFR 135

Query: 134 VFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIIL 193
            FM  + R+KDL  F  +A  S R      +  I+ R++IP+FMISELRRSFEIGFLI+L
Sbjct: 136 EFMLAHVRDKDLQTFEALAAESFRKK--FDDKRIDLRVIIPAFMISELRRSFEIGFLIML 193

Query: 194 PFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           PFL+IDMIVAT+ M+MGMMM+PPT ++LPFK++FFVLIDGW+LL   LV+SF
Sbjct: 194 PFLVIDMIVATLTMSMGMMMMPPTILALPFKMLFFVLIDGWNLLASGLVRSF 245


>gi|114765260|ref|ZP_01444392.1| flagellar biosynthesis protein P [Pelagibaca bermudensis HTCC2601]
 gi|114542395|gb|EAU45423.1| flagellar biosynthesis protein P [Roseovarius sp. HTCC2601]
          Length = 282

 Score =  238 bits (608), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 162/220 (73%), Gaps = 7/220 (3%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           ++S  I++     T+LS+AP LL+++T F RF+IVFS+LR+ +G+   PPN+V+ S+ALF
Sbjct: 57  TLSGRIIQLIAAMTVLSLAPGLLVIMTSFTRFVIVFSMLRSALGLNQSPPNMVLTSMALF 116

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTF+VM P  + + E G+QPLM N ITE  A+ RV EPF +FM  NTREKDL+LF D+A 
Sbjct: 117 MTFFVMQPVFEDAWEGGVQPLMANSITEEQALMRVGEPFKLFMYANTREKDLALFRDIAA 176

Query: 154 SSHRNTDITKN-------DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIV 206
            S       ++       + + +R L+P+FMISELRR+F IGFLI LPFL+ID+IVA+++
Sbjct: 177 RSEGTVPPEESAPAPQSAEDVGWRELVPAFMISELRRAFSIGFLIYLPFLVIDLIVASVL 236

Query: 207 MAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           M+ GMMMLPP  ISLPFKVIFFVLIDGW +L  +L++S++
Sbjct: 237 MSAGMMMLPPVLISLPFKVIFFVLIDGWYMLAGSLMESYL 276


>gi|148256782|ref|YP_001241367.1| flagellar biosynthesis protein FliP [Bradyrhizobium sp. BTAi1]
 gi|146408955|gb|ABQ37461.1| Flagellar transport protein FliP [Bradyrhizobium sp. BTAi1]
          Length = 234

 Score =  238 bits (607), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 159/216 (73%), Gaps = 4/216 (1%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P +  ++   V+   + T+LSIAP +LIM+T F R ++V S+LRT MG  + PPN VII+
Sbjct: 21  PGNGGVTERAVQLIALLTVLSIAPSILIMMTSFTRIVVVLSLLRTAMGTATAPPNAVIIA 80

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LA+F+T +VM P L +S + G++PL+ NQI    A+QR + P   FM+ N REKDL LFM
Sbjct: 81  LAMFLTAFVMGPVLQKSYDDGVRPLIENQIGVEDALQRASVPLRGFMQKNVREKDLKLFM 140

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           D++  +   T     D +  RIL+P+FMISEL+R+FEIGFL+ LPFLIID++VA+++M+M
Sbjct: 141 DLSGEAPPATP----DELSLRILVPAFMISELKRAFEIGFLLFLPFLIIDLVVASVLMSM 196

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  +SLPFK+IFFVL+DGWSL+  +LV+S+
Sbjct: 197 GMMMLPPVVVSLPFKLIFFVLVDGWSLVAGSLVQSY 232


>gi|27380927|ref|NP_772456.1| flagellar biosynthesis protein FliP [Bradyrhizobium japonicum USDA
           110]
 gi|27354093|dbj|BAC51081.1| flagellar biosynthetic protein [Bradyrhizobium japonicum USDA 110]
          Length = 250

 Score =  238 bits (606), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 114/212 (53%), Positives = 158/212 (74%), Gaps = 4/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
            ++   ++   + T+LSIAP +LIM+T F R ++V S+LRT MG  + PPN VII+LA+F
Sbjct: 41  GVTERAIQLIALLTVLSIAPSILIMMTSFTRIVVVLSLLRTAMGTATAPPNSVIIALAMF 100

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +TF+VM P L +S + GI+PL+ NQI    A+QR + P   FM+ N REKDL LF+D++ 
Sbjct: 101 LTFFVMGPVLQKSYDEGIRPLVANQIGVEDALQRASVPLRGFMQKNVREKDLKLFLDLSG 160

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                T     D +  RILIP+FMISEL+R+FEIGFL+ LPFLIID++VA+++M+MGMMM
Sbjct: 161 EPPPATP----DELALRILIPAFMISELKRAFEIGFLLFLPFLIIDLVVASVLMSMGMMM 216

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPP +ISLPFK+IFFVL+DGWSL+  +LV+S+
Sbjct: 217 LPPATISLPFKLIFFVLVDGWSLVAGSLVQSY 248


>gi|84502361|ref|ZP_01000497.1| flagellar biosynthesis protein [Oceanicola batsensis HTCC2597]
 gi|84389173|gb|EAQ01970.1| flagellar biosynthesis protein [Oceanicola batsensis HTCC2597]
          Length = 277

 Score =  238 bits (606), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 162/218 (74%), Gaps = 5/218 (2%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           +++  +++     T+LSIAP LL+++T F RF+IVFS+LR+ +G+   PPN+V+ S+ALF
Sbjct: 54  TLAGRLIQLVAAMTVLSIAPGLLVIMTSFTRFVIVFSMLRSALGLNQTPPNMVLSSMALF 113

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMA- 152
           MTF+VM P  + + EMGI PL+NN ITE  A++R AEPF  FM  NTREKDL+LF D+A 
Sbjct: 114 MTFFVMQPVFEDAWEMGIDPLINNVITEEQALERTAEPFRTFMLANTREKDLALFQDIAA 173

Query: 153 ----HSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMA 208
                +   N  + ++    +R L+P+FMISELRR+F IGFLI LPF+ ID+I+A+I+M+
Sbjct: 174 RSAGQTGADNLQVDEDGLPSWRSLVPAFMISELRRAFSIGFLIYLPFVAIDLIIASILMS 233

Query: 209 MGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
            GMMMLPP  ISLPFKVIFFVLIDGW +L  +L++S++
Sbjct: 234 AGMMMLPPVLISLPFKVIFFVLIDGWYMLAGSLMESYL 271


>gi|146341897|ref|YP_001206945.1| flagellar biosynthesis protein FliP [Bradyrhizobium sp. ORS278]
 gi|146194703|emb|CAL78728.1| Flagellar transport protein FliP [Bradyrhizobium sp. ORS278]
          Length = 226

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 158/211 (74%), Gaps = 4/211 (1%)

Query: 35  ISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFM 94
           ++   V+   + T+LSIAP +L+M+T F R ++V S+LRT MG  + PPN VII+LA+F+
Sbjct: 18  VTERAVQLIALLTVLSIAPSILVMMTSFTRIVVVLSLLRTAMGTATAPPNSVIIALAMFL 77

Query: 95  TFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHS 154
           T +VM P L +S + G++PL+ NQIT   A+QR + P   FM+ N REKDL LFMD++  
Sbjct: 78  TAFVMGPVLQKSYDDGVRPLIENQITVEDALQRASVPLRGFMQKNVREKDLKLFMDLSGE 137

Query: 155 SHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMML 214
           +   T     D +  RIL+P+FMISEL+R+FEIGFL+ LPFLIID++VA+++M+MGMMML
Sbjct: 138 APPATP----DELSLRILVPAFMISELKRAFEIGFLLFLPFLIIDLVVASVLMSMGMMML 193

Query: 215 PPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           PP  +SLPFK+IFFVL+DGWSL+  +LV+S+
Sbjct: 194 PPVVVSLPFKLIFFVLVDGWSLVAGSLVQSY 224


>gi|115523185|ref|YP_780096.1| flagellar biosynthesis protein FliP [Rhodopseudomonas palustris
           BisA53]
 gi|115517132|gb|ABJ05116.1| flagellar biosynthetic protein FliP [Rhodopseudomonas palustris
           BisA53]
          Length = 244

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 160/213 (75%), Gaps = 2/213 (0%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S S  I++   + T+LS+AP LLIMVT F RF++  S LRTG+G+ + P N+V+ISLALF
Sbjct: 34  SASGRIIQMVALLTVLSLAPGLLIMVTSFTRFVVALSFLRTGLGLQTTPANIVMISLALF 93

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +TFYVM+PT DR+   GIQPLM N+ITE  A  RV EPF  FM    R+KDL  F ++A 
Sbjct: 94  LTFYVMAPTFDRAWREGIQPLMQNEITEKEAYARVTEPFREFMLAQVRDKDLQTFENLAA 153

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            S R       + ++ R++IP+FM+SELRR+FEIGFLI++PFL+IDMIVAT+ M+MGMMM
Sbjct: 154 ESLRAKP--DGERVDLRVIIPAFMVSELRRAFEIGFLIVMPFLVIDMIVATLTMSMGMMM 211

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           +PPT  +LPFKV+FFVLIDGW+LL   LV+SF+
Sbjct: 212 MPPTVFALPFKVLFFVLIDGWNLLAVGLVRSFL 244


>gi|323136548|ref|ZP_08071629.1| flagellar biosynthetic protein FliP [Methylocystis sp. ATCC 49242]
 gi|322397865|gb|EFY00386.1| flagellar biosynthetic protein FliP [Methylocystis sp. ATCC 49242]
          Length = 243

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 120/236 (50%), Positives = 166/236 (70%), Gaps = 4/236 (1%)

Query: 11  LVTPELVFAKSSLHDVMNIP-ADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVF 69
           ++TP + FA   L     +P    S S  I++  G  T+LSIAP LLIMVT F RF I  
Sbjct: 10  MMTPSIAFAAEGLDLNALLPNGAASSSGKIIQLLGALTVLSIAPGLLIMVTSFTRFAIAL 69

Query: 70  SILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVA 129
           S LRTG+G+ S P NLV+ISLALFMTFYVM+P ++++   G++PL+ N+ITE  A ++++
Sbjct: 70  SFLRTGLGLQSTPANLVLISLALFMTFYVMTPAMNQAWSSGVKPLVENKITEVEAFEKIS 129

Query: 130 EPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGF 189
            PF  FM  + R+KD+ LF D+          T+   ++  +LIP+FMISELRR FEIGF
Sbjct: 130 APFREFMIAHVRDKDIRLFEDLRKVEPSTKGKTE---LQLSVLIPAFMISELRRGFEIGF 186

Query: 190 LIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LI++PFL ID+IVA + M+MGMMMLPP +ISLP K++FF+LIDGW+LL  +L++S+
Sbjct: 187 LIVVPFLAIDIIVAVLTMSMGMMMLPPATISLPAKILFFILIDGWNLLAGSLIRSY 242


>gi|312115243|ref|YP_004012839.1| flagellar biosynthetic protein FliP [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220372|gb|ADP71740.1| flagellar biosynthetic protein FliP [Rhodomicrobium vannielii ATCC
           17100]
          Length = 265

 Score =  234 bits (596), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 157/210 (74%), Gaps = 6/210 (2%)

Query: 36  STWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMT 95
           S+ I++   + T+LS+AP +LIMVTCF RF+I  S LR G+G+ S P N++++SLALFMT
Sbjct: 61  SSRIIQLVLVITVLSLAPGILIMVTCFTRFVIALSFLRVGLGLPSTPANIILVSLALFMT 120

Query: 96  FYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSS 155
            + MSPT D++ E G++P M+ +++E  A Q++ +PF  FM  N R+KD+ LF  M+  +
Sbjct: 121 AFTMSPTFDKAWETGVKPFMDKKLSEDAAFQKITDPFREFMMANVRQKDIDLFAGMSPQA 180

Query: 156 HRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLP 215
                 +       R LIP+FMISELRR FEIGFLI+LPFL+ID+I +T++MAMGMMM+ 
Sbjct: 181 ------SAEGATALRTLIPAFMISELRRGFEIGFLIMLPFLVIDLIASTVLMAMGMMMVS 234

Query: 216 PTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           PT++SLPFKV+FF+LIDGW+LLV NLV+SF
Sbjct: 235 PTTVSLPFKVLFFILIDGWNLLVGNLVRSF 264


>gi|90423026|ref|YP_531396.1| flagellar biosynthesis protein FliP [Rhodopseudomonas palustris
           BisB18]
 gi|90105040|gb|ABD87077.1| flagellar biosynthetic protein FliP [Rhodopseudomonas palustris
           BisB18]
          Length = 254

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 157/211 (74%), Gaps = 4/211 (1%)

Query: 35  ISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFM 94
           ++   ++   + T+LSIAP +LIM+T F R ++V S+LRT +G  + PPN VI++LALF+
Sbjct: 45  VTERAIQLIALLTVLSIAPSILIMMTSFTRIVVVLSLLRTALGTATAPPNSVILALALFL 104

Query: 95  TFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHS 154
           T +VM P L +S + GI+PL+ NQIT   A+QR   P   FM+ N REKDL LFMD+++ 
Sbjct: 105 TAFVMGPVLQKSYDDGIKPLIANQITVEEALQRAVVPLRGFMQKNVREKDLKLFMDLSNE 164

Query: 155 SHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMML 214
               T     D +  RIL+P+FMISEL+R+FEIGFL+ LPFLIID++VA+++M+MGMMML
Sbjct: 165 PIPATP----DDLSLRILVPAFMISELKRAFEIGFLLFLPFLIIDLVVASVLMSMGMMML 220

Query: 215 PPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           PP  +SLPFK+IFFVL+DGWSL+  +LV+S+
Sbjct: 221 PPVVVSLPFKLIFFVLVDGWSLVAGSLVQSY 251


>gi|83944189|ref|ZP_00956645.1| flagellar biosynthesis protein [Sulfitobacter sp. EE-36]
 gi|83955110|ref|ZP_00963766.1| flagellar biosynthesis protein [Sulfitobacter sp. NAS-14.1]
 gi|83840439|gb|EAP79612.1| flagellar biosynthesis protein [Sulfitobacter sp. NAS-14.1]
 gi|83845056|gb|EAP82937.1| flagellar biosynthesis protein [Sulfitobacter sp. EE-36]
          Length = 274

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 114/213 (53%), Positives = 159/213 (74%), Gaps = 1/213 (0%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S+S  +++ F I T+LS+AP LL+MVT F RF+IVFS+LR  +G+   PPN+V+ ++ALF
Sbjct: 61  SLSGRLIQLFAIITVLSVAPGLLVMVTSFTRFVIVFSMLRLALGLNQTPPNIVLNAMALF 120

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTF+VM P  + + E G+ PLM N I E  A++ ++EPF+ FM  NTR+KDL LF D+A 
Sbjct: 121 MTFFVMQPVFEDAWEGGLVPLMENAIIEEQAVRNISEPFYNFMLVNTRDKDLQLFTDIAD 180

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            +   +D        +R+L+PSFMISELRR+F IGFLI LPF+ ID+IVA+++M+ GMMM
Sbjct: 181 EASPPSD-GPAALPSWRVLVPSFMISELRRAFTIGFLIYLPFIAIDLIVASVLMSAGMMM 239

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           LPP  +SLPFKVIFFVLIDGW +L  +L++S++
Sbjct: 240 LPPVLVSLPFKVIFFVLIDGWYMLAGSLIQSYV 272


>gi|90422616|ref|YP_530986.1| flagellar biosynthesis protein FliP [Rhodopseudomonas palustris
           BisB18]
 gi|90104630|gb|ABD86667.1| flagellar biosynthetic protein FliP [Rhodopseudomonas palustris
           BisB18]
          Length = 248

 Score =  232 bits (592), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 162/217 (74%), Gaps = 2/217 (0%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P   S S  I++   + T+LS+AP LLIMVT F RF++  S LRTG+G+ + P N+V+IS
Sbjct: 34  PGGGSASGRIIQMVALLTVLSLAPGLLIMVTSFTRFVVALSFLRTGLGLQTTPANIVMIS 93

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+TFYVM+PT DR+   G+QPLM N+ITE  A  RV EPF  FM  + R+KDL  F 
Sbjct: 94  LALFLTFYVMAPTFDRAWRDGLQPLMQNEITEKEAYSRVTEPFREFMLAHVRDKDLQTFE 153

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            +A  S R     + + ++ R++IP+FM+SELRR+FEIGFLI++PFL+IDM+VAT+ M+M
Sbjct: 154 SLAAESLRIRP--EGEKVDLRVIIPAFMVSELRRAFEIGFLIVMPFLVIDMVVATLTMSM 211

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           GMMM+PPT  +LPFKV+FFVLIDGW+LL   LV+S++
Sbjct: 212 GMMMMPPTVFALPFKVLFFVLIDGWNLLAVGLVRSYL 248


>gi|209964214|ref|YP_002297129.1| flagellar biosynthesis protein FliP [Rhodospirillum centenum SW]
 gi|209957680|gb|ACI98316.1| flagellar biosynthesis protein FliP [Rhodospirillum centenum SW]
          Length = 255

 Score =  231 bits (588), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 155/207 (74%), Gaps = 4/207 (1%)

Query: 39  IVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYV 98
           I++   + T+LS+AP +LIM+TCF R +IV S LR+ MG   VPPN V++SLALF+TF++
Sbjct: 50  IIQLVALLTVLSLAPSILIMMTCFVRIVIVLSFLRSAMGTQQVPPNQVLVSLALFLTFFI 109

Query: 99  MSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRN 158
           M+P +  S   GI+PL+N  I E TA  R  EPF  FM  + RE+DL LF+D+A +    
Sbjct: 110 MAPVMQESYANGIRPLINEDIDELTAFNRAVEPFHGFMMKHVRERDLQLFLDIAKTG--- 166

Query: 159 TDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTS 218
             +     +  +++IP+FM+SEL+R+FEIGFL+ +PFL+IDM+VA+++M+MGMMMLPPT 
Sbjct: 167 -PVADPKDVPLQVVIPAFMLSELKRAFEIGFLVFVPFLVIDMVVASVLMSMGMMMLPPTL 225

Query: 219 ISLPFKVIFFVLIDGWSLLVENLVKSF 245
           I+LPFKVIFFVL+DGW L+V +LV+SF
Sbjct: 226 IALPFKVIFFVLVDGWYLIVGSLVQSF 252


>gi|115523568|ref|YP_780479.1| flagellar biosynthesis protein FliP [Rhodopseudomonas palustris
           BisA53]
 gi|115517515|gb|ABJ05499.1| flagellar biosynthetic protein FliP [Rhodopseudomonas palustris
           BisA53]
          Length = 254

 Score =  231 bits (588), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 156/212 (73%), Gaps = 4/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
            ++   ++   + T+LSIAP +LIM+T F R ++V S+LRT +G  + PPN VI++LALF
Sbjct: 43  GVTERAIQLIALLTVLSIAPSILIMMTSFTRIVVVLSLLRTALGTATAPPNAVILALALF 102

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T +VM P L +S + GI+PL+ NQIT   A +R  +P   FM+ N REKDL LF+D++ 
Sbjct: 103 LTGFVMGPVLQKSYDDGIKPLVANQITVEQAFERAVDPLRGFMQKNVREKDLKLFLDLSG 162

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                T     D +  RIL+P+FMISEL+R+FEIGFL+ LPFL+ID++VA+++M+MGMMM
Sbjct: 163 EPPPATP----DAMSLRILVPAFMISELKRAFEIGFLLFLPFLVIDLVVASVLMSMGMMM 218

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPP  +SLPFK+IFFVL+DGWSL+  +LV+S+
Sbjct: 219 LPPVVVSLPFKLIFFVLVDGWSLVAGSLVQSY 250


>gi|85716540|ref|ZP_01047510.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
 gi|85696541|gb|EAQ34429.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
          Length = 251

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 110/212 (51%), Positives = 157/212 (74%), Gaps = 4/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
            +S   ++   + T+LSIAP +LIM+T F R ++V S+LRT +G  + PPN VII+LA+F
Sbjct: 42  GVSERAIQLIALLTVLSIAPSILIMMTSFTRIVVVLSLLRTALGTATAPPNSVIIALAVF 101

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T +VM PTL +S + GI+PL+ N+IT   A+QR + P   FM+ N RE+DL LFMD++ 
Sbjct: 102 LTAFVMGPTLQKSYDDGIKPLVANEITVEEALQRASVPLRGFMQKNVREQDLKLFMDLSG 161

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                T       +  RIL+P+FMISEL+R+FEIGFL+ LPFLIID++VA+++M+MGMMM
Sbjct: 162 EPPPKTP----AELSLRILMPAFMISELKRAFEIGFLLFLPFLIIDLVVASVLMSMGMMM 217

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPP  +SLPFK+IFFVL+DGW+L+  +LV+S+
Sbjct: 218 LPPVVVSLPFKLIFFVLVDGWALVAGSLVQSY 249


>gi|288958044|ref|YP_003448385.1| flagellar biosynthetic protein [Azospirillum sp. B510]
 gi|288910352|dbj|BAI71841.1| flagellar biosynthetic protein [Azospirillum sp. B510]
          Length = 266

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 158/215 (73%), Gaps = 4/215 (1%)

Query: 31  ADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISL 90
           A  + +  IV+T G+ T+LS+AP +LIM+T F R +IV S LR  +G+  VPP  V++SL
Sbjct: 53  AGGTATGRIVQTIGLITVLSLAPSILIMMTAFTRIVIVLSFLRNALGVQQVPPTTVMMSL 112

Query: 91  ALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMD 150
           ALF+TF+VM+P  +RS   GIQPLMN +I E  A +R   P   FM ++T EKDL LFMD
Sbjct: 113 ALFLTFFVMAPVFERSYTQGIQPLMNQEIDEMEAFRRTVAPLRDFMLHHTAEKDLRLFMD 172

Query: 151 MAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMG 210
           MA    R  ++ + + +   +L+P+FMISE++R FEIGFL+ LPFLIIDM+V++I+M+MG
Sbjct: 173 MA----RLQNVQEPNDMPLHVLVPAFMISEIKRGFEIGFLLFLPFLIIDMVVSSILMSMG 228

Query: 211 MMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MMMLPPT +++PFK+IFFVL+DGW L+  +L +SF
Sbjct: 229 MMMLPPTMVAIPFKIIFFVLVDGWYLIAGSLARSF 263


>gi|154253010|ref|YP_001413834.1| flagellar biosynthetic protein FliP [Parvibaculum lavamentivorans
           DS-1]
 gi|154156960|gb|ABS64177.1| flagellar biosynthetic protein FliP [Parvibaculum lavamentivorans
           DS-1]
          Length = 248

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 159/218 (72%), Gaps = 4/218 (1%)

Query: 28  NIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVI 87
           ++  +L ++  IV+   + T+LS+AP +LIMVT F R I+V S+LRT +GM   PPN V+
Sbjct: 33  DLSDNLGLTDHIVQIVALVTVLSLAPSILIMVTSFVRIIVVLSLLRTALGMQQSPPNAVL 92

Query: 88  ISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSL 147
           +SLALF+T +VM+PT   +   GI+PLMN QI    A +R + PF  FM +  R++DL L
Sbjct: 93  VSLALFLTAFVMTPTFTTAYNEGIEPLMNQQIETAEAFERSSVPFKTFMLSQVRKQDLQL 152

Query: 148 FMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVM 207
           F+D++ +        +   I  ++++P+FMISELRR+FEIGFL+ LPF++IDM+VA+++M
Sbjct: 153 FVDLSQTEQPE----EATDIGLQVIVPAFMISELRRAFEIGFLVFLPFIVIDMVVASVLM 208

Query: 208 AMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +MGMMMLPP  ISLPFK+IFFVL+DGWSL+  +LV+SF
Sbjct: 209 SMGMMMLPPVIISLPFKLIFFVLVDGWSLIAGSLVQSF 246


>gi|92116943|ref|YP_576672.1| flagellar biosynthesis protein FliP [Nitrobacter hamburgensis X14]
 gi|91799837|gb|ABE62212.1| flagellar biosynthetic protein FliP [Nitrobacter hamburgensis X14]
          Length = 251

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 117/246 (47%), Positives = 169/246 (68%), Gaps = 7/246 (2%)

Query: 3   RYCFFALFLVTPELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           R   F L L+    +   +   D+   +    +  ++   ++   + T+LSIAP +LIM+
Sbjct: 8   RRVLFVLVLIAAGSLADPAFAQDISINLGGAGNGGVTERAIQLIALLTVLSIAPSILIMM 67

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R ++V S+LRT +G  + PPN VII+LA+F+T +VM PTL +S + GI+PL+ NQI
Sbjct: 68  TSFTRIVVVLSLLRTALGTATAPPNSVIIALAMFLTAFVMGPTLQKSYDDGIKPLVANQI 127

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           T   A+QR + P   FM+ N RE+DL LF+D+   S      T  D +  RIL+P+FMIS
Sbjct: 128 TVEEALQRASVPLRGFMQKNVREQDLKLFIDL---SGEPPPATPAD-LSLRILMPAFMIS 183

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+R+FEIGFL+ LPFLIID++VA+++M+MGMMMLPP  +SLPFK+IFFVL+DGWSL+  
Sbjct: 184 ELKRAFEIGFLLFLPFLIIDLVVASVLMSMGMMMLPPVVVSLPFKLIFFVLVDGWSLVAG 243

Query: 240 NLVKSF 245
           +LV+S+
Sbjct: 244 SLVQSY 249


>gi|86750888|ref|YP_487384.1| flagellar biosynthesis protein FliP [Rhodopseudomonas palustris
           HaA2]
 gi|86573916|gb|ABD08473.1| flagellar biosynthetic protein FliP [Rhodopseudomonas palustris
           HaA2]
          Length = 254

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 108/212 (50%), Positives = 159/212 (75%), Gaps = 4/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
            ++   ++   + T+LSIAP +LIM+T F R ++V S+LRT +G  + PPN+VII+LALF
Sbjct: 43  GVTERAIQLIALLTVLSIAPSILIMMTSFTRIVVVLSLLRTALGTATAPPNMVIIALALF 102

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T +VM PTL +S + GI+PL+ N+++   A+ R + P  +FM+ N REKDL LF+D++ 
Sbjct: 103 LTAFVMGPTLQKSYDDGIKPLIANEMSVEDALVRASGPLRIFMQKNVREKDLKLFLDLSG 162

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                T     + +  RIL+P+FMISEL+R+FEIGFL+ LPFLIID++VA+++M+MGMMM
Sbjct: 163 EPPPATP----EDLSLRILMPAFMISELKRAFEIGFLLFLPFLIIDLVVASVLMSMGMMM 218

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPP  +SLPFK+IFFVL+DGWSL+  +LV+S+
Sbjct: 219 LPPVVVSLPFKLIFFVLVDGWSLVAGSLVQSY 250


>gi|288962691|ref|YP_003452985.1| flagellar biosynthetic protein [Azospirillum sp. B510]
 gi|288914957|dbj|BAI76441.1| flagellar biosynthetic protein [Azospirillum sp. B510]
          Length = 279

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 106/223 (47%), Positives = 161/223 (72%), Gaps = 11/223 (4%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S+S  IV+   + T+LS+AP LLIMVTCF R I+V S+LR+ +G+   PPN+V++SLA+F
Sbjct: 55  SLSGRIVQGIVLLTVLSVAPGLLIMVTCFTRIIVVLSLLRSALGLQQSPPNMVLVSLAMF 114

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM---- 149
           +TF++M P +D + + G++PL+N Q+T+   ++R+ EPF  FM ++ RE+DL+ F     
Sbjct: 115 LTFHIMGPVIDSAWQDGLRPLLNEQVTQEQGLERMIEPFRGFMASHVRERDLAAFAAFTA 174

Query: 150 -------DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIV 202
                  + A    ++      + ++ R+L+P+F++SELRR+FEIGFL+ LPFL+IDM+V
Sbjct: 175 KPKPAGEEAAQPPEKDGRPVTAESVDLRLLMPAFLLSELRRAFEIGFLLFLPFLVIDMVV 234

Query: 203 ATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           A I+MAMGMMMLPP  I+LPFK+IFFVL DGW L+  +L++S+
Sbjct: 235 AAILMAMGMMMLPPVMIALPFKIIFFVLTDGWFLIAGSLIRSY 277


>gi|39936951|ref|NP_949227.1| flagellar biosynthesis protein FliP [Rhodopseudomonas palustris
           CGA009]
 gi|192292779|ref|YP_001993384.1| flagellar biosynthesis protein FliP [Rhodopseudomonas palustris
           TIE-1]
 gi|39650808|emb|CAE29331.1| putative flagellar biosynthesis protein fliP [Rhodopseudomonas
           palustris CGA009]
 gi|192286528|gb|ACF02909.1| flagellar biosynthetic protein FliP [Rhodopseudomonas palustris
           TIE-1]
          Length = 254

 Score =  228 bits (580), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 108/212 (50%), Positives = 157/212 (74%), Gaps = 4/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
            ++   ++   + T+LSIAP +L+M+T F R ++V S+LRT +G  + PPN VII+LALF
Sbjct: 43  GVTERAIQLIALLTVLSIAPSILVMMTSFTRIVVVLSLLRTALGTATAPPNAVIIALALF 102

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T +VM PTL +S + GI+PL+ N+I    A+ R + P  +FM+ N REKDL LF+D++ 
Sbjct: 103 LTAFVMGPTLQKSYDEGIKPLIANEIGVDDAMVRASGPLRIFMQKNVREKDLKLFLDLSG 162

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                T     + +  RIL+P+F+ISEL+R+FEIGFL+ LPFLIID++VA+I+M+MGMMM
Sbjct: 163 EPPPATP----EDLSLRILMPAFLISELKRAFEIGFLLFLPFLIIDLVVASILMSMGMMM 218

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPP  +SLPFK+IFFVL+DGWSL+  +LV+S+
Sbjct: 219 LPPVVVSLPFKLIFFVLVDGWSLVAGSLVQSY 250


>gi|75675323|ref|YP_317744.1| flagellar biosynthesis protein FliP [Nitrobacter winogradskyi
           Nb-255]
 gi|74420193|gb|ABA04392.1| Flagellar transport protein FliP [Nitrobacter winogradskyi Nb-255]
          Length = 251

 Score =  227 bits (579), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 117/246 (47%), Positives = 170/246 (69%), Gaps = 8/246 (3%)

Query: 3   RYCFFALFLVTPELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           R  FF L L+T   +   +   D+   +    +  ++   ++   + T+LSIAP +LIM+
Sbjct: 9   RVSFF-LILITAGSLTDPALAQDISINLGGAGNGGVTERAIQLIALLTVLSIAPSILIMM 67

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R ++V S+LRT +G  + PPN VII+LA+F+T +VM PTL +S + GI+PL+ N+ 
Sbjct: 68  TSFTRIVVVLSLLRTALGTATAPPNSVIIALAMFLTAFVMGPTLQKSYDEGIKPLVANET 127

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           T   A+QR + P   FM+ N RE+DL LFMD+   S      T  D +  RIL+P+FMIS
Sbjct: 128 TVEEALQRASVPLRGFMQKNVREQDLKLFMDL---SGEPPPATPAD-LSLRILMPAFMIS 183

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+R+FEIGFL+ LPFLIID++VA+++M+MGMMMLPP  +SLPFK+IFFVL+DGW+L+  
Sbjct: 184 ELKRAFEIGFLLFLPFLIIDLVVASVLMSMGMMMLPPVVVSLPFKLIFFVLVDGWALVAG 243

Query: 240 NLVKSF 245
           +LV+S+
Sbjct: 244 SLVQSY 249


>gi|91976169|ref|YP_568828.1| flagellar biosynthesis protein FliP [Rhodopseudomonas palustris
           BisB5]
 gi|91682625|gb|ABE38927.1| flagellar biosynthetic protein FliP [Rhodopseudomonas palustris
           BisB5]
          Length = 255

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 157/212 (74%), Gaps = 4/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
            ++   ++   + T+LSIAP +L+M+T F R ++V S+LRT +G  + PPN VII+LALF
Sbjct: 44  GVTERAIQLIALLTVLSIAPSILVMMTSFTRIVVVLSLLRTALGTATAPPNSVIIALALF 103

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T +VM PTL +S + GI+PL+ N++    A+ R + P  +FM+ N REKDL LF+D++ 
Sbjct: 104 LTGFVMGPTLQKSYDDGIKPLIANEMAVEDALVRASGPLRIFMQKNVREKDLKLFLDLSG 163

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                T     + +  RIL+P+FMISEL+R+FEIGFL+ LPFLIID++VA+++M+MGMMM
Sbjct: 164 EQPPATP----EELSLRILMPAFMISELKRAFEIGFLLFLPFLIIDLVVASVLMSMGMMM 219

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPP  +SLPFK+IFFVL+DGWSL+  +LV+S+
Sbjct: 220 LPPVVVSLPFKLIFFVLVDGWSLVAGSLVQSY 251


>gi|163744333|ref|ZP_02151693.1| flagellar biosynthetic protein FliP [Oceanibulbus indolifex HEL-45]
 gi|161381151|gb|EDQ05560.1| flagellar biosynthetic protein FliP [Oceanibulbus indolifex HEL-45]
          Length = 278

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 163/234 (69%), Gaps = 8/234 (3%)

Query: 21  SSLHDVMNIPA-----DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTG 75
            +L DV+   A     + ++S  IV+   + T+LSIAP LL+++T F RF+IV S+LR+ 
Sbjct: 40  GTLSDVIGDSAPGSDENANLSGRIVQFIALMTVLSIAPGLLVVMTSFTRFVIVLSMLRSA 99

Query: 76  MGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVF 135
           +G+   PPN+V+ SLALFMTF+VM P  + + E G+QPL+ N I E  A++R+A PF  F
Sbjct: 100 LGLNQTPPNIVLTSLALFMTFFVMQPVFEDAYEAGVQPLLENAIAEEQALERIAAPFKSF 159

Query: 136 MRNNTREKDLSLFMDMAHSSHRNTDI---TKNDHIEYRILIPSFMISELRRSFEIGFLII 192
           M  NTR +D +LF+ +A +     +       +   +R L+P+FMISELRR+F IGFLI 
Sbjct: 160 MYVNTRPEDYALFLRIAPADEEAEETPLPASAEEATFRHLVPAFMISELRRAFTIGFLIY 219

Query: 193 LPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           LPF+ ID+I+A+++M+ GMMMLPP  ISLPFKVIFFVLIDGW +L  +L++S++
Sbjct: 220 LPFVAIDLIIASVLMSAGMMMLPPVLISLPFKVIFFVLIDGWYMLAGSLIESYV 273


>gi|316932831|ref|YP_004107813.1| flagellar biosynthetic protein FliP [Rhodopseudomonas palustris
           DX-1]
 gi|315600545|gb|ADU43080.1| flagellar biosynthetic protein FliP [Rhodopseudomonas palustris
           DX-1]
          Length = 255

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 157/212 (74%), Gaps = 4/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
            ++   ++   + T+LSIAP +LIM+T F R ++V S+LRT +G  + PPN VII+LALF
Sbjct: 44  GVTERAIQLIALLTVLSIAPSILIMMTSFTRIVVVLSLLRTALGTATAPPNAVIIALALF 103

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T +VM PTL ++ + GI+PL+ N+I    A+ R + P  VFM+ N REKDL LF+D++ 
Sbjct: 104 LTAFVMGPTLQKAYDDGIKPLIANEIGVDDALVRASGPMRVFMQKNVREKDLKLFLDLSG 163

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                T     + +  RIL+P+F+ISEL+R+FEIGFL+ LPFLIID++VA+I+M+MGMMM
Sbjct: 164 EPPPATP----EDLSLRILMPAFLISELKRAFEIGFLLFLPFLIIDLVVASILMSMGMMM 219

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPP  +SLPFK+IFFVL+DGWSL+  +LV+S+
Sbjct: 220 LPPVVVSLPFKLIFFVLVDGWSLVAGSLVQSY 251


>gi|46200839|ref|ZP_00056386.2| COG1338: Flagellar biosynthesis pathway, component FliP
           [Magnetospirillum magnetotacticum MS-1]
          Length = 241

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 105/212 (49%), Positives = 155/212 (73%), Gaps = 4/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S ++ I++   + T+LS+AP +L+M+T F RF++V   LR  +G    PPN V++SLA+F
Sbjct: 33  SATSRIIQLIALTTVLSVAPSILVMITSFTRFVVVLGFLRQALGTQQSPPNTVMVSLAMF 92

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T +VM+PT +++   GIQP+M+  + E    +R  +PF  FM  + R +DL LFMDM+ 
Sbjct: 93  LTAFVMTPTFEKAWTDGIQPVMDGHLDEIEGFERAIKPFHAFMSKHVRAQDLKLFMDMS- 151

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
              R  ++ K + +  R LIP+FMISELRR+FEIGFLI LPFLIIDM++A+++M+MGMMM
Sbjct: 152 ---RAKEVEKAEDVPLRALIPAFMISELRRAFEIGFLIFLPFLIIDMVIASVLMSMGMMM 208

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +PP  ISLPFK+IFFV++DGW L+V +LV+S+
Sbjct: 209 IPPAMISLPFKLIFFVMVDGWYLVVGSLVQSY 240


>gi|158422252|ref|YP_001523544.1| flagellar biosynthetic FliP protein [Azorhizobium caulinodans ORS
           571]
 gi|158329141|dbj|BAF86626.1| flagellar biosynthetic FliP protein [Azorhizobium caulinodans ORS
           571]
          Length = 292

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 129/260 (49%), Positives = 171/260 (65%), Gaps = 30/260 (11%)

Query: 16  LVFAKSSLHDVMNIPA--------DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFII 67
           L +A++ +     IP+          ++S  I++   + T+LSIAP LLIMVT F RF+I
Sbjct: 32  LAYAQNRVQGDTQIPSLDSLLGDNGGAVSGRIIQMVMVLTVLSIAPGLLIMVTSFTRFVI 91

Query: 68  VFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQR 127
             S LR+G+G+ S P NLV+ISL+LFMTFYVM PT D++   G++PL   +ITE  A  +
Sbjct: 92  ALSFLRSGLGLSSTPANLVLISLSLFMTFYVMGPTFDKAWTEGVRPLTERKITEEEAFTK 151

Query: 128 VAEPFWVFMRNNTREKDLSLFMDMAH----------------------SSHRNTDITKND 165
           ++EPF  FM +  R KDL LF D+A                       S +R+ +     
Sbjct: 152 ISEPFREFMLSQVRPKDLRLFADIAAATGRPSKNDPETAAQNNSAPATSPNRDQNAQPER 211

Query: 166 HIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKV 225
            IE RILIP+FMISELRR FEIGFLIILPFLIIDMIVAT+VM+MGMMM+ P +++LPFK+
Sbjct: 212 QIELRILIPAFMISELRRGFEIGFLIILPFLIIDMIVATLVMSMGMMMMSPAALALPFKI 271

Query: 226 IFFVLIDGWSLLVENLVKSF 245
           +FFVLIDGW++LV  LV+SF
Sbjct: 272 LFFVLIDGWNILVSGLVRSF 291


>gi|163849877|ref|YP_001637920.1| flagellar biosynthetic protein FliP [Methylobacterium extorquens
           PA1]
 gi|163661482|gb|ABY28849.1| flagellar biosynthetic protein FliP [Methylobacterium extorquens
           PA1]
          Length = 253

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/202 (50%), Positives = 150/202 (74%), Gaps = 4/202 (1%)

Query: 44  GIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTL 103
            + T+L++AP +L+M T F R ++V SILR+ +G  + PPN V++SLALF+T +VM+PT 
Sbjct: 54  ALITVLALAPSVLVMATSFTRIVVVLSILRSALGTQTAPPNTVMVSLALFLTAFVMAPTA 113

Query: 104 DRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITK 163
             +   G++PLM  QI+++ A +R + PF  FM  N REKDL LF+DMA    R      
Sbjct: 114 REAYRTGVEPLMAGQISQSQAFERASAPFKTFMLRNVREKDLKLFLDMA----RQPAPAG 169

Query: 164 NDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPF 223
            + I   I+ P+FMISELRR+FEIGFL+ +PFLIID++VA+++MAMGMMMLPP +++LPF
Sbjct: 170 PEAIGLEIVTPAFMISELRRAFEIGFLLFIPFLIIDLVVASVLMAMGMMMLPPATVALPF 229

Query: 224 KVIFFVLIDGWSLLVENLVKSF 245
           K+IFFVL+DGW+L+  +L++S+
Sbjct: 230 KLIFFVLVDGWTLVAGSLIQSY 251


>gi|328543163|ref|YP_004303272.1| flagellar transport protein FliP [polymorphum gilvum SL003B-26A1]
 gi|326412909|gb|ADZ69972.1| Flagellar transport protein FliP [Polymorphum gilvum SL003B-26A1]
          Length = 245

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 157/212 (74%), Gaps = 4/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S++   V+   + T+LS+AP +L+MVT F R ++V S+LR+ +G+ + PPN+V++SLALF
Sbjct: 35  SLTERAVQLVALLTVLSLAPSILVMVTSFTRIVVVLSLLRSAIGLQTAPPNMVMVSLALF 94

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T ++M+PTL  + E G+QPL+   I    A +R + PF  FM +  REKDL+LF +++ 
Sbjct: 95  LTAFIMAPTLQVAYEEGVQPLVEGTIEFDQAFERASTPFHAFMLSQVREKDLALFQELSG 154

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                T     + + ++ LIP+FMISELRR+FEIGFL+ LPFLIID++VA+++M+MGMMM
Sbjct: 155 QEAPET----QEDLSFQTLIPAFMISELRRAFEIGFLLYLPFLIIDLVVASVLMSMGMMM 210

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPP  ISLPFK+IFFVL+DGW+L+  +LV+SF
Sbjct: 211 LPPVVISLPFKLIFFVLVDGWNLVAGSLVRSF 242


>gi|218528509|ref|YP_002419325.1| flagellar biosynthetic protein FliP [Methylobacterium
           chloromethanicum CM4]
 gi|240137103|ref|YP_002961572.1| flagellar biosynthesis protein FliP [Methylobacterium extorquens
           AM1]
 gi|218520812|gb|ACK81397.1| flagellar biosynthetic protein FliP [Methylobacterium
           chloromethanicum CM4]
 gi|240007069|gb|ACS38295.1| flagellar biosynthesis protein FliP [Methylobacterium extorquens
           AM1]
          Length = 253

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 103/202 (50%), Positives = 150/202 (74%), Gaps = 4/202 (1%)

Query: 44  GIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTL 103
            + T+L++AP +L+M T F R ++V SILR+ +G  + PPN V++SLALF+T +VM+PT 
Sbjct: 54  ALITVLALAPSVLVMATSFTRIVVVLSILRSALGTQTAPPNTVMVSLALFLTAFVMAPTA 113

Query: 104 DRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITK 163
             +   G++PLM  QI+++ A +R + PF  FM  N REKDL LF+DMA    R      
Sbjct: 114 REAYRTGVEPLMAGQISQSQAFERASAPFKTFMLRNVREKDLKLFLDMA----RQPAPAG 169

Query: 164 NDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPF 223
            + I   I+ P+FMISELRR+FEIGFL+ +PFLIID++VA+++MAMGMMMLPP +++LPF
Sbjct: 170 PEAIGLEIVTPAFMISELRRAFEIGFLLFIPFLIIDLVVASVLMAMGMMMLPPATVALPF 229

Query: 224 KVIFFVLIDGWSLLVENLVKSF 245
           K+IFFVL+DGW+L+  +L++S+
Sbjct: 230 KLIFFVLVDGWTLVAGSLIQSY 251


>gi|254559115|ref|YP_003066210.1| flagellar biosynthesis protein FliP [Methylobacterium extorquens
           DM4]
 gi|254266393|emb|CAX22157.1| flagellar biosynthesis protein FliP [Methylobacterium extorquens
           DM4]
          Length = 253

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 103/202 (50%), Positives = 150/202 (74%), Gaps = 4/202 (1%)

Query: 44  GIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTL 103
            + T+L++AP +L+M T F R ++V SILR+ +G  + PPN V++SLALF+T +VM+PT 
Sbjct: 54  ALITVLALAPSVLVMATSFTRIVVVLSILRSALGTQTAPPNTVMVSLALFLTAFVMAPTA 113

Query: 104 DRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITK 163
             +   G++PLM  QI+++ A +R + PF  FM  N REKDL LF+DMA    R      
Sbjct: 114 REAYRTGVEPLMAGQISQSQAFERASAPFKTFMLRNVREKDLKLFLDMA----RQPAPAG 169

Query: 164 NDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPF 223
            + I   I+ P+FMISELRR+FEIGFL+ +PFLIID++VA+++MAMGMMMLPP +++LPF
Sbjct: 170 PEAIGLEIVTPAFMISELRRAFEIGFLLFIPFLIIDLVVASVLMAMGMMMLPPATVALPF 229

Query: 224 KVIFFVLIDGWSLLVENLVKSF 245
           K+IFFVL+DGW+L+  +L++S+
Sbjct: 230 KLIFFVLVDGWTLVAGSLIQSY 251


>gi|89068716|ref|ZP_01156102.1| flagellar biosynthesis protein [Oceanicola granulosus HTCC2516]
 gi|89045679|gb|EAR51741.1| flagellar biosynthesis protein [Oceanicola granulosus HTCC2516]
          Length = 282

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 159/221 (71%), Gaps = 9/221 (4%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
            +S  I++   + T+LS+AP LLI++T F RF+IVFSILR+ +G+   PPN+V+ S+ALF
Sbjct: 58  ELSGRILQLIALITVLSLAPGLLIVMTSFTRFVIVFSILRSALGLNQTPPNVVLTSMALF 117

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTF+VM P  + + E G+QPLM+N ITE  A++R+A+PF  FM  NTR  DL LF ++A 
Sbjct: 118 MTFFVMQPVFEDAWEDGLQPLMSNAITEEQAVERIADPFKTFMFANTRPVDLDLFREIAA 177

Query: 154 SSHRNTDI--------TKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATI 205
            +  +           T  D   +R L+P+FMISELRR+F IGFLI LPF+ ID+IVA+I
Sbjct: 178 RAGGDDAGAIELPPPETAADA-SWRELVPAFMISELRRAFTIGFLIFLPFIAIDLIVASI 236

Query: 206 VMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           +M+ GMMMLPP  ISLPFKVIFFVLIDGW +L  +L++S++
Sbjct: 237 LMSAGMMMLPPVLISLPFKVIFFVLIDGWHMLAGSLIESYL 277


>gi|188579766|ref|YP_001923211.1| flagellar biosynthetic protein FliP [Methylobacterium populi BJ001]
 gi|179343264|gb|ACB78676.1| flagellar biosynthetic protein FliP [Methylobacterium populi BJ001]
          Length = 253

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 102/201 (50%), Positives = 150/201 (74%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+L++AP +L+M T F R ++V SILR+ +G  + PPN V++SLALF+T +VM+PT  
Sbjct: 55  LITVLALAPSVLVMATSFTRIVVVLSILRSALGTQTAPPNTVMVSLALFLTAFVMAPTAR 114

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
            +   G++PL+  QI+++ A +R + PF  FM  N REKDL LF+DMA    R       
Sbjct: 115 EAYRAGVEPLVAGQISQSQAFERASAPFKTFMLRNVREKDLKLFLDMA----RQPAPAGP 170

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           + I   I+ P+FMISELRR+FEIGFL+ +PFLIID++VA+++MAMGMMMLPP +++LPFK
Sbjct: 171 EAIGLEIVTPAFMISELRRAFEIGFLLFIPFLIIDLVVASVLMAMGMMMLPPATVALPFK 230

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           +IFFVL+DGW+L+  +L++S+
Sbjct: 231 LIFFVLVDGWTLVAGSLIQSY 251


>gi|220925383|ref|YP_002500685.1| flagellar biosynthetic protein FliP [Methylobacterium nodulans ORS
           2060]
 gi|219949990|gb|ACL60382.1| flagellar biosynthetic protein FliP [Methylobacterium nodulans ORS
           2060]
          Length = 251

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 108/231 (46%), Positives = 160/231 (69%), Gaps = 8/231 (3%)

Query: 19  AKSSLHDVMNIPADLSISTWI----VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRT 74
           A +S     ++  DL  S  +    ++   + T+L++AP +L+M T F R ++V SILR+
Sbjct: 23  ASASGALAQSVTVDLGPSGGVTERALQLVALITVLALAPSVLVMATSFTRIVVVLSILRS 82

Query: 75  GMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWV 134
            +G  + PPN VI+SLALF+T +VM+PT   +   GI+PL+  QI ++ A +R A PF  
Sbjct: 83  ALGTQTAPPNAVIVSLALFLTAFVMAPTARDAYRAGIEPLVAGQIQQSQAFERAAAPFKA 142

Query: 135 FMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILP 194
           FM    REKDL LF+D+A +    T     + +   IL P+FMISELRR+FEIGFL+ +P
Sbjct: 143 FMLRTVREKDLQLFLDLAKAPRPATP----EAVGLEILTPAFMISELRRAFEIGFLLFIP 198

Query: 195 FLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FLIID++VA+I+M++GMMMLPP +++LPFK+IFFVL+DGW+L+  +LV+S+
Sbjct: 199 FLIIDLVVASILMSVGMMMLPPATVALPFKLIFFVLVDGWTLVAGSLVQSY 249


>gi|299131778|ref|ZP_07024973.1| flagellar biosynthetic protein FliP [Afipia sp. 1NLS2]
 gi|298591915|gb|EFI52115.1| flagellar biosynthetic protein FliP [Afipia sp. 1NLS2]
          Length = 252

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 105/212 (49%), Positives = 153/212 (72%), Gaps = 4/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
            ++   ++   + T+LS+AP +L+M+T F R ++V S+LRT MG  + PPN V+I+LALF
Sbjct: 42  GVTARAIQLIALLTVLSVAPSILVMMTSFTRIVVVLSLLRTAMGTATAPPNSVMIALALF 101

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T +VM P L +S + G++P++ NQ+T    +     P   FM+ N REKDL LFMD++ 
Sbjct: 102 LTGFVMGPVLQKSYDDGVKPVIANQLTVEQGLPLAIAPLRGFMQKNVREKDLKLFMDLSR 161

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                T     D +  RILIP+FMISEL+R+FEIGFL+ LPFLIID++V++++M+MGMMM
Sbjct: 162 EPPPATP----DEMSLRILIPAFMISELKRAFEIGFLLFLPFLIIDLVVSSVLMSMGMMM 217

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPP  +SLPFK+IFFVL+DGWSL+  +LV+S+
Sbjct: 218 LPPVVVSLPFKLIFFVLVDGWSLVAGSLVQSY 249


>gi|83309709|ref|YP_419973.1| flagellar biosynthesis protein FliP [Magnetospirillum magneticum
           AMB-1]
 gi|82944550|dbj|BAE49414.1| Flagellar biosynthesis pathway [Magnetospirillum magneticum AMB-1]
          Length = 250

 Score =  223 bits (567), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 153/212 (72%), Gaps = 4/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S ++ I++   + T+LS+AP +L+MVT F RF++V   LR  +G    PPN V++SLA+F
Sbjct: 42  SATSRIIQLIALTTVLSVAPSILVMVTSFTRFVVVLGFLRQALGTQQSPPNTVMVSLAMF 101

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T +VM+PT +++   GI P+M+  + E    +R  +PF  FM  + R +DL LFMD++ 
Sbjct: 102 LTAFVMAPTFEKAWTDGIAPVMDGHLDEIEGFERAVKPFHAFMSKHVRGQDLKLFMDLS- 160

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
              R  ++ K +    R LIP+FMISELRR+FEIGFLI LPFLIIDM++A+++M+MGMMM
Sbjct: 161 ---RAKEVEKAEDAPLRALIPAFMISELRRAFEIGFLIFLPFLIIDMVIASVLMSMGMMM 217

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +PP  ISLPFK+IFFV++DGW L+V +LV+S+
Sbjct: 218 IPPAMISLPFKLIFFVMVDGWYLVVGSLVQSY 249


>gi|254504560|ref|ZP_05116711.1| flagellar biosynthetic protein FliP [Labrenzia alexandrii DFL-11]
 gi|222440631|gb|EEE47310.1| flagellar biosynthetic protein FliP [Labrenzia alexandrii DFL-11]
          Length = 255

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 109/214 (50%), Positives = 160/214 (74%), Gaps = 4/214 (1%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D +++   V+   + T+LS+AP +L+MVT F R ++V S+LR+ +G+ + PPN+V++SLA
Sbjct: 43  DANLTERAVQLVILLTVLSLAPSILVMVTSFTRIVVVLSLLRSAIGLQTAPPNMVMVSLA 102

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF++ ++M PTL  + + G+QPL++  I    A +R +EPF  FM +  REKDL LF ++
Sbjct: 103 LFLSAFIMMPTLQAAYDAGVQPLIDGDIEIDQAYERASEPFRDFMLSQVREKDLMLFQEL 162

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
              S R+   T  D +E  +LIP+FMISELRR+FEIGFL+ LPFLIID+++A+++M+MGM
Sbjct: 163 ---SGRDAPETPED-LEMAVLIPAFMISELRRAFEIGFLLYLPFLIIDLVIASVLMSMGM 218

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MMLPP  ISLPFK+IFFVL+DGW+L+  +LVKSF
Sbjct: 219 MMLPPVVISLPFKLIFFVLVDGWNLVAGSLVKSF 252


>gi|170743261|ref|YP_001771916.1| flagellar biosynthetic protein FliP [Methylobacterium sp. 4-46]
 gi|168197535|gb|ACA19482.1| flagellar biosynthetic protein FliP [Methylobacterium sp. 4-46]
          Length = 283

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 100/202 (49%), Positives = 153/202 (75%), Gaps = 4/202 (1%)

Query: 44  GIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTL 103
            + T+L++AP +L+M T F R ++V SILR+ +G  + PPN VI+SLALF+T +VM+PT 
Sbjct: 84  ALITVLALAPSVLVMATAFTRIVVVLSILRSALGTQTAPPNAVIVSLALFLTAFVMAPTA 143

Query: 104 DRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITK 163
             +   GI+PL+  QI+++ A +R ++PF  FM  + REKDL LF+D++++    T    
Sbjct: 144 REAYRTGIEPLVAGQISQSQAFERASQPFKAFMLRSVREKDLRLFLDLSNAPRPATP--- 200

Query: 164 NDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPF 223
            + +   IL P+FMISELRR+FEIGFL+ +PFLIID++VA+++M++GMMMLPP +++LPF
Sbjct: 201 -EAVGLEILTPAFMISELRRAFEIGFLLFIPFLIIDLVVASVLMSVGMMMLPPATVALPF 259

Query: 224 KVIFFVLIDGWSLLVENLVKSF 245
           K+IFFVL+DGW+L+  +LV+S+
Sbjct: 260 KLIFFVLVDGWTLVAGSLVQSY 281


>gi|300024600|ref|YP_003757211.1| flagellar biosynthetic protein FliP [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526421|gb|ADJ24890.1| flagellar biosynthetic protein FliP [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 247

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 114/216 (52%), Positives = 162/216 (75%), Gaps = 2/216 (0%)

Query: 31  ADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISL 90
            D S+S  IV+   + T+LS+AP LL+MVT F RF+I  S LR+G+G+ + P N++++SL
Sbjct: 34  GDASVSGRIVQLLVVMTVLSVAPGLLMMVTSFARFVIALSFLRSGLGLQTTPSNMILVSL 93

Query: 91  ALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMD 150
           ALFMT +VM+PT   + + G++P++ N+I++    QR  EPF  FM+ N REKD+++F D
Sbjct: 94  ALFMTMFVMAPTFQAAWDNGVKPMVENKISQEEGYQRTTEPFRAFMKANVREKDIAIFQD 153

Query: 151 MAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMG 210
           +  S+ R  +  K    + R+LIP+FM+SELRR FEIGFL+ LPFL+ID++VATI+ +MG
Sbjct: 154 L--SAERFGEANKAGPDDLRVLIPAFMVSELRRGFEIGFLVTLPFLVIDLVVATIMTSMG 211

Query: 211 MMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           MMM+PPT +SLP K++FFVL+DGWSLLV  LVKSFI
Sbjct: 212 MMMMPPTVVSLPLKILFFVLVDGWSLLVGALVKSFI 247


>gi|209884533|ref|YP_002288390.1| flagellar biosynthetic protein FliP [Oligotropha carboxidovorans
           OM5]
 gi|209872729|gb|ACI92525.1| flagellar biosynthetic protein FliP [Oligotropha carboxidovorans
           OM5]
          Length = 253

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 155/215 (72%), Gaps = 4/215 (1%)

Query: 31  ADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISL 90
            +  ++   ++   + T+LSIAP +L+M+T F R ++V S+LRT +G  + PPN V+I+L
Sbjct: 39  GNGGVTERAIQLIALLTVLSIAPSILVMMTSFTRIVVVLSLLRTALGTATAPPNSVMIAL 98

Query: 91  ALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMD 150
           ALF+T +VM P L +S + G++P++ N+++     +R   P   FM+ N REKDL LFMD
Sbjct: 99  ALFLTGFVMGPVLQKSYDEGVKPVIANELSVEQGFERAVGPLRGFMQKNVREKDLKLFMD 158

Query: 151 MAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMG 210
           ++      T     + +  RILIP+FMISEL+R+FEIGFL+ LPFLIID++V++++M+MG
Sbjct: 159 LSGEPPPATP----EEMSLRILIPAFMISELKRAFEIGFLLFLPFLIIDLVVSSVLMSMG 214

Query: 211 MMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MMMLPP  +SLPFK+IFFVL+DGW+L+  +LV+S+
Sbjct: 215 MMMLPPVVVSLPFKLIFFVLVDGWALVAGSLVQSY 249


>gi|118588703|ref|ZP_01546111.1| flagellar biosynthesis protein P [Stappia aggregata IAM 12614]
 gi|118438689|gb|EAV45322.1| flagellar biosynthesis protein P [Stappia aggregata IAM 12614]
          Length = 237

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 157/214 (73%), Gaps = 3/214 (1%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D +++   V+   + T+LS+AP +L+MVT F R ++V S+LR+ +G+ + PPN+V++SLA
Sbjct: 24  DTTLTERAVQMVILLTVLSLAPSILVMVTSFTRIVVVLSLLRSAIGLQTAPPNMVMVSLA 83

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF++ ++M PTL  S + G+QPL++  I    A +R ++PF  FM +  REKDL+LF ++
Sbjct: 84  LFLSAFIMMPTLQASYDAGVQPLIDGDIELEQAFERASDPFRTFMLSQVREKDLALFEEL 143

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + +          + +    L+P+FMISELRR+FEIGFL+ LPFLIID+++A+++M+MGM
Sbjct: 144 SGAEEAPE---SPEDLSMATLVPAFMISELRRAFEIGFLLYLPFLIIDLVIASVLMSMGM 200

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MMLPP  ISLPFK+IFFVL+DGW+L+  +LVKSF
Sbjct: 201 MMLPPVVISLPFKLIFFVLVDGWNLVAGSLVKSF 234


>gi|254292926|ref|YP_003058949.1| flagellar biosynthetic protein FliP [Hirschia baltica ATCC 49814]
 gi|254041457|gb|ACT58252.1| flagellar biosynthetic protein FliP [Hirschia baltica ATCC 49814]
          Length = 255

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 153/213 (71%), Gaps = 4/213 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
            +++ IV   G+ TILS+AP +L+M T F R ++V S+LRT MG+   PPN VIISL+LF
Sbjct: 42  GMTSGIVEMLGVITILSLAPSILVMTTSFVRIVVVLSLLRTAMGLQQAPPNAVIISLSLF 101

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T +VM+PT + + + G++P M   I    A+ R A P   FM  + ++ DL+LFM MA+
Sbjct: 102 LTAFVMAPTFEAAYKEGVEPFMAESIGLEDALPRAAAPIKTFMAKHVQDDDLALFMGMAN 161

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                  +   +   +++L P+FMISEL+R+FEIGF+I LPFL+ID++VA+I+M+MGMMM
Sbjct: 162 IET----LESAEAAPFQVLAPAFMISELKRAFEIGFMIFLPFLVIDLVVASILMSMGMMM 217

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           LPP +IS+PFK+IFFVL+DGW LL  +LV+SF+
Sbjct: 218 LPPVTISMPFKLIFFVLVDGWRLLAGSLVESFV 250


>gi|296534353|ref|ZP_06896817.1| flagellar biosynthetic protein FliP [Roseomonas cervicalis ATCC
           49957]
 gi|296265319|gb|EFH11480.1| flagellar biosynthetic protein FliP [Roseomonas cervicalis ATCC
           49957]
          Length = 258

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 105/224 (46%), Positives = 156/224 (69%), Gaps = 4/224 (1%)

Query: 22  SLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSV 81
           SL+  +  P +   +T +V+   +  +LS+AP LL+MVT F R  IV S+LR+ +G   V
Sbjct: 35  SLNLDLGQPGEAGATTRLVQLTALIGLLSLAPSLLVMVTAFARISIVLSLLRSAIGAPGV 94

Query: 82  PPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTR 141
           PPN V+I LALF+TF+VM P L+ S   G+QP+   Q+ E   +Q  AEPF  FM  + R
Sbjct: 95  PPNPVLIGLALFLTFFVMQPVLEASWTQGLQPMAAGQLGEIEGLQAAAEPFRGFMLAHAR 154

Query: 142 EKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMI 201
           + D++LF+D+A+       + +     +R+L+P+F++ ELRR+FEIGFLI LPFL+ID++
Sbjct: 155 DSDIALFLDLANLPA----VEEPARTPWRVLVPAFLVGELRRAFEIGFLIFLPFLVIDIV 210

Query: 202 VATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           VA+++M +GMMMLPP ++SLPFK+IFFVL+DGW L+  +LV+ F
Sbjct: 211 VASVLMGLGMMMLPPNTVSLPFKLIFFVLVDGWRLVSGSLVQGF 254


>gi|46204265|ref|ZP_00050254.2| COG1338: Flagellar biosynthesis pathway, component FliP
           [Magnetospirillum magnetotacticum MS-1]
          Length = 249

 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 158/231 (68%), Gaps = 7/231 (3%)

Query: 18  FAKSSLHDVMNIPADLS---ISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRT 74
           F  S+     ++  DLS   +S   ++   + T+LS+AP  L++VT F R ++VFSILR+
Sbjct: 21  FLGSTPASAQSLTIDLSSGGVSERALQLVALVTVLSLAPSALVVVTSFTRLVVVFSILRS 80

Query: 75  GMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWV 134
            +G  S PPN V+++LALF+T +VM+P   ++   GI PL+  +I +  A +R   PF  
Sbjct: 81  ALGTQSAPPNAVLVALALFLTAFVMAPVGRQAYTAGIAPLLAGEIQQGQAFERTLAPFRA 140

Query: 135 FMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILP 194
           FM  N REKDL LF+ MA    +       + I   ++ P+FMISEL R+FEIGFL+ +P
Sbjct: 141 FMLKNVREKDLDLFLKMA----KTPPPASPEEIGLEVVTPAFMISELSRAFEIGFLLFIP 196

Query: 195 FLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           F+IID+ V++++MA+GMMM+PPTS+SLPFK+IFFVL+DGWSLLV +LV+SF
Sbjct: 197 FMIIDLAVSSVLMALGMMMMPPTSVSLPFKLIFFVLVDGWSLLVGSLVQSF 247


>gi|254470348|ref|ZP_05083752.1| flagellar biosynthetic protein FliP [Pseudovibrio sp. JE062]
 gi|211960659|gb|EEA95855.1| flagellar biosynthetic protein FliP [Pseudovibrio sp. JE062]
          Length = 248

 Score =  218 bits (555), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 163/239 (68%), Gaps = 5/239 (2%)

Query: 7   FALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFI 66
           FALFL       A+S   D      D S++   V+   + T+LS+AP +LIMVT F R +
Sbjct: 13  FALFLFWFGPAAAQSISIDFGGGEGD-SVTERAVQLVMLLTVLSLAPSILIMVTSFTRIV 71

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           +V S+LR+ +G+ + PPN V++SLALF+T +VM P  + + ++G +P++   I    A +
Sbjct: 72  VVLSLLRSAIGLQTAPPNAVMLSLALFLTAFVMMPAFETAWDLGAKPMIEGTIEPQEAFE 131

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           R +EPF  FMR   RE DL LF ++A +    T     + +  R+L+P+FMISELRR+FE
Sbjct: 132 RASEPFHQFMRQQVRESDLLLFQELAKAPTPETP----EDLSLRVLVPAFMISELRRAFE 187

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGFL+ LPFLIID+++A+++M+MGMMMLPP  ISLPFK+IFFVL+DGW L+  +LV+SF
Sbjct: 188 IGFLLYLPFLIIDLVIASVLMSMGMMMLPPIVISLPFKLIFFVLVDGWQLIAGSLVRSF 246


>gi|58039965|ref|YP_191929.1| flagellar biosynthesis protein FliP [Gluconobacter oxydans 621H]
 gi|58002379|gb|AAW61273.1| Flagellar biosynthetic protein FliP [Gluconobacter oxydans 621H]
          Length = 255

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 106/237 (44%), Positives = 160/237 (67%), Gaps = 6/237 (2%)

Query: 11  LVTPELVFAKSSLHDVMNIPADLSIST--WIVRTFGIFTILSIAPILLIMVTCFPRFIIV 68
           L  P L  A++   D+    A     T   +V+   + T+LS+AP LL+M+T F R +IV
Sbjct: 21  LAFPHLAHAQAVSIDLGQNGASGGAGTTSRLVQLTALITVLSLAPSLLVMITAFTRIVIV 80

Query: 69  FSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRV 128
            S+LR+ +G   +PPN V+I LALF+T +VM PTL +S + GI+PLM  ++ E   +   
Sbjct: 81  LSLLRSALGAQGMPPNTVLIGLALFLTLFVMQPTLQKSWDAGIEPLMAGRVGEMEGLTAA 140

Query: 129 AEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIG 188
           A+PF  FM    R  D++ F+++AH         K     +R+L+P+FMI ELRR FE+G
Sbjct: 141 AQPFHDFMAVTARPADVATFLNIAH----EKPPAKIGDTPWRVLVPAFMIGELRRGFEMG 196

Query: 189 FLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FL+ LPFL+ID++V++++M++GMMMLPP+++SLPFK+IFFV++DGWSL+  +LV+SF
Sbjct: 197 FLLYLPFLVIDLVVSSVLMSLGMMMLPPSTVSLPFKLIFFVVVDGWSLVAGSLVRSF 253


>gi|144900473|emb|CAM77337.1| Type III secretion system inner membrane P protein
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 253

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 99/207 (47%), Positives = 150/207 (72%), Gaps = 4/207 (1%)

Query: 39  IVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYV 98
           I++   + T+LS+AP +L+MVT F R +IV   LR  +G    PPN+V++SLA+F+T ++
Sbjct: 48  IIQLIALTTVLSVAPSILVMVTSFTRIVIVLGFLRQALGTMQSPPNMVLVSLAMFLTAFI 107

Query: 99  MSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRN 158
           M+PTL++S   G+QP +   + E  A +   +P   FM  + R++DL LF+D++    R 
Sbjct: 108 MAPTLEQSWNDGVQPYVEGSLEEAAAFEATVKPLQTFMLRHVRDQDLQLFLDLS----RT 163

Query: 159 TDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTS 218
            D+ K +    + LIP+FMISELRR+FEIGFLI LPF++IDM++A+++M+MGMMM+PP  
Sbjct: 164 PDVAKAEDAPLKALIPAFMISELRRAFEIGFLIFLPFIVIDMVIASVLMSMGMMMIPPAM 223

Query: 219 ISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +SLPFK+IFFVL+DGW ++V +LV+SF
Sbjct: 224 VSLPFKLIFFVLVDGWYMVVGSLVQSF 250


>gi|170751431|ref|YP_001757691.1| flagellar biosynthetic protein FliP [Methylobacterium radiotolerans
           JCM 2831]
 gi|170657953|gb|ACB27008.1| flagellar biosynthetic protein FliP [Methylobacterium radiotolerans
           JCM 2831]
          Length = 255

 Score =  216 bits (549), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 98/202 (48%), Positives = 147/202 (72%), Gaps = 4/202 (1%)

Query: 44  GIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTL 103
            + T+L++AP +L+M T F R ++V SILR+ +G  + PP  V++SLALF+T +VM+PT 
Sbjct: 56  ALITVLAVAPSVLVMATAFTRIVVVLSILRSALGTQTAPPTAVLVSLALFLTAFVMAPTG 115

Query: 104 DRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITK 163
             +   GI+PL+  +IT+  A +R + PF  FM  N REKDL LF+D+A           
Sbjct: 116 RAAYSAGIEPLIAGRITQAQAFERASAPFKTFMLRNVREKDLKLFLDLAKVPAPK----G 171

Query: 164 NDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPF 223
            + +   I+ P+FMISELRR+FEIGFL+ +PFLIID++VA+++MA+GMMM+PP +++LPF
Sbjct: 172 PEDVGLEIVTPAFMISELRRAFEIGFLLFIPFLIIDLVVASVLMAVGMMMVPPATVALPF 231

Query: 224 KVIFFVLIDGWSLLVENLVKSF 245
           K+IFFVL+DGW+L+  +LV+S+
Sbjct: 232 KLIFFVLVDGWTLVAGSLVQSY 253


>gi|114570490|ref|YP_757170.1| flagellar biosynthesis protein FliP [Maricaulis maris MCS10]
 gi|114340952|gb|ABI66232.1| flagellar biosynthetic protein FliP [Maricaulis maris MCS10]
          Length = 251

 Score =  215 bits (547), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 166/243 (68%), Gaps = 5/243 (2%)

Query: 4   YCFFALFLVTPELVFAKSSLHDV-MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCF 62
           +CF    L    L+  ++    V ++   + +++  +++   + T+LS+AP ++IM T F
Sbjct: 9   FCFSLFLLGVITLIGFQADAQTVTIDAGQEGALTERVLQLMALLTVLSLAPSIIIMTTSF 68

Query: 63  PRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITET 122
            R I+V S+LRTG+G+   PPN V++SLA+FMT ++M+P   +S + GIQPL+N +I  T
Sbjct: 69  VRIIVVLSLLRTGLGLQQSPPNAVLVSLAIFMTGFIMAPVFTQSYDEGIQPLLNEEIELT 128

Query: 123 TAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELR 182
            A      P   FM ++ RE DL+LF+DM+  +   +     +   + I+ P+FMISELR
Sbjct: 129 EAFDLSTAPLKTFMLSHVREDDLALFIDMSQEAVPESP----EATSFWIVAPAFMISELR 184

Query: 183 RSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLV 242
           R+FEIGFL+ +PFLIID++VA+I+M+MGMMMLPP  ISLPFK+IFFVL+DGW L+V +LV
Sbjct: 185 RAFEIGFLLFIPFLIIDLVVASILMSMGMMMLPPIVISLPFKLIFFVLVDGWRLVVGSLV 244

Query: 243 KSF 245
           +SF
Sbjct: 245 QSF 247


>gi|307637369|gb|ADN79819.1| Flagellar biosynthesis protein [Helicobacter pylori 908]
 gi|325997557|gb|ADZ49765.1| Flagellar biosynthesis protein [Helicobacter pylori 2017]
          Length = 250

 Score =  214 bits (546), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 111/248 (44%), Positives = 167/248 (67%), Gaps = 10/248 (4%)

Query: 4   YCFFALFLVTP---ELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLI 57
           + F  L L+ P    L+ A S+L  V   +N P+D       +    + T+L +AP L++
Sbjct: 4   FIFLMLALICPLICPLMSADSALPSVNLSLNAPSDPKQLVTTLNVIALLTLLVLAPSLIL 63

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           ++T F R I+VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ 
Sbjct: 64  VMTSFTRLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDK 123

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           +I+ T A ++ A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FM
Sbjct: 124 KISYTEAFEKSALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DDVSLSVLIPAFM 179

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
           ISEL+ +F+IGFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL
Sbjct: 180 ISELKTAFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLL 239

Query: 238 VENLVKSF 245
            ENLV SF
Sbjct: 240 TENLVASF 247


>gi|307945658|ref|ZP_07660994.1| flagellar biosynthetic protein FliP [Roseibium sp. TrichSKD4]
 gi|307771531|gb|EFO30756.1| flagellar biosynthetic protein FliP [Roseibium sp. TrichSKD4]
          Length = 231

 Score =  214 bits (546), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 167/229 (72%), Gaps = 4/229 (1%)

Query: 17  VFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           ++A ++    +    D +++   V+   + T+LS+AP +LIMVT F R ++V S+LR+ +
Sbjct: 4   IWAANAQEITIGFGDDTTLTERAVQLLALLTVLSLAPSILIMVTSFTRIVVVLSLLRSAI 63

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G+ + PPN+V+ISLA+F+T ++M+PTL ++   G+QPL+++ I    A +R ++PF  FM
Sbjct: 64  GLQTAPPNMVMISLAMFLTAFIMAPTLQKAYNDGVQPLIDDDIEFNQAFERASDPFRQFM 123

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
            +  REKDL+LF +++     +T     + +E   L+P+FMISEL+R+FEIGFL+ LPFL
Sbjct: 124 LSQVREKDLALFQELSGRPAPDTP----EELELSTLVPAFMISELKRAFEIGFLLYLPFL 179

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID+++A+++M+MGMMMLPP  ISLPFK+IFFVL+DGW+L+  +LVKSF
Sbjct: 180 IIDLVIASVLMSMGMMMLPPVVISLPFKLIFFVLVDGWNLVAGSLVKSF 228


>gi|308182827|ref|YP_003926954.1| flagellar biosynthesis protein FliP [Helicobacter pylori PeCan4]
 gi|308065012|gb|ADO06904.1| flagellar biosynthesis protein FliP [Helicobacter pylori PeCan4]
          Length = 248

 Score =  214 bits (545), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 166/246 (67%), Gaps = 10/246 (4%)

Query: 6   FFALFLVTP---ELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           F  L L+ P    L+ A S+L  V   +N P+D       +    + T+L +AP L++++
Sbjct: 4   FIFLILICPLICPLMSADSALPSVNLSLNAPSDPKQLVTTLNVIALLTLLVLAPSLILVM 63

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R I+VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I
Sbjct: 64  TSFTRLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKI 123

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           + T A ++ A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMIS
Sbjct: 124 SYTEAFEKSALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMIS 179

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F+IGFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL E
Sbjct: 180 ELKTAFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTE 239

Query: 240 NLVKSF 245
           NLV SF
Sbjct: 240 NLVASF 245


>gi|217033150|ref|ZP_03438609.1| hypothetical protein HPB128_194g3 [Helicobacter pylori B128]
 gi|216945122|gb|EEC23821.1| hypothetical protein HPB128_194g3 [Helicobacter pylori B128]
          Length = 231

 Score =  214 bits (545), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 159/230 (69%), Gaps = 7/230 (3%)

Query: 19  AKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTG 75
           A S+L  V   +N P+D       +    + T+L +AP L++++T F R I+VFS LRT 
Sbjct: 3   ADSALPSVNLSLNAPSDPKQLVTTLNVIALLTLLVLAPSLILVMTSFTRLIVVFSFLRTA 62

Query: 76  MGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVF 135
           +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I+ T A ++ A PF  F
Sbjct: 63  LGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKISYTEAFEKSALPFKEF 122

Query: 136 MRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPF 195
           M  NTREKDL+LF  + +  +  T     D +   +LIP+FMISEL+ +F+IGFL+ LPF
Sbjct: 123 MLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMISELKTAFQIGFLLYLPF 178

Query: 196 LIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           L+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL ENLV SF
Sbjct: 179 LVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTENLVASF 228


>gi|317014102|gb|ADU81538.1| flagellar biosynthesis protein FliP [Helicobacter pylori
           Gambia94/24]
          Length = 248

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 166/246 (67%), Gaps = 10/246 (4%)

Query: 6   FFALFLVTP---ELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           F  L L+ P    L+ A S+L  V   +N P+D       +    + T+L +AP L++++
Sbjct: 4   FIFLILICPLICPLMSADSTLPSVNLSLNAPSDPKQLVTTLNVIALLTLLVLAPSLILVM 63

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R I+VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I
Sbjct: 64  TSFTRLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKI 123

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           + T A ++ A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMIS
Sbjct: 124 SYTEAFEKSALPFKKFMLKNTREKDLALFFRIRNLPNPKTP----DDVSLSVLIPAFMIS 179

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F+IGFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL E
Sbjct: 180 ELKTAFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTE 239

Query: 240 NLVKSF 245
           NLV SF
Sbjct: 240 NLVASF 245


>gi|315586640|gb|ADU41021.1| flagellar biosynthetic protein FliP [Helicobacter pylori 35A]
          Length = 248

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 112/246 (45%), Positives = 165/246 (67%), Gaps = 10/246 (4%)

Query: 6   FFALFLVTP---ELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           F  L L+ P    L+ A S+L  V   +N P D       +    + T+L +AP L++++
Sbjct: 4   FIFLILICPLICPLMSADSALPSVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVM 63

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R I+VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I
Sbjct: 64  TSFTRLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKI 123

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           + T A ++ A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMIS
Sbjct: 124 SYTEAFEKSALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMIS 179

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F+IGFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFKV+ F+L+DG++LL E
Sbjct: 180 ELKTAFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKVLVFILVDGFNLLTE 239

Query: 240 NLVKSF 245
           NLV SF
Sbjct: 240 NLVASF 245


>gi|298736381|ref|YP_003728907.1| flagellar biosynthesis protein FliP [Helicobacter pylori B8]
 gi|298355571|emb|CBI66443.1| flagellar biosynthesis protein (FliP) [Helicobacter pylori B8]
          Length = 260

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 109/238 (45%), Positives = 164/238 (68%), Gaps = 8/238 (3%)

Query: 11  LVTPELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFII 67
           L+ P L+ A S+L  V   +N P+D       +    + T+L +AP L++++T F R I+
Sbjct: 25  LICP-LMSADSALPSVNLSLNAPSDPKQLVTTLNVIALLTLLVLAPSLILVMTSFTRLIV 83

Query: 68  VFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQR 127
           VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I+ T A ++
Sbjct: 84  VFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKISYTEAFEK 143

Query: 128 VAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEI 187
            A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMISEL+ +F+I
Sbjct: 144 SALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMISELKTAFQI 199

Query: 188 GFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL ENLV SF
Sbjct: 200 GFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTENLVASF 257


>gi|308184472|ref|YP_003928605.1| flagellar biosynthesis protein FliP [Helicobacter pylori SJM180]
 gi|308060392|gb|ADO02288.1| flagellar biosynthesis protein FliP [Helicobacter pylori SJM180]
          Length = 301

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 166/246 (67%), Gaps = 10/246 (4%)

Query: 6   FFALFLVTP---ELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           F  L L+ P    L+ A S+L  V   +N P+D       +    + T+L +AP L++++
Sbjct: 57  FIFLILICPLICPLMSADSALPSVNLSLNAPSDPKQLVTTLNVIALLTLLVLAPSLILVM 116

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R I+VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I
Sbjct: 117 TSFTRLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKI 176

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           + T A ++ A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMIS
Sbjct: 177 SYTEAFEKSALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMIS 232

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F+IGFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL E
Sbjct: 233 ELKTAFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTE 292

Query: 240 NLVKSF 245
           NLV SF
Sbjct: 293 NLVASF 298


>gi|217033687|ref|ZP_03439114.1| hypothetical protein HP9810_5g29 [Helicobacter pylori 98-10]
 gi|216943876|gb|EEC23313.1| hypothetical protein HP9810_5g29 [Helicobacter pylori 98-10]
          Length = 231

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 158/230 (68%), Gaps = 7/230 (3%)

Query: 19  AKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTG 75
           A S+L  V   +N P D       +    + T+L +AP L++++T F R I+VFS LRT 
Sbjct: 3   ADSTLPSVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVMTSFTRLIVVFSFLRTA 62

Query: 76  MGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVF 135
           +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I+ T A ++ A PF  F
Sbjct: 63  LGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKISYTEAFEKSALPFKEF 122

Query: 136 MRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPF 195
           M  NTREKDL+LF  + +  +  T     D +   +LIP+FMISEL+ +F+IGFL+ LPF
Sbjct: 123 MLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMISELKTAFQIGFLLYLPF 178

Query: 196 LIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           L+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL ENLV SF
Sbjct: 179 LVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTENLVASF 228


>gi|312126835|ref|YP_003991709.1| flagellar biosynthetic protein flip [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776854|gb|ADQ06340.1| flagellar biosynthetic protein FliP [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 253

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 105/234 (44%), Positives = 163/234 (69%), Gaps = 4/234 (1%)

Query: 12  VTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSI 71
           V  E+ FA +SL+  +  P +    +  ++     TIL++AP +LIM+T F R +IV   
Sbjct: 23  VKKEIAFATASLNINLGSPQNPKDVSSALQLIIFLTILTLAPSILIMMTSFTRILIVLGF 82

Query: 72  LRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEP 131
           +R  +G   +PPN ++I LALF+TF+VM+P  D+      QP +N +IT   A++R  EP
Sbjct: 83  VRNALGTQQMPPNQILIGLALFLTFFVMAPVTDKIYTQAYQPYINGRITSQEALKRAEEP 142

Query: 132 FWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLI 191
              FM  NTR+KDL LF+ +++  + NT++     +  R+++P+F+ISEL+ +FE+GFLI
Sbjct: 143 LKEFMLKNTRKKDLDLFVKLSNV-NPNTNV---KDLPLRVVVPAFIISELKSAFEMGFLI 198

Query: 192 ILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
            +PFLIIDM+VA+I+M+MGM+M+PP  ISLPFK++ F+L+DGW+L+VE+LV+SF
Sbjct: 199 YVPFLIIDMVVASILMSMGMLMIPPVMISLPFKILLFILVDGWNLVVESLVRSF 252


>gi|108563093|ref|YP_627409.1| flagellar biosynthesis protein FliP [Helicobacter pylori HPAG1]
 gi|107836866|gb|ABF84735.1| flagellar biosynthetic protein [Helicobacter pylori HPAG1]
 gi|261839493|gb|ACX99258.1| flagellar biosynthesis protein FliP [Helicobacter pylori 52]
 gi|308062010|gb|ADO03898.1| flagellar biosynthesis protein FliP [Helicobacter pylori Cuz20]
 gi|317009302|gb|ADU79882.1| flagellar biosynthesis protein FliP [Helicobacter pylori India7]
 gi|317012496|gb|ADU83104.1| flagellar biosynthesis protein FliP [Helicobacter pylori
           Lithuania75]
 gi|317177503|dbj|BAJ55292.1| flagellar biosynthesis protein FliP [Helicobacter pylori F16]
 gi|317178956|dbj|BAJ56744.1| flagellar biosynthesis protein FliP [Helicobacter pylori F30]
 gi|317181997|dbj|BAJ59781.1| flagellar biosynthesis protein FliP [Helicobacter pylori F57]
          Length = 248

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 165/246 (67%), Gaps = 10/246 (4%)

Query: 6   FFALFLVTP---ELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           F  L L+ P    L+ A S+L  V   +N P D       +    + T+L +AP L++++
Sbjct: 4   FIFLILICPLICPLMSADSALPSVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVM 63

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R I+VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I
Sbjct: 64  TSFTRLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKI 123

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           + T A ++ A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMIS
Sbjct: 124 SYTEAFEKSALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMIS 179

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F+IGFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL E
Sbjct: 180 ELKTAFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTE 239

Query: 240 NLVKSF 245
           NLV SF
Sbjct: 240 NLVASF 245


>gi|308063526|gb|ADO05413.1| flagellar biosynthesis protein FliP [Helicobacter pylori Sat464]
          Length = 248

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 109/238 (45%), Positives = 163/238 (68%), Gaps = 8/238 (3%)

Query: 11  LVTPELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFII 67
           L+ P L+ A S+L  V   +N P D       +    + T+L +AP L++++T F R I+
Sbjct: 13  LICP-LMSADSALPSVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVMTSFTRLIV 71

Query: 68  VFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQR 127
           VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I+ T A ++
Sbjct: 72  VFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKISYTEAFEK 131

Query: 128 VAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEI 187
            A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMISEL+ +F+I
Sbjct: 132 SALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMISELKTAFQI 187

Query: 188 GFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL ENLV SF
Sbjct: 188 GFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTENLVASF 245


>gi|188527470|ref|YP_001910157.1| flagellar biosynthesis protein FliP [Helicobacter pylori Shi470]
 gi|188143710|gb|ACD48127.1| flagellar biosynthesis protein FliP [Helicobacter pylori Shi470]
          Length = 248

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 109/238 (45%), Positives = 163/238 (68%), Gaps = 8/238 (3%)

Query: 11  LVTPELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFII 67
           L+ P L+ A S+L  V   +N P D       +    + T+L +AP L++++T F R I+
Sbjct: 13  LICP-LMSADSALPSVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVMTSFTRLIV 71

Query: 68  VFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQR 127
           VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I+ T A ++
Sbjct: 72  VFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKISYTEAFEK 131

Query: 128 VAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEI 187
            A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMISEL+ +F+I
Sbjct: 132 SALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMISELKTAFQI 187

Query: 188 GFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL ENLV SF
Sbjct: 188 GFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTENLVASF 245


>gi|254779331|ref|YP_003057436.1| flagellar biosynthesis protein FliP [Helicobacter pylori B38]
 gi|254001242|emb|CAX29217.1| Flagellar biosynthetic protein FliP [Helicobacter pylori B38]
          Length = 248

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 109/238 (45%), Positives = 163/238 (68%), Gaps = 8/238 (3%)

Query: 11  LVTPELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFII 67
           L+ P L+ A S+L  V   +N P D       +    + T+L +AP L++++T F R I+
Sbjct: 13  LICP-LMSADSALPSVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVMTSFTRLIV 71

Query: 68  VFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQR 127
           VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I+ T A ++
Sbjct: 72  VFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKISYTEAFEK 131

Query: 128 VAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEI 187
            A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMISEL+ +F+I
Sbjct: 132 SALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMISELKTAFQI 187

Query: 188 GFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL ENLV SF
Sbjct: 188 GFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTENLVASF 245


>gi|317010902|gb|ADU84649.1| flagellar biosynthesis protein FliP [Helicobacter pylori
           SouthAfrica7]
          Length = 248

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 164/242 (67%), Gaps = 7/242 (2%)

Query: 7   FALFLVTPELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFP 63
           F +F +   L+ A S+L  V   +N P D       +    + T+L +AP L++++T F 
Sbjct: 8   FLIFALIGPLMSADSALPSVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVMTSFI 67

Query: 64  RFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETT 123
           R I+VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I+ T 
Sbjct: 68  RLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKISYTE 127

Query: 124 AIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRR 183
           A ++ A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMISEL+ 
Sbjct: 128 AFEKSALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DDVSLSVLIPAFMISELKT 183

Query: 184 SFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVK 243
           +F+IGFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL ENLV 
Sbjct: 184 AFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTENLVA 243

Query: 244 SF 245
           SF
Sbjct: 244 SF 245


>gi|210134891|ref|YP_002301330.1| flagellar biosynthesis protein FliP [Helicobacter pylori P12]
 gi|210132859|gb|ACJ07850.1| flagellar biosynthetic protein [Helicobacter pylori P12]
          Length = 260

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 165/246 (67%), Gaps = 10/246 (4%)

Query: 6   FFALFLVTP---ELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           F  L L+ P    L+ A S+L  V   +N P D       +    + T+L +AP L++++
Sbjct: 16  FIFLILICPLICPLMSADSALPSVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVM 75

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R I+VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I
Sbjct: 76  TSFTRLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKI 135

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           + T A ++ A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMIS
Sbjct: 136 SYTEAFEKSALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMIS 191

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F+IGFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL E
Sbjct: 192 ELKTAFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTE 251

Query: 240 NLVKSF 245
           NLV SF
Sbjct: 252 NLVASF 257


>gi|208434601|ref|YP_002266267.1| flagellar biosynthetic protein [Helicobacter pylori G27]
 gi|208432530|gb|ACI27401.1| flagellar biosynthetic protein [Helicobacter pylori G27]
          Length = 260

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 109/238 (45%), Positives = 163/238 (68%), Gaps = 8/238 (3%)

Query: 11  LVTPELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFII 67
           L+ P L+ A S+L  V   +N P D       +    + T+L +AP L++++T F R I+
Sbjct: 25  LICP-LMSADSALPSVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVMTSFTRLIV 83

Query: 68  VFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQR 127
           VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I+ T A ++
Sbjct: 84  VFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKISYTEAFEK 143

Query: 128 VAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEI 187
            A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMISEL+ +F+I
Sbjct: 144 SALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMISELKTAFQI 199

Query: 188 GFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL ENLV SF
Sbjct: 200 GFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTENLVASF 257


>gi|109947417|ref|YP_664645.1| flagellar biosynthesis protein FliP [Helicobacter acinonychis str.
           Sheeba]
 gi|109714638|emb|CAJ99646.1| flagellar biosynthesis protein [Helicobacter acinonychis str.
           Sheeba]
          Length = 248

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 103/224 (45%), Positives = 156/224 (69%), Gaps = 4/224 (1%)

Query: 22  SLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSV 81
           S++  +N P D       +    + T+L +AP L++++T F R I+VFS LRT +G    
Sbjct: 26  SVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVMTSFTRLIVVFSFLRTALGTQQT 85

Query: 82  PPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTR 141
           PP  +++SL+L +TF++M P+L ++ ++GI+P M+ +I+ T A ++ A PF  FM  NTR
Sbjct: 86  PPTQILVSLSLILTFFIMEPSLKKAYDIGIKPYMDKKISYTEAFEKSALPFKEFMLKNTR 145

Query: 142 EKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMI 201
           EKDL+LF  +    +  T     D +   +LIP+FMISEL+ +F+IGFL+ LPFL+IDM+
Sbjct: 146 EKDLALFFRIRQLPNPKTP----DDVSLSVLIPAFMISELKTAFQIGFLLYLPFLVIDMV 201

Query: 202 VATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL ENLV SF
Sbjct: 202 ISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTENLVASF 245


>gi|312621584|ref|YP_004023197.1| flagellar biosynthetic protein flip [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202051|gb|ADQ45378.1| flagellar biosynthetic protein FliP [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 252

 Score =  212 bits (539), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 163/231 (70%), Gaps = 4/231 (1%)

Query: 15  ELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRT 74
           E+ FA +SL+  +  P + +  +  ++     TIL++AP +LIM+T F R +IV   +R 
Sbjct: 25  EIAFATASLNINLGNPQNPNDVSSALQLIIFLTILTLAPSILIMMTSFTRILIVLGFIRN 84

Query: 75  GMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWV 134
            +G   +PPN ++I LALF+TF+VM+P  D+      QP +N +IT   A++R  EP   
Sbjct: 85  ALGTQQMPPNQILIGLALFLTFFVMAPVTDKIYTQAYQPYINGRITSQEALKRAEEPLKE 144

Query: 135 FMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILP 194
           FM  NTR+KDL LF+ +++  + NT++     +  R+++P+F+ISEL+ +FE+GFLI +P
Sbjct: 145 FMLKNTRKKDLDLFVKLSNV-NPNTNV---KDLPLRVVVPAFIISELKSAFEMGFLIYVP 200

Query: 195 FLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FLIIDM+VA+I+M+MGM+M+PP  ISLPFK++ F+L+DGW+L+VE+LV+SF
Sbjct: 201 FLIIDMVVASILMSMGMLMIPPVMISLPFKILLFILVDGWNLVVESLVRSF 251


>gi|207092164|ref|ZP_03239951.1| flagellar biosynthesis protein FliP [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 266

 Score =  212 bits (539), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 165/246 (67%), Gaps = 10/246 (4%)

Query: 6   FFALFLVTP---ELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           F  L L+ P    L+ A S+L  V   +N P D       +    + T+L +AP L++++
Sbjct: 22  FIFLILICPLICPLMSADSALPSVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVM 81

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R I+VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I
Sbjct: 82  TSFTRLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKI 141

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           + T A ++ A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMIS
Sbjct: 142 SYTEAFEKSALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMIS 197

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F+IGFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL E
Sbjct: 198 ELKTAFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTE 257

Query: 240 NLVKSF 245
           NLV SF
Sbjct: 258 NLVASF 263


>gi|83858799|ref|ZP_00952321.1| flagellar biosynthesis protein FliP [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853622|gb|EAP91474.1| flagellar biosynthesis protein FliP [Oceanicaulis alexandrii
           HTCC2633]
          Length = 258

 Score =  212 bits (539), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 154/214 (71%), Gaps = 5/214 (2%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D +++  +++   + T+LS+AP +LIM T F R ++V S+LRT MG+   PPN V+ISL+
Sbjct: 43  DTALTERVLQMIALLTVLSLAPSILIMTTSFIRIVVVLSLLRTAMGLQQSPPNAVLISLS 102

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+T ++M+P   ++ + G++PL++ Q++   A    A+P   FM  +TRE+DL LF+++
Sbjct: 103 LFLTAFIMAPVFTQAYQDGVEPLLSGQLSNQEAFSAAAQPVKTFMLAHTREEDLGLFLNI 162

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +         T        ++ P+FMISELRR+FEIGFL+ +PFLIID++VA+I+M+MGM
Sbjct: 163 SGEEPETAQDTP-----VHVVAPAFMISELRRAFEIGFLLFIPFLIIDLVVASILMSMGM 217

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MMLPP  ISLPFK+IFFVL+DGWSL++ +LV+SF
Sbjct: 218 MMLPPVIISLPFKLIFFVLVDGWSLVIGSLVQSF 251


>gi|317180434|dbj|BAJ58220.1| flagellar biosynthesis protein FliP [Helicobacter pylori F32]
          Length = 248

 Score =  211 bits (538), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 164/246 (66%), Gaps = 10/246 (4%)

Query: 6   FFALFLVTP---ELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           F  L L+ P    L+ A S+L  V   +N P D       +    + T+L +AP L++++
Sbjct: 4   FIFLILICPLICPLMSADSALPSVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVM 63

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R I+VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+  I
Sbjct: 64  TSFTRLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKTI 123

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           + T A ++ A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMIS
Sbjct: 124 SYTEAFEKSALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMIS 179

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F+IGFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL E
Sbjct: 180 ELKTAFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTE 239

Query: 240 NLVKSF 245
           NLV SF
Sbjct: 240 NLVASF 245


>gi|15611692|ref|NP_223343.1| flagellar biosynthesis protein FliP [Helicobacter pylori J99]
 gi|4155178|gb|AAD06205.1| FLAGELLAR BIOSYNTHESIS PROTEIN [Helicobacter pylori J99]
          Length = 248

 Score =  211 bits (538), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 110/246 (44%), Positives = 165/246 (67%), Gaps = 10/246 (4%)

Query: 6   FFALFLVTP---ELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           F  L L+ P    L+ A S+L  V   +N P+D       +    + T+L +AP L++++
Sbjct: 4   FIFLILICPLICPLMSADSALPSVNLSLNAPSDPKQLVTTLNVIALLTLLVLAPSLILVM 63

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R I+VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I
Sbjct: 64  TSFTRLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKI 123

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           + T A ++   PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMIS
Sbjct: 124 SYTEAFEKSTLPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DDVSLSVLIPAFMIS 179

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F+IGFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL E
Sbjct: 180 ELKTAFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTE 239

Query: 240 NLVKSF 245
           NLV SF
Sbjct: 240 NLVASF 245


>gi|297379879|gb|ADI34766.1| flagellar biosynthetic protein FliP [Helicobacter pylori v225d]
          Length = 248

 Score =  211 bits (537), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 110/246 (44%), Positives = 165/246 (67%), Gaps = 10/246 (4%)

Query: 6   FFALFLVTP---ELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           F  L L+ P    L+ A S+L  V   +N P D       +    + T+L +AP L++++
Sbjct: 4   FIFLILICPLICPLMSADSALPSVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVM 63

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R I+VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P ++ +I
Sbjct: 64  TSFTRLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYVDKKI 123

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           + T A ++ A PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMIS
Sbjct: 124 SYTEAFEKSALPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMIS 179

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F+IGFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL E
Sbjct: 180 ELKTAFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTE 239

Query: 240 NLVKSF 245
           NLV SF
Sbjct: 240 NLVASF 245


>gi|312876513|ref|ZP_07736496.1| flagellar biosynthetic protein FliP [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796724|gb|EFR13070.1| flagellar biosynthetic protein FliP [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 252

 Score =  211 bits (537), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 162/231 (70%), Gaps = 4/231 (1%)

Query: 15  ELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRT 74
           E+ FA +S++  +  P +    +  ++     TIL++AP +LIM+T F R +IV   +R 
Sbjct: 25  EIAFASASININLGSPQNPKDVSSALQLIIFLTILTLAPSILIMMTSFTRILIVLGFVRN 84

Query: 75  GMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWV 134
            +G   +PPN ++I LALF+TF+VM+P  D+      QP +N +IT   A++R  EP   
Sbjct: 85  ALGTQQMPPNQILIGLALFLTFFVMAPVTDKIYTQAYQPYINGRITSQEALKRAEEPLKE 144

Query: 135 FMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILP 194
           FM  NTR+KDL LF+ +++  + NT++     +  R+++P+F+ISEL+ +FE+GFLI +P
Sbjct: 145 FMLKNTRKKDLDLFVKLSNV-NPNTNV---KDLPLRVVVPAFIISELKSAFEMGFLIYVP 200

Query: 195 FLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FLIIDM+VA+I+M+MGM+M+PP  ISLPFK++ F+L+DGW+L+VE+LV+SF
Sbjct: 201 FLIIDMVVASILMSMGMLMIPPVMISLPFKILLFILVDGWNLVVESLVRSF 251


>gi|332673532|gb|AEE70349.1| flagellar biosynthetic protein FliP [Helicobacter pylori 83]
          Length = 248

 Score =  211 bits (536), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 110/246 (44%), Positives = 164/246 (66%), Gaps = 10/246 (4%)

Query: 6   FFALFLVTP---ELVFAKSSLHDV---MNIPADLSISTWIVRTFGIFTILSIAPILLIMV 59
           F  L L+ P    L+ A S+L  V   +N P D       +    + T+L +AP L++++
Sbjct: 4   FIFLILICPLICPLMSADSALPSVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVM 63

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R I+VFS LRT +G    PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I
Sbjct: 64  TSFTRLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKI 123

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           + T A ++   PF  FM  NTREKDL+LF  + +  +  T     D +   +LIP+FMIS
Sbjct: 124 SYTEAFEKSTLPFKEFMLKNTREKDLALFFRIRNLPNPKTP----DEVSLSVLIPAFMIS 179

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F+IGFL+ LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL E
Sbjct: 180 ELKTAFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTE 239

Query: 240 NLVKSF 245
           NLV SF
Sbjct: 240 NLVASF 245


>gi|167645329|ref|YP_001682992.1| flagellar biosynthesis protein FliP [Caulobacter sp. K31]
 gi|167347759|gb|ABZ70494.1| flagellar biosynthetic protein FliP [Caulobacter sp. K31]
          Length = 266

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 159/232 (68%), Gaps = 6/232 (2%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILR 73
           P +  A+S+++  +++     +S  +V+  G+ T+LS+AP ++IM T F R ++V  +LR
Sbjct: 34  PAVAVAQSAIN--VDLGTGAGLSERVVQMVGLLTVLSLAPSIVIMTTSFVRIVVVLGLLR 91

Query: 74  TGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFW 133
           T +G+   PPN VIISLALF+T  VM PT ++S + GI+PL++ QI    A    A P  
Sbjct: 92  TAIGVQQSPPNPVIISLALFLTAIVMGPTFEKSYDDGIKPLLDKQIEMPEAFDAAAAPVK 151

Query: 134 VFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIIL 193
           VFM     + DL+LF+ ++      T +        +++ P+FMISEL+R+FEIGFL+ +
Sbjct: 152 VFMLRQVDQDDLALFIRLSKIEKPKTAV----DTPLKVVTPAFMISELKRAFEIGFLLFI 207

Query: 194 PFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           PFL+ID++VA+++M+MGMMMLPP ++SLPFK+IFFVL+DGW L+  +LV+SF
Sbjct: 208 PFLVIDLVVASVLMSMGMMMLPPATVSLPFKLIFFVLVDGWRLVAGSLVESF 259


>gi|209963528|ref|YP_002296443.1| flagellar biosynthesis protein FliP [Rhodospirillum centenum SW]
 gi|209956994|gb|ACI97630.1| flagellar biosynthesis protein FliP [Rhodospirillum centenum SW]
          Length = 267

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 150/231 (64%), Gaps = 12/231 (5%)

Query: 27  MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLV 86
           M    D S +  +V+   + TILS+AP LL+MVT F R ++V S+LR+ +G+   PPN+V
Sbjct: 33  MGGTGDASFAGRMVQVVALVTILSVAPGLLVMVTSFTRIVVVLSLLRSALGLQQTPPNMV 92

Query: 87  IISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLS 146
           ++ LAL +T YVM PTLDRS   G+QP+++ QITE  A +R+ EPF  FM+ + R KDL 
Sbjct: 93  LLGLALLLTAYVMGPTLDRSWREGVQPMVDGQITEEQAFERIVEPFRDFMQAHVRPKDLE 152

Query: 147 LFMDMAHSSHRNTDI------------TKNDHIEYRILIPSFMISELRRSFEIGFLIILP 194
           LF      +                          R LI +F+ISELRR+FEIGFL+ LP
Sbjct: 153 LFRSFEAGTKSGAAPAAGSAGPAPSTEEAASAPGLRTLIAAFVISELRRAFEIGFLLFLP 212

Query: 195 FLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FL+IDMI+A ++MAMGMMMLPP  ISLPFK+IFFV++DGW L+   LV+S+
Sbjct: 213 FLVIDMIIAAVLMAMGMMMLPPVIISLPFKIIFFVMVDGWLLVAGALVRSY 263


>gi|261838080|gb|ACX97846.1| flagellar biosynthetic protein [Helicobacter pylori 51]
          Length = 252

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/224 (45%), Positives = 156/224 (69%), Gaps = 4/224 (1%)

Query: 22  SLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSV 81
           S++  +N P D       +    + T+L +AP L++++T F R I+VFS LRT +G    
Sbjct: 30  SVNLSLNAPNDPKQLVTTLNVIALLTLLVLAPSLILVMTSFTRLIVVFSFLRTALGTQQT 89

Query: 82  PPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTR 141
           PP  +++SL+L +TF++M P+L ++ + GI+P M+ +I+ T A ++ A PF  FM  NTR
Sbjct: 90  PPTQILVSLSLILTFFIMEPSLKKAYDTGIKPYMDKKISYTEAFEKSALPFKEFMLKNTR 149

Query: 142 EKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMI 201
           EKDL+LF  + +  +  T     + +   +LIP+FMISEL+ +F+IGFL+ LPFL+IDM+
Sbjct: 150 EKDLALFFRIRNLPNPKTP----NEVSLSVLIPAFMISELKTAFQIGFLLYLPFLVIDMV 205

Query: 202 VATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +++I+MAMGMMMLPP  ISLPFK++ F+L+DG++LL ENLV SF
Sbjct: 206 ISSILMAMGMMMLPPVMISLPFKILVFILVDGFNLLTENLVASF 249


>gi|283954390|ref|ZP_06371910.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794007|gb|EFC32756.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 233

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 103/202 (50%), Positives = 147/202 (72%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R I+VFS LR  MG  S+PPN ++++LAL +TF++M P   
Sbjct: 35  VLTILALAPSIVFVMTSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVAT 94

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P +  QI    A  + A+PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 95  KSYNEGIKPYLAEQIGYEEAFVKGAKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 150

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI LPFL+IDM+V++++MAMGMMMLPPT ISLPFK
Sbjct: 151 DDVPLTVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPTMISLPFK 210

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 211 LLIFVLVDGWNLLVQRLVESFV 232


>gi|94314220|ref|YP_587429.1| flagellar biosynthesis protein FliP [Cupriavidus metallidurans
           CH34]
 gi|93358072|gb|ABF12160.1| flagellar biosynthesis protein FliP [Cupriavidus metallidurans
           CH34]
          Length = 264

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 106/235 (45%), Positives = 154/235 (65%), Gaps = 7/235 (2%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSI 71
           PE   A+S L  V + P      TW   ++T  + T LS  P  ++M+T F R IIV  +
Sbjct: 34  PESALAQS-LPGVTSRPGPGGGQTWSLSIQTLVLLTSLSFLPAAMLMMTGFTRIIIVLGL 92

Query: 72  LRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEP 131
           LR  +G  S PPN V++ L+LF+TF+VMSP  D+      QPL  N+I+  TA QR A P
Sbjct: 93  LRNALGTASSPPNQVLVGLSLFLTFFVMSPVFDKVYTDAYQPLSENKISLETAAQRAAVP 152

Query: 132 FWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLI 191
              FM   TREKDL++F  MA    +  ++   + + + +L+P+F+ SEL+ +F+IGF I
Sbjct: 153 LRAFMLRQTREKDLAMFAQMA----KTPELQGPEDVPFTVLVPAFVTSELKTAFQIGFTI 208

Query: 192 ILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
            +PFLIID++VA+++MAMGMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF+
Sbjct: 209 FIPFLIIDLVVASVLMAMGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSFM 263


>gi|16125203|ref|NP_419767.1| flagellar biosynthesis protein FliP [Caulobacter crescentus CB15]
 gi|221233939|ref|YP_002516375.1| flagellar biosynthesis protein FliP [Caulobacter crescentus NA1000]
 gi|2494562|sp|Q45980|FLIP_CAUCR RecName: Full=Flagellar biosynthetic protein fliP
 gi|841253|gb|AAA86882.1| FliP [Caulobacter crescentus CB15]
 gi|13422227|gb|AAK22935.1| flagellar biosynthesis protein FliP [Caulobacter crescentus CB15]
 gi|220963111|gb|ACL94467.1| flagellar biosyntheis protein FliP [Caulobacter crescentus NA1000]
          Length = 266

 Score =  208 bits (530), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 159/234 (67%), Gaps = 6/234 (2%)

Query: 12  VTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSI 71
           + P    A+S+++  +N+     ++  +V+  G+ T+LS+AP ++IM T F R ++V  +
Sbjct: 33  IMPAAAMAQSAVN--INLGTGAGLTERVVQLVGLMTVLSLAPSIVIMTTSFVRIVVVLGL 90

Query: 72  LRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEP 131
           LRT +G+   PPN V+ISLALF+T  VM+PT +RS + GI+PL++ Q+    A +  + P
Sbjct: 91  LRTAIGVQQSPPNPVLISLALFLTAIVMAPTFERSYDAGIKPLLDQQMELPEAFEAASGP 150

Query: 132 FWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLI 191
              FM +     DL+LF+ ++      T          R++ P+FMISEL+R+FEIGFL+
Sbjct: 151 VKQFMLSQVDRDDLALFVRLSKIPQPRT----AAETPLRVVTPAFMISELKRAFEIGFLL 206

Query: 192 ILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
            +PFL+ID++VA+++M+MGMMMLPP SISLPFK+IFFVL+DGW L+  +LV+SF
Sbjct: 207 FIPFLVIDLVVASVLMSMGMMMLPPASISLPFKLIFFVLVDGWRLVAGSLVESF 260


>gi|222530123|ref|YP_002574005.1| flagellar biosynthetic protein FliP [Caldicellulosiruptor bescii
           DSM 6725]
 gi|222456970|gb|ACM61232.1| flagellar biosynthetic protein FliP [Caldicellulosiruptor bescii
           DSM 6725]
          Length = 252

 Score =  208 bits (529), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 108/236 (45%), Positives = 167/236 (70%), Gaps = 14/236 (5%)

Query: 15  ELVFAKSSLH----DVMNIPADLSISTWIVRTFGIF-TILSIAPILLIMVTCFPRFIIVF 69
           E+ FA +SL+    +  N P D+S +  ++    IF TIL++AP +LIM+T F R +IV 
Sbjct: 25  EIAFAAASLNINLGNSQN-PNDVSSALQLI----IFLTILTLAPSILIMMTSFTRILIVL 79

Query: 70  SILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVA 129
             +R  +G   +PPN ++I LALF+TF+VM+P  D+      QP +N +IT   A++R  
Sbjct: 80  GFIRNALGTQQMPPNQILIGLALFLTFFVMAPVTDKIYIQAYQPYINGRITSQEALKRAE 139

Query: 130 EPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGF 189
           EP   FM  NTR+KDL LF+ +++  + NT++     +  R+++P+F+ISEL+ +FE+GF
Sbjct: 140 EPLKEFMLKNTRKKDLDLFVKLSNV-NPNTNV---KDLPLRVVVPAFIISELKSAFEMGF 195

Query: 190 LIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LI +PFLIIDM+VA+I+M+MGM+M+PP  ISLPFK++ F+L+DGW+L++E+LV+SF
Sbjct: 196 LIYVPFLIIDMVVASILMSMGMLMIPPVMISLPFKILLFILVDGWNLVIESLVRSF 251


>gi|295706270|ref|YP_003599345.1| flagellar biosynthetic protein FliP [Bacillus megaterium DSM 319]
 gi|294803929|gb|ADF40995.1| flagellar biosynthetic protein FliP [Bacillus megaterium DSM 319]
          Length = 222

 Score =  208 bits (529), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 162/231 (70%), Gaps = 18/231 (7%)

Query: 23  LHDVMNI-----PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMG 77
           +++VMN+     P ++S S   V+   + T+ S+AP +LIM+TCF R +IV S +RT +G
Sbjct: 1   MNEVMNLFNSSSPTNISTS---VQLLLLLTVFSVAPGILIMMTCFTRIVIVLSFVRTSLG 57

Query: 78  MGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMR 137
              +PPN +++ L+LF+TF++M+PT  +  E  +QPL+  +IT   A ++ AEP   FM 
Sbjct: 58  TQQMPPNQILVGLSLFLTFFIMAPTFSQVNEQALQPLLKEKITLNQAYEKAAEPMKEFMS 117

Query: 138 NNTREKDLSLFMDMAHSSHRNTDITKNDHIE---YRILIPSFMISELRRSFEIGFLIILP 194
            +TR+KDL+LF++ A       DI K   ++      L+P++ ISEL+ +F+IGF+I +P
Sbjct: 118 AHTRQKDLALFLEYA-------DIDKPSSVQDIPLTALVPAYAISELKTAFQIGFMIFIP 170

Query: 195 FLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FLIIDMI+A+++M+MGMMMLPP  ISLPFK++ FVL+DGW+L+V++L+ SF
Sbjct: 171 FLIIDMIIASVLMSMGMMMLPPVMISLPFKILLFVLVDGWNLVVKSLLISF 221


>gi|209545574|ref|YP_002277803.1| flagellar biosynthesis protein FliP [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533251|gb|ACI53188.1| flagellar biosynthetic protein FliP [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 266

 Score =  208 bits (529), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 101/232 (43%), Positives = 152/232 (65%), Gaps = 4/232 (1%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILR 73
           P L  A+S   D+     D   ++ +V+   + TILS+AP LL+MVT F R I+V S+LR
Sbjct: 37  PTLAHAQSLSLDLGKGMGDAGTTSRLVQLTALITILSLAPSLLVMVTAFTRIIVVLSLLR 96

Query: 74  TGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFW 133
             +G    PPN V+I LALF+TF+VM P   +S + GI P+M+ +++E   +   AEPF 
Sbjct: 97  GAIGAQGAPPNTVLIGLALFLTFFVMQPVFQQSWDHGIVPMMDGRVSEMEGLTAAAEPFR 156

Query: 134 VFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIIL 193
            FM  N R  D++ F+ +A+               +R+++P+FMI EL R FE+GFL+ L
Sbjct: 157 TFMLANARPADITTFLHLANVPP----PATPAETPWRVIMPAFMIGELSRGFEMGFLLYL 212

Query: 194 PFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           PFL+ID++ ++++M++GMMMLPP +ISLPFK+IFFV++DGW ++   LV+SF
Sbjct: 213 PFLVIDIVTSSVLMSLGMMMLPPATISLPFKLIFFVMVDGWQMVAGGLVRSF 264


>gi|57242347|ref|ZP_00370286.1| flagellar biosynthetic protein FliP [Campylobacter upsaliensis
           RM3195]
 gi|57017027|gb|EAL53809.1| flagellar biosynthetic protein FliP [Campylobacter upsaliensis
           RM3195]
          Length = 244

 Score =  207 bits (528), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 147/202 (72%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R IIVFS LR  MG  S+PPN +++++AL +TF++M P   
Sbjct: 46  VLTILALAPSIIFIMTSFLRLIIVFSFLRQAMGTQSMPPNTILVTMALILTFFIMEPVAT 105

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   G++P ++ QI    A  R A+PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 106 KSYNEGVKPYLSEQIGYEEAFVRGAKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 161

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI LPFL+IDM+V++++MAMGMMMLPP  ISLPFK
Sbjct: 162 DDVPLSVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPVMISLPFK 221

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 222 LLIFVLVDGWNLLVQRLVESFV 243


>gi|86152107|ref|ZP_01070319.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|85840892|gb|EAQ58142.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni 260.94]
          Length = 244

 Score =  207 bits (528), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 147/202 (72%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R I+VFS LR  MG  S+PPN ++++LAL +TF++M P   
Sbjct: 46  VLTILALAPSIVFVITSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVAT 105

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P +  +I    A  + A+PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 106 KSYNEGIKPYLAEKIGYEEAFIKGAKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 161

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI LPFL+IDM+V++++MAMGMMMLPPT ISLPFK
Sbjct: 162 DDVPLTVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPTMISLPFK 221

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 222 LLIFVLVDGWNLLVQRLVESFV 243


>gi|162147465|ref|YP_001601926.1| flagellar biosynthesis protein FliP [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786042|emb|CAP55624.1| putative flagellar biosynthetic protein fliP [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 259

 Score =  207 bits (528), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 101/232 (43%), Positives = 152/232 (65%), Gaps = 4/232 (1%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILR 73
           P L  A+S   D+     D   ++ +V+   + TILS+AP LL+MVT F R I+V S+LR
Sbjct: 30  PTLAHAQSLSLDLGKGMGDAGTTSRLVQLTALITILSLAPSLLVMVTAFTRIIVVLSLLR 89

Query: 74  TGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFW 133
             +G    PPN V+I LALF+TF+VM P   +S + GI P+M+ +++E   +   AEPF 
Sbjct: 90  GAIGAQGAPPNTVLIGLALFLTFFVMQPVFQQSWDHGIVPMMDGRVSEMEGLTAAAEPFR 149

Query: 134 VFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIIL 193
            FM  N R  D++ F+ +A+               +R+++P+FMI EL R FE+GFL+ L
Sbjct: 150 TFMLANARPADITTFLHLANVPP----PATPAETPWRVIMPAFMIGELSRGFEMGFLLYL 205

Query: 194 PFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           PFL+ID++ ++++M++GMMMLPP +ISLPFK+IFFV++DGW ++   LV+SF
Sbjct: 206 PFLVIDIVTSSVLMSLGMMMLPPATISLPFKLIFFVMVDGWQMVAGGLVRSF 257


>gi|121612246|ref|YP_001000505.1| flagellar biosynthesis protein FliP [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|30721657|gb|AAP34259.1| FliP [Campylobacter jejuni subsp. jejuni 81-176]
 gi|87249412|gb|EAQ72372.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni 81-176]
          Length = 244

 Score =  207 bits (528), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 148/202 (73%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R I+VFS LR  MG  S+PPN ++++LAL +TF++M P   
Sbjct: 46  VLTILALAPSIVFVMTSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVAT 105

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P ++ +I    A  + A+PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 106 KSYNEGIKPYLSEKIGYEEAFIKGAKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 161

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI LPFL+IDM+V++++MAMGMMMLPPT ISLPFK
Sbjct: 162 DDVPLTVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPTMISLPFK 221

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 222 LLIFVLVDGWNLLVQRLVESFV 243


>gi|258404717|ref|YP_003197459.1| flagellar biosynthetic protein FliP [Desulfohalobium retbaense DSM
           5692]
 gi|257796944|gb|ACV67881.1| flagellar biosynthetic protein FliP [Desulfohalobium retbaense DSM
           5692]
          Length = 252

 Score =  207 bits (528), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 98/201 (48%), Positives = 145/201 (72%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+LS+AP +L+M T F R +IV S +R  MG+  +PPN VII LALF+TF++MSP L 
Sbjct: 55  LLTVLSLAPAILLMTTSFIRIVIVLSFIRQAMGVRQMPPNQVIIGLALFLTFFIMSPVLS 114

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  +  +QP ++ +I +  AI+R   P   FM N  R+KDL LF+D++ S    T     
Sbjct: 115 QMNQDALQPYLDQEIGDAQAIERAVSPMREFMFNQVRQKDLQLFVDISGSDQPET----R 170

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           + I   +L+P+FM+SE++R+F+IGFLI +PFL+IDM+ A+++M+MGM+MLPP  ISLPFK
Sbjct: 171 EEIRTMLLVPAFMLSEIKRAFQIGFLIFVPFLVIDMVTASVLMSMGMLMLPPVIISLPFK 230

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L+V +LV+SF
Sbjct: 231 ILLFVLVDGWHLVVGSLVRSF 251


>gi|295690701|ref|YP_003594394.1| flagellar biosynthetic protein FliP [Caulobacter segnis ATCC 21756]
 gi|295432604|gb|ADG11776.1| flagellar biosynthetic protein FliP [Caulobacter segnis ATCC 21756]
          Length = 265

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 158/234 (67%), Gaps = 6/234 (2%)

Query: 12  VTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSI 71
           V P    A+S+++  +N+     ++  +V+   + T+LS+AP ++IM T F R ++V  +
Sbjct: 32  VMPAAAMAQSAVN--INLGTGAGLTDRVVQLVALMTVLSLAPSIVIMTTSFVRIVVVLGL 89

Query: 72  LRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEP 131
           LRT +G+ S PPN VIISLALF+T  VM PT +RS + GI+PL++ QI    A    + P
Sbjct: 90  LRTAIGVQSSPPNPVIISLALFLTAIVMGPTFERSYDAGIKPLLDKQIELPEAFDAASGP 149

Query: 132 FWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLI 191
              FM +     DL+LF+ ++      T     +    +++ P+FMISEL+R+FEIGFL+
Sbjct: 150 VKQFMLSQVDRDDLALFVRLSKIPQPKT----AEDTPIKVVTPAFMISELKRAFEIGFLL 205

Query: 192 ILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
            +PFL+ID++VA+++M+MGMMMLPP +ISLPFK+IFFVL+DGW L+  +LV+SF
Sbjct: 206 FIPFLVIDLVVASVLMSMGMMMLPPATISLPFKLIFFVLVDGWRLVAGSLVESF 259


>gi|222823982|ref|YP_002575556.1| flagellar biosynthesis protein FliP [Campylobacter lari RM2100]
 gi|222539204|gb|ACM64305.1| flagellar biosynthesis protein FliP [Campylobacter lari RM2100]
          Length = 244

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 148/203 (72%), Gaps = 6/203 (2%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R ++VFS LRT +G  ++PPN ++++LAL +TF++M P   
Sbjct: 46  VLTILALAPTIVFVMTSFLRLVVVFSFLRTALGTQTMPPNTILVTLALILTFFIMEPVAT 105

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P +  QI    A  +  +PF  FM  NTREKDL+LF  +     RN +  K 
Sbjct: 106 KSYNEGIKPYIAEQIGYEEAFAKGVKPFKDFMLKNTREKDLALFYRI-----RNLENPKT 160

Query: 165 -DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPF 223
            D +   +L+P+FMISEL+ +FEIGFL+ LPFL+IDM+V++++MAMGMMMLPP  IS+PF
Sbjct: 161 IDDVPLTVLVPAFMISELKTAFEIGFLLFLPFLVIDMVVSSVLMAMGMMMLPPVMISMPF 220

Query: 224 KVIFFVLIDGWSLLVENLVKSFI 246
           K++ FVL+DGW+LL++NLVKSF+
Sbjct: 221 KLLIFVLVDGWNLLIQNLVKSFL 243


>gi|57237661|ref|YP_178909.1| flagellar biosynthesis protein FliP [Campylobacter jejuni RM1221]
 gi|86150212|ref|ZP_01068439.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|86153364|ref|ZP_01071568.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|88597515|ref|ZP_01100749.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|157415087|ref|YP_001482343.1| flagellar biosynthesis protein FliP [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|218562448|ref|YP_002344227.1| flagellar biosynthesis protein FliP [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|57166465|gb|AAW35244.1| flagellar biosynthetic protein FliP [Campylobacter jejuni RM1221]
 gi|85839328|gb|EAQ56590.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|85843090|gb|EAQ60301.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|88190107|gb|EAQ94082.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360154|emb|CAL34948.1| flagellar biosynthesis protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|157386051|gb|ABV52366.1| flagellar biosynthesis protein [Campylobacter jejuni subsp. jejuni
           81116]
 gi|284926065|gb|ADC28417.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|307747729|gb|ADN90999.1| Flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni M1]
 gi|315058270|gb|ADT72599.1| Flagellar biosynthesis protein fliP [Campylobacter jejuni subsp.
           jejuni S3]
 gi|315930473|gb|EFV09528.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni 305]
 gi|315931173|gb|EFV10146.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 244

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 147/202 (72%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R I+VFS LR  MG  S+PPN ++++LAL +TF++M P   
Sbjct: 46  VLTILALAPSIVFVMTSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVAT 105

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P +  +I    A  + A+PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 106 KSYNEGIKPYLAEKIGYEEAFIKGAKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 161

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI LPFL+IDM+V++++MAMGMMMLPPT ISLPFK
Sbjct: 162 DDVPLTVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPTMISLPFK 221

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 222 LLIFVLVDGWNLLVQRLVESFV 243


>gi|315928248|gb|EFV07564.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni DFVF1099]
          Length = 233

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 147/202 (72%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R I+VFS LR  MG  S+PPN ++++LAL +TF++M P   
Sbjct: 35  VLTILALAPSIVFVMTSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVAT 94

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P +  +I    A  + A+PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 95  KSYNEGIKPYLAEKIGYEEAFIKGAKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 150

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI LPFL+IDM+V++++MAMGMMMLPPT ISLPFK
Sbjct: 151 DDVPLTVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPTMISLPFK 210

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 211 LLIFVLVDGWNLLVQRLVESFV 232


>gi|297569685|ref|YP_003691029.1| flagellar biosynthetic protein FliP [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925600|gb|ADH86410.1| flagellar biosynthetic protein FliP [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 247

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 142/201 (70%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           +FT+L++AP +L+M+TCF R I+VFS LR  +G   +PPN V++ LA+F+T ++M+P   
Sbjct: 50  VFTVLAMAPAILLMMTCFTRLIVVFSFLRNAIGTQQMPPNQVLVGLAMFLTLFIMAPVFS 109

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  +  I P M  +I    A+Q  AEP   FM   TREKDL LF+ +A +    T     
Sbjct: 110 QINQTAIGPYMEEEIGAEEALQLAAEPIREFMFKQTREKDLELFLGLARAPRPQT----K 165

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   ILIP+FMISEL+ +F IGF++ LPFL+IDM+VA+++++MGMMMLPP  ++LPFK
Sbjct: 166 DDVPTHILIPAFMISELKTAFTIGFVLFLPFLVIDMVVASVLLSMGMMMLPPIMVALPFK 225

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L+V +LV+SF
Sbjct: 226 ILLFVLVDGWYLIVGSLVRSF 246


>gi|148926523|ref|ZP_01810205.1| flagellar biosynthesis protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|145845217|gb|EDK22311.1| flagellar biosynthesis protein [Campylobacter jejuni subsp. jejuni
           CG8486]
          Length = 244

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 147/202 (72%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R I+VFS LR  MG  S+PPN ++++LAL +TF++M P   
Sbjct: 46  VLTILALAPSIVFVMTSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVAT 105

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P +  +I    A  + A+PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 106 KSYNEGIKPYLAEKIGYEEAFIKGAKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 161

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI LPFL+IDM+V++++MAMGMMMLPPT ISLPFK
Sbjct: 162 DDVPLTVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPTMISLPFK 221

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 222 LLIFVLVDGWNLLVQRLVESFV 243


>gi|39995531|ref|NP_951482.1| flagellar biosynthesis protein FliP [Geobacter sulfurreducens PCA]
 gi|39982294|gb|AAR33755.1| flagellar biosynthetic protein FliP [Geobacter sulfurreducens PCA]
 gi|298504532|gb|ADI83255.1| flagellar biogenesis protein FliP [Geobacter sulfurreducens KN400]
          Length = 255

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 149/216 (68%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D+S+   +++ F + T+LS+AP LL+M T F R  +V S LR  +G    PPN +II+
Sbjct: 46  PGDVSV---VLQIFFLMTVLSLAPGLLMMTTSFTRIAVVLSFLRHAIGTQQAPPNQIIIA 102

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TF+VM+P   +     IQP    QIT+  A++R   P   FM + TREKDL+LF+
Sbjct: 103 LSLFLTFFVMAPVWQQVNTQAIQPYRAAQITQDEALKRAVAPMRKFMLSQTREKDLALFL 162

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           +++      T     D I    LIP+FMISELR +F+IGFLI +PFL++DM+VA+++M+M
Sbjct: 163 NLSKLPRPRT----ADDIPTLTLIPAFMISELRTAFQIGFLIFIPFLVVDMVVASVLMSM 218

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FVL+DGW L++ +L+KSF
Sbjct: 219 GMMMLPPVMISLPFKILLFVLVDGWGLVIGSLIKSF 254


>gi|57167820|ref|ZP_00366960.1| flagellar biosynthesis protein Cj0820c [Campylobacter coli RM2228]
 gi|305432155|ref|ZP_07401321.1| flagellar biosynthetic protein FliP [Campylobacter coli JV20]
 gi|57020942|gb|EAL57606.1| flagellar biosynthesis protein Cj0820c [Campylobacter coli RM2228]
 gi|304444820|gb|EFM37467.1| flagellar biosynthetic protein FliP [Campylobacter coli JV20]
          Length = 247

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 145/202 (71%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R I+VFS LR  MG  S+PPN ++++LAL +TF++M P   
Sbjct: 49  VLTILALAPSIIFVMTSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVAT 108

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P +  QI    A  R  +PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 109 KSYNEGIKPYLAEQIGYEEAFARGVKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 164

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI LPFL+IDM+V++++MAMGMMMLPP  ISLPFK
Sbjct: 165 DDVPLTVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPVMISLPFK 224

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 225 LLIFVLVDGWNLLVQRLVESFV 246


>gi|153951658|ref|YP_001398263.1| flagellar biosynthesis protein FliP [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939104|gb|ABS43845.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 244

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 146/202 (72%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R I+VFS LR  MG  S+PPN ++++LAL +TF++M P   
Sbjct: 46  VLTILALAPSIVFVMTSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVAT 105

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P +  QI    A  +  +PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 106 KSYNEGIKPYLAEQIGYEEAFIKGTKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 161

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI LPFL+IDM+V++++MAMGMMMLPPT ISLPFK
Sbjct: 162 DDVPLTVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPTMISLPFK 221

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 222 LLIFVLVDGWNLLVQRLVESFV 243


>gi|294500924|ref|YP_003564624.1| flagellar biosynthetic protein FliP [Bacillus megaterium QM B1551]
 gi|294350861|gb|ADE71190.1| flagellar biosynthetic protein FliP [Bacillus megaterium QM B1551]
          Length = 222

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 162/231 (70%), Gaps = 18/231 (7%)

Query: 23  LHDVMNI-----PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMG 77
           +++VMN+     P ++S S   V+   + T+ S+AP +LIM+TCF R +IV S +RT +G
Sbjct: 1   MNEVMNLFNSSSPTNISTS---VQLLLLLTVFSVAPGILIMMTCFTRIVIVLSFVRTSLG 57

Query: 78  MGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMR 137
              +PPN +++ L+LF+TF++M+PT  +  E  +QPL+  +IT   A ++ AEP   FM 
Sbjct: 58  TQQMPPNQILVGLSLFLTFFIMAPTFSQVNEQALQPLLKEKITLNQAYEKAAEPMKEFMS 117

Query: 138 NNTREKDLSLFMDMAHSSHRNTDITKNDHIE---YRILIPSFMISELRRSFEIGFLIILP 194
            +TR+KDL+LF++ A       DI +   ++      L+P++ ISEL+ +F+IGF+I +P
Sbjct: 118 AHTRQKDLALFLEYA-------DIDRPSSVQDIPLTALVPAYAISELKTAFQIGFMIFIP 170

Query: 195 FLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FLIIDMI+A+++M+MGMMMLPP  ISLPFK++ FVL+DGW+L+V++L+ SF
Sbjct: 171 FLIIDMIIASVLMSMGMMMLPPVMISLPFKILLFVLVDGWNLVVKSLLISF 221


>gi|302872555|ref|YP_003841191.1| flagellar biosynthetic protein FliP [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575414|gb|ADL43205.1| flagellar biosynthetic protein FliP [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 253

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 159/231 (68%), Gaps = 4/231 (1%)

Query: 15  ELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRT 74
           ++ FA +S    ++ P +    +  ++     TIL++AP +LIM+T F R +IV   +R 
Sbjct: 26  QIAFASASFSINLDNPQNPKDVSSALQLIIFLTILTLAPSILIMMTSFTRILIVLGFVRN 85

Query: 75  GMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWV 134
            +G   +PPN ++I LALF+TF+VM+P  D+      QP +  QIT   A++R  +P   
Sbjct: 86  ALGTQQMPPNQILIGLALFLTFFVMAPVTDKIYTQAYQPYIKGQITSQEALKRAEQPLKE 145

Query: 135 FMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILP 194
           FM  NTR+KDL LF+ + +  + NT++     +  R+++P+F+ISEL+ +FE+GFLI +P
Sbjct: 146 FMLKNTRKKDLDLFVKLGNI-NPNTNV---KDLPIRVVVPAFIISELKSAFEMGFLIYVP 201

Query: 195 FLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FLIIDM+VA+I+M+MGM+M+PP  ISLPFK++ F+L+DGW+L+VE+LV+SF
Sbjct: 202 FLIIDMVVASILMSMGMLMIPPVMISLPFKILLFILVDGWNLVVESLVRSF 252


>gi|315124338|ref|YP_004066342.1| flagellar biosynthesis protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|315018060|gb|ADT66153.1| flagellar biosynthesis protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
          Length = 230

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 147/202 (72%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R I+VFS LR  MG  S+PPN ++++LAL +TF++M P   
Sbjct: 32  VLTILALAPSIVFVMTSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVAT 91

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P +  +I    A  + A+PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 92  KSYNEGIKPYLAEKIGYEEAFIKGAKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 147

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI LPFL+IDM+V++++MAMGMMMLPPT ISLPFK
Sbjct: 148 DDVPLTVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPTMISLPFK 207

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 208 LLIFVLVDGWNLLVQRLVESFV 229


>gi|312792663|ref|YP_004025586.1| flagellar biosynthetic protein flip [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179803|gb|ADQ39973.1| flagellar biosynthetic protein FliP [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 253

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 162/231 (70%), Gaps = 4/231 (1%)

Query: 15  ELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRT 74
           E+ FA +SL+  +  P +    +  ++     TIL++AP +LIM+T F R +IV   +R 
Sbjct: 26  EIAFASASLNINLGSPQNPKDVSSALQLLIFLTILTLAPSILIMMTSFTRILIVLGFVRN 85

Query: 75  GMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWV 134
            +G   +PPN ++I LALF+TF+VM+P  D+      QP +N +IT   A++R  EP   
Sbjct: 86  ALGTQQMPPNQILIGLALFLTFFVMAPVTDKIYTQAYQPYINGRITSQEALKRAEEPLKE 145

Query: 135 FMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILP 194
           FM  NTR+KDL LF+ +++  + NT++     +  R+++P+F+ISEL+ +FE+GFLI +P
Sbjct: 146 FMLKNTRKKDLDLFVKLSNV-NPNTNV---KDLPLRVVVPAFIISELKSAFEMGFLIYVP 201

Query: 195 FLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FLIIDM+VA+I+M+MGM+M+PP  ISLPFK++ F+L+DGW+L+VE+LV+SF
Sbjct: 202 FLIIDMVVASILMSMGMLMIPPVMISLPFKILLFILVDGWNLVVESLVRSF 252


>gi|315638458|ref|ZP_07893635.1| flagellar biosynthetic protein FliP [Campylobacter upsaliensis
           JV21]
 gi|315481449|gb|EFU72076.1| flagellar biosynthetic protein FliP [Campylobacter upsaliensis
           JV21]
          Length = 244

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 146/202 (72%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R IIVFS LR  MG  S+PPN +++++AL +TF++M P   
Sbjct: 46  VLTILALAPSIIFIMTSFLRLIIVFSFLRQAMGTQSMPPNTILVTMALILTFFIMEPVAT 105

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   G++P ++ QI    A  R  +PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 106 KSYNEGVKPYLSEQIGYEEAFVRGVKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 161

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI LPFL+IDM+V++++MAMGMMMLPP  ISLPFK
Sbjct: 162 DDVPLSVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPVMISLPFK 221

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 222 LLIFVLVDGWNLLVQRLVESFV 243


>gi|66735095|gb|AAY53788.1| flagella export apparatus [Campylobacter jejuni]
          Length = 233

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 147/202 (72%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R I+VFS LR  MG  S+PPN ++++LAL +TF++M P   
Sbjct: 35  VLTILALAPSIVFVMTSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVAT 94

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P ++ +I    A  + A+PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 95  KSYNEGIKPYLSEKIGYEEAFIKGAKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 150

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI  PFL+IDM+V++++MAMGMMMLPPT ISLPFK
Sbjct: 151 DDVPLTVLVPAFMISELKTAFEIGFLIYQPFLVIDMVVSSVLMAMGMMMLPPTMISLPFK 210

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 211 LLIFVLVDGWNLLVQRLVESFV 232


>gi|197104388|ref|YP_002129765.1| flagellar biosynthesis protein FliP [Phenylobacterium zucineum
           HLK1]
 gi|196477808|gb|ACG77336.1| flagellar biosynthesis protein FliP [Phenylobacterium zucineum
           HLK1]
          Length = 245

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 99/212 (46%), Positives = 148/212 (69%), Gaps = 4/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
            ++  +V+  G+ T+LS+AP ++IM T F R ++V S+LRT +G+   PPN VIISLALF
Sbjct: 31  GLTERVVQLVGLLTVLSLAPSIVIMTTSFVRIVVVLSLLRTALGVQQSPPNAVIISLALF 90

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T  VM PT +RS + G++PL++ QI    A      P   FM +    +DL+LF+ ++ 
Sbjct: 91  LTAIVMGPTFERSYQEGVKPLLDQQIELPQAFDAAGAPVKTFMLSQVDPEDLALFVRLSR 150

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                T     +    R++ P+FMISEL+R+FEIGFL+ +PFL+ID++VA+++M+MGMMM
Sbjct: 151 IPRPAT----MEDTPLRVVTPAFMISELKRAFEIGFLLFIPFLVIDLVVASVLMSMGMMM 206

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPP ++SLPFK+IFFVL+DGW L+  +LV+SF
Sbjct: 207 LPPVTVSLPFKLIFFVLVDGWRLVAGSLVESF 238


>gi|167005441|ref|ZP_02271199.1| flagellar biosynthesis protein FliP [Campylobacter jejuni subsp.
           jejuni 81-176]
          Length = 244

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 147/202 (72%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R I+VFS LR  MG  S+PPN ++++LAL +TF++M P   
Sbjct: 46  VLTILALAPSIVFVMTSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVAT 105

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P ++ +I    A  + A+PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 106 KSYNEGIKPYLSEKIGYEEAFIKGAKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 161

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI  PFL+IDM+V++++MAMGMMMLPPT ISLPFK
Sbjct: 162 DDVPLTVLVPAFMISELKTAFEIGFLIYQPFLVIDMVVSSVLMAMGMMMLPPTMISLPFK 221

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 222 LLIFVLVDGWNLLVQRLVESFV 243


>gi|78224289|ref|YP_386036.1| flagellar biosynthesis protein FliP [Geobacter metallireducens
           GS-15]
 gi|78195544|gb|ABB33311.1| Flagellar transport protein FliP [Geobacter metallireducens GS-15]
          Length = 250

 Score =  205 bits (521), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 149/217 (68%), Gaps = 9/217 (4%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D+S    +++ F + T+LS+AP L++M T F R +IV S LR  +G    PPN +I++
Sbjct: 41  PGDVST---VLQIFFLMTVLSLAPGLMMMTTSFTRIVIVLSFLRNAIGTQQSPPNQIIVA 97

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TF+VMSP   +     IQP    QIT+  A +R   P   FM + TREKDL+LF+
Sbjct: 98  LSLFLTFFVMSPVWQQVNTQAIQPYRAAQITQEEAFRRAQVPVRKFMFSQTREKDLALFI 157

Query: 150 DMAH-SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMA 208
           +++     RN D      I    LIP+FMISELR +F+IGFLI +PFL+IDM+VA+++M+
Sbjct: 158 NLSKLQRPRNAD-----DIPTLTLIPAFMISELRTAFQIGFLIFIPFLVIDMVVASVLMS 212

Query: 209 MGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MGMMMLPP  ISLPFK++ FVL+DGW L++ +LVKSF
Sbjct: 213 MGMMMLPPVMISLPFKILLFVLVDGWGLVIGSLVKSF 249


>gi|163732490|ref|ZP_02139935.1| flagellar biosynthesis protein P [Roseobacter litoralis Och 149]
 gi|161393850|gb|EDQ18174.1| flagellar biosynthesis protein P [Roseobacter litoralis Och 149]
          Length = 243

 Score =  205 bits (521), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 155/251 (61%), Gaps = 15/251 (5%)

Query: 1   MIRYCFFALFLVT---PELVFAKS---SLHDVMNIPADLSISTWIVRTFGIFTILSIAPI 54
           M R    A+FL     P + FA+    SL D      D S+S   ++ F + T+LS+AP 
Sbjct: 1   MTRVVLLAVFLTGVFIPSVSFAQDLSISLGD------DGSLSARTIQLFILITVLSLAPG 54

Query: 55  LLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPL 114
           L IM+TCFP  + V SILR  +G+   PPN++I+SLALF+T+++M P    + + GIQPL
Sbjct: 55  LAIMITCFPFLVTVLSILRQAIGLQQSPPNMLIVSLALFLTYFIMEPVFQAAWQNGIQPL 114

Query: 115 MNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIP 174
            +N I   TA  R  EPF  FM       D   F  MA       D T        +L+P
Sbjct: 115 TDNAIDAETAFVRTLEPFRSFM---AARLDPDTFFAMAELRSETIDATPTAEAPLSVLVP 171

Query: 175 SFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGW 234
           SF++SE+ R+F+IGFL+ LPFLIID++VA ++M+MGMMM+PP  +SLPFK+ FFVL DGW
Sbjct: 172 SFLLSEISRAFQIGFLVFLPFLIIDLVVAAVLMSMGMMMVPPVIVSLPFKLAFFVLADGW 231

Query: 235 SLLVENLVKSF 245
           +L+  +LV+S+
Sbjct: 232 NLIAGSLVQSY 242


>gi|205356321|ref|ZP_03223086.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8421]
 gi|205345706|gb|EDZ32344.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 233

 Score =  205 bits (521), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 146/202 (72%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL +AP ++ ++T F R I+VFS LR  MG  S+PPN ++++LAL +TF++M P   
Sbjct: 35  VLTILVLAPSIVFVMTSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVAT 94

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P +  +I    A  + A+PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 95  KSYNEGIKPYLAEKIGYEEAFIKGAKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 150

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI LPFL+IDM+V++++MAMGMMMLPPT ISLPFK
Sbjct: 151 DDVPLTVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPTMISLPFK 210

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 211 LLIFVLVDGWNLLVQRLVESFV 232


>gi|283957192|ref|ZP_06374656.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283791368|gb|EFC30173.1| flagellar biosynthetic protein FliP [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 244

 Score =  204 bits (520), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 146/202 (72%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL++AP ++ ++T F R I+VFS LR  MG  S+PPN ++++LAL +TF++M P   
Sbjct: 46  VLTILALAPSIVFVMTSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVAT 105

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P +  +I    A  +  +PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 106 KSYNEGIKPYLAEKIGYEEAFIKGVKPFKDFMLKNTREKDLALFYRIRNLPNPKTI---- 161

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +L+P+FMISEL+ +FEIGFLI LPFL+IDM+V++++MAMGMMMLPPT ISLPFK
Sbjct: 162 DDVPLTVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPTMISLPFK 221

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           ++ FVL+DGW+LLV+ LV+SF+
Sbjct: 222 LLIFVLVDGWNLLVQRLVESFV 243


>gi|313895854|ref|ZP_07829408.1| flagellar biosynthetic protein FliP [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|312975279|gb|EFR40740.1| flagellar biosynthetic protein FliP [Selenomonas sp. oral taxon 137
           str. F0430]
          Length = 255

 Score =  204 bits (519), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 154/216 (71%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D++ S   ++   + T+LS+AP +LIM T F R ++V   LR  +   +VPPN V+++
Sbjct: 46  PQDVAAS---MQLLAVLTVLSLAPAMLIMTTSFVRIVVVIGFLRNALSTQNVPPNQVVLA 102

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TFY+M+P   ++ E GI+P ++ QIT+  A++ V EP   FM + TRE DL+LF+
Sbjct: 103 LSLFLTFYIMAPYWGQANENGIRPYLDGQITQEQALENVVEPMRDFMFHQTRESDLALFV 162

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           +++ +   N+     D +    LIP+F+ISEL+ +F+IGF+I +PF++IDMIVA+ +M+M
Sbjct: 163 NLSDAERPNSP----DDVSTFTLIPAFIISELKTAFQIGFMIYIPFIVIDMIVASTLMSM 218

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FV++DGW LL+++L+ SF
Sbjct: 219 GMMMLPPVMISLPFKILLFVMVDGWHLLIQSLIMSF 254


>gi|149203108|ref|ZP_01880079.1| flagellar biosynthetic protein FliP [Roseovarius sp. TM1035]
 gi|149143654|gb|EDM31690.1| flagellar biosynthetic protein FliP [Roseovarius sp. TM1035]
          Length = 245

 Score =  204 bits (519), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 100/215 (46%), Positives = 146/215 (67%), Gaps = 3/215 (1%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S+S   ++   + T+LS+AP + IMVTCFP  + V SILR G+G+   PPN++I+SLA
Sbjct: 34  DASLSARTLQLIALITVLSLAPGIAIMVTCFPFVVTVLSILRQGIGLQQSPPNMLIVSLA 93

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VM P   ++ E GI+PL+  +++   AI+R   PF VFM        L+    +
Sbjct: 94  LFLTFFVMEPVFTQAWETGIEPLLQERLSPDLAIERTLAPFRVFMLGRVDPDTLA---TI 150

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           A      T ++        ILIPSFM+SE+ R+F+IGFL+ LPFLIID++VA I+M+MGM
Sbjct: 151 AALRPETTTLSAGPDAPLSILIPSFMLSEIARAFQIGFLVFLPFLIIDLVVAAILMSMGM 210

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           MM+PP  +SLPFK+ FFV+ DGW+L+ E+LV+ ++
Sbjct: 211 MMVPPAIVSLPFKLAFFVIADGWTLIAESLVRGYL 245


>gi|320529418|ref|ZP_08030506.1| flagellar biosynthetic protein FliP [Selenomonas artemidis F0399]
 gi|320138384|gb|EFW30278.1| flagellar biosynthetic protein FliP [Selenomonas artemidis F0399]
          Length = 255

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 153/216 (70%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D++ S   ++   + T+LS+AP +LIM T F R ++V   LR  +   +VPPN V+++
Sbjct: 46  PQDVAAS---MQLLAVLTVLSLAPAMLIMTTSFVRIVVVIGFLRNALSTQNVPPNQVVLA 102

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TFY+M+P   ++ E GI+P ++ QIT+  A++ V EP   FM   TRE DL+LF+
Sbjct: 103 LSLFLTFYIMAPYWGQANENGIRPYLDGQITQEQALENVVEPMRDFMFRQTRESDLALFV 162

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           +++ +   N+     D +    LIP+F+ISEL+ +F+IGF+I +PF++IDMIVA+ +M+M
Sbjct: 163 NLSDAERPNSP----DDVSTFTLIPAFIISELKTAFQIGFMIYIPFIVIDMIVASTLMSM 218

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FV++DGW LL+++L+ SF
Sbjct: 219 GMMMLPPVMISLPFKILLFVMVDGWHLLIQSLIMSF 254


>gi|52080238|ref|YP_079029.1| flagellar biosynthesis protein FliP [Bacillus licheniformis ATCC
           14580]
 gi|52785615|ref|YP_091444.1| flagellar biosynthesis protein FliP [Bacillus licheniformis ATCC
           14580]
 gi|319645983|ref|ZP_08000213.1| FliP protein [Bacillus sp. BT1B_CT2]
 gi|52003449|gb|AAU23391.1| flagellar protein [Bacillus licheniformis ATCC 14580]
 gi|52348117|gb|AAU40751.1| FliP [Bacillus licheniformis ATCC 14580]
 gi|317391733|gb|EFV72530.1| FliP protein [Bacillus sp. BT1B_CT2]
          Length = 221

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 151/222 (68%), Gaps = 11/222 (4%)

Query: 24  HDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPP 83
            D  N+ A        VR   + T+ SIAP +LI++TCF R +IV S +RT +   S+PP
Sbjct: 11  SDAANVSAS-------VRLLLLLTVFSIAPGILILMTCFTRVVIVLSFVRTSLATQSMPP 63

Query: 84  NLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREK 143
           N V+I LALF+TF++M PT     +  + PLMNN+IT   A  +   P   FM  +TR+K
Sbjct: 64  NQVLIGLALFLTFFIMGPTFSEINKEALTPLMNNKITLDEAYTKAEAPIKTFMSKHTRQK 123

Query: 144 DLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVA 203
           DL+LFM+ A      T  + ND I    ++P+F+ISEL+ +F++GF+I +PFLIIDM+VA
Sbjct: 124 DLALFMNYAK---METPESIND-IPLSTMVPAFVISELKTAFQMGFMIFIPFLIIDMVVA 179

Query: 204 TIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +++M+MGMMMLPP  ISLPFK++ FVL+DGW L+V++L++SF
Sbjct: 180 SVLMSMGMMMLPPVMISLPFKILLFVLVDGWYLIVKSLLQSF 221


>gi|229544408|ref|ZP_04433466.1| flagellar biosynthetic protein FliP [Bacillus coagulans 36D1]
 gi|229324893|gb|EEN90570.1| flagellar biosynthetic protein FliP [Bacillus coagulans 36D1]
          Length = 221

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 145/206 (70%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+   + T+LS+AP +LI++T F R +IV S +RT +G  + PPN VI+ LALF+TF++M
Sbjct: 20  VKILLLMTVLSLAPSILILLTSFTRIVIVLSFVRTSLGTQTAPPNQVIVGLALFLTFFIM 79

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT  +  +  + PL ++++T   A  +  +PF  FM   TR+KDL LF+D AH     +
Sbjct: 80  APTFQQVNKQALTPLFHDKLTLEEAYDKAQKPFKEFMAKETRQKDLQLFLDYAHKKQPKS 139

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                  I    L+P+F ISEL+ +F++GF+I +PFL+IDM+VA+++M+MGMMMLPP  I
Sbjct: 140 ----VQDIPMTTLVPAFTISELKTAFQMGFMIFIPFLVIDMVVASVLMSMGMMMLPPVMI 195

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW L+V++L++SF
Sbjct: 196 SLPFKILLFVLVDGWYLVVKSLLESF 221


>gi|312135838|ref|YP_004003176.1| flagellar biosynthetic protein flip [Caldicellulosiruptor
           owensensis OL]
 gi|311775889|gb|ADQ05376.1| flagellar biosynthetic protein FliP [Caldicellulosiruptor
           owensensis OL]
          Length = 253

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 105/245 (42%), Positives = 162/245 (66%), Gaps = 10/245 (4%)

Query: 1   MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVT 60
           +I  CF        EL FA ++++  +  P +    +  ++     TIL++ P +LIM+T
Sbjct: 18  LITVCF------KKELAFATANININLGNPQNPDDISSALQLIIFLTILTLVPSILIMMT 71

Query: 61  CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT 120
            F R +IV   +R  +G   +PPN ++I LALF+TF+VM+P  D+      QP +N +IT
Sbjct: 72  SFTRILIVLGFVRNALGTQQMPPNQILIGLALFLTFFVMAPVTDKIYTQAYQPYINGEIT 131

Query: 121 ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE 180
              A++R   P   FM  NTR+KDL LF+ + +  + NT+I     +  R+++P+F+ISE
Sbjct: 132 SQEALKRAEVPLKEFMLKNTRKKDLDLFVKLGNV-NPNTNIR---DLPLRVVVPAFIISE 187

Query: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVEN 240
           L+ +FE+GFLI +PFLIIDM VA+I+M+MGM+M+PP  ISLPFK++ F+L+DGW+L+VE+
Sbjct: 188 LKSAFEMGFLIYVPFLIIDMTVASILMSMGMLMIPPVMISLPFKILLFILVDGWNLVVES 247

Query: 241 LVKSF 245
           LV+SF
Sbjct: 248 LVRSF 252


>gi|302037618|ref|YP_003797940.1| flagellar biosynthetic protein FliP [Candidatus Nitrospira
           defluvii]
 gi|300605682|emb|CBK42015.1| Flagellar biosynthetic protein FliP, export component [Candidatus
           Nitrospira defluvii]
          Length = 266

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 144/207 (69%), Gaps = 4/207 (1%)

Query: 39  IVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYV 98
           +++   +FT+LS+AP L IMVT F R +IV S LR  MG   VPPN V+ISLALF+T +V
Sbjct: 63  VLQILALFTVLSLAPALFIMVTSFTRMVIVLSFLRQAMGTQQVPPNQVLISLALFLTMFV 122

Query: 99  MSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRN 158
           M+P      +  +QPL+  QI    A  R  +P   FM    R+KDL LFM+++H+    
Sbjct: 123 MAPVGQAVYKDALQPLLAEQIGYEDAWNRGIQPIRAFMLKQMRDKDLELFMELSHAPKA- 181

Query: 159 TDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTS 218
              T+ + +   ++IP+F++SELR +F+IGFL+ +PFLI+DM+VA+++M+MGMM+LPP  
Sbjct: 182 ---TQVEQVPIHVIIPAFVLSELRIAFQIGFLLYIPFLIVDMVVASVLMSMGMMLLPPVM 238

Query: 219 ISLPFKVIFFVLIDGWSLLVENLVKSF 245
           ISLPFK+I FVL DGW L+V ++V+SF
Sbjct: 239 ISLPFKLILFVLADGWYLVVGSMVRSF 265


>gi|182418437|ref|ZP_02949731.1| flagellar biosynthetic protein FliP [Clostridium butyricum 5521]
 gi|237666336|ref|ZP_04526321.1| flagellar biosynthetic protein FliP [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|182377819|gb|EDT75363.1| flagellar biosynthetic protein FliP [Clostridium butyricum 5521]
 gi|237657535|gb|EEP55090.1| flagellar biosynthetic protein FliP [Clostridium butyricum E4 str.
           BoNT E BL5262]
          Length = 259

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 153/225 (68%), Gaps = 5/225 (2%)

Query: 22  SLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSV 81
           S  D  + P D   +   +R    FT+L++ P ++IMVT F R ++VFS L+T +G+   
Sbjct: 40  SFGDGSDSPKDYVTN---IRILIFFTVLALLPSIVIMVTSFTRIVVVFSFLKTAIGVTQS 96

Query: 82  PPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTR 141
            PN ++  LA+F+TF++M P   +    GIQP + N+IT+  AI  +++P   FM   TR
Sbjct: 97  VPNQILTGLAIFLTFFIMQPVYSQMNTNGIQPYLENKITQEQAIDEISKPLKEFMAKETR 156

Query: 142 EKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMI 201
           + DL LF+++ +   ++  I +   I +  L+P+F ISELR +FEIGFLI LPFL+IDM+
Sbjct: 157 QDDLELFIEINNVDKQS--IAEAKDIPFTSLVPAFAISELRTAFEIGFLIFLPFLVIDMV 214

Query: 202 VATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           VA+++M+MGM MLPPT+++LPFK+I FV+++GW LLVE L+KSF+
Sbjct: 215 VASVLMSMGMFMLPPTTVALPFKLILFVMVNGWHLLVEQLIKSFM 259


>gi|110677670|ref|YP_680677.1| flagellar biosynthesis protein FliP [Roseobacter denitrificans OCh
           114]
 gi|109453786|gb|ABG29991.1| flagellar biosynthetic protein FliP [Roseobacter denitrificans OCh
           114]
          Length = 245

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 155/251 (61%), Gaps = 15/251 (5%)

Query: 1   MIRYCFFALFLV---TPELVFAKS---SLHDVMNIPADLSISTWIVRTFGIFTILSIAPI 54
           M R    A+ L+   TP +  A+    SL D      D S+S   ++ F + T+LS+AP 
Sbjct: 3   MTRITLLAVVLIGLFTPSVSLAQDLSISLGD------DGSLSARTIQLFILITVLSLAPG 56

Query: 55  LLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPL 114
           L IM+TCFP  + V SILR  +G+   PPN++I+SLALF+T+++M P    + + GIQPL
Sbjct: 57  LAIMITCFPFLVTVLSILRQAIGLQQSPPNMLIVSLALFLTYFIMEPVFQAAWQNGIQPL 116

Query: 115 MNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIP 174
            +N I   TA  R  EPF +FM       D   F  MA       D          +L+P
Sbjct: 117 TDNAIDAETAFVRTLEPFRIFMAGRL---DPDTFFAMAELRSETIDAAPTAEAPLSVLVP 173

Query: 175 SFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGW 234
           SF++SE+ R+F+IGFL+ LPFLIID++VA ++M+MGMMM+PP  +SLPFK+ FFVL DGW
Sbjct: 174 SFLLSEISRAFQIGFLVFLPFLIIDLVVAAVLMSMGMMMVPPVIVSLPFKLAFFVLADGW 233

Query: 235 SLLVENLVKSF 245
           +L+  +LV+S+
Sbjct: 234 NLIAGSLVQSY 244


>gi|73539701|ref|YP_300068.1| flagellar biosynthesis protein FliP [Ralstonia eutropha JMP134]
 gi|72123038|gb|AAZ65224.1| Flagellar transport protein FliP [Ralstonia eutropha JMP134]
          Length = 265

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 150/228 (65%), Gaps = 6/228 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
            +L  V + P       W   ++T  + T LS  P  ++M+T F R +IV  +LR  +G 
Sbjct: 41  QALPGVTSKPGPGGGQIWSLSIQTLVLLTSLSFLPAAVLMMTGFTRIVIVLGLLRNALGT 100

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ L+LF+TF+VMSP LDR      +PL  N+I+  TA+ + AEP   FM  
Sbjct: 101 ASSPPNQVLVGLSLFLTFFVMSPVLDRVYNDAYKPLSENRISLETAMAKAAEPLKGFMLK 160

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TREKDL++F  MA +     ++   + +   IL+P+F+ SEL+ +F+IGF I +PFLII
Sbjct: 161 QTREKDLAMFAQMAKAP----EMQGPEEVPMSILVPAFVTSELKTAFQIGFTIFIPFLII 216

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           D++VA+++MAMGMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF+
Sbjct: 217 DLVVASVLMAMGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSFM 264


>gi|295696128|ref|YP_003589366.1| flagellar biosynthetic protein FliP [Bacillus tusciae DSM 2912]
 gi|295411730|gb|ADG06222.1| flagellar biosynthetic protein FliP [Bacillus tusciae DSM 2912]
          Length = 264

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 95/203 (46%), Positives = 145/203 (71%), Gaps = 6/203 (2%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+LS+AP +L+M+T F R I+V S +R+ + +   PPN V+I LAL +TF+VM+PTL 
Sbjct: 67  LITVLSLAPGILVMITSFTRMIVVLSFVRSALAVQQTPPNQVLIGLALALTFFVMAPTLS 126

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDI-TK 163
           +  +  +QP +  ++T+T AI R   PF  FM   TREKDL LF+D     +RN  +  +
Sbjct: 127 QVNQQAVQPYLRGELTQTQAIARAEVPFKHFMAKQTREKDLQLFLD-----YRNVALPDR 181

Query: 164 NDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPF 223
            + I   +L+P++ ISEL+ +FEIGF+I +PFLIIDM++++++MAMGMMMLPP  +SLPF
Sbjct: 182 VEDIPMSLLVPAYTISELKTAFEIGFMIFIPFLIIDMVISSVLMAMGMMMLPPVIVSLPF 241

Query: 224 KVIFFVLIDGWSLLVENLVKSFI 246
           K++ FVL DGW L+V++L+  ++
Sbjct: 242 KILLFVLADGWYLIVKSLLAGYV 264


>gi|238924154|ref|YP_002937670.1| flagellar biosynthetic protein FliP [Eubacterium rectale ATCC
           33656]
 gi|238875829|gb|ACR75536.1| flagellar biosynthetic protein FliP [Eubacterium rectale ATCC
           33656]
 gi|291524887|emb|CBK90474.1| flagellar biosynthetic protein FliP [Eubacterium rectale DSM 17629]
 gi|291529028|emb|CBK94614.1| flagellar biosynthetic protein FliP [Eubacterium rectale M104/1]
          Length = 299

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 96/206 (46%), Positives = 145/206 (70%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           VR F + T+LS+AP +LIM+T F R IIV   +RT +G  + PPN V++ LALF+T ++M
Sbjct: 98  VRMFLVLTVLSLAPSILIMLTSFTRIIIVLHFVRTAIGTQTAPPNQVLVGLALFLTLFIM 157

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PT  +  E  I+PL   +IT+  AI+    PF  FM   T+ KD+ LF+D++   + + 
Sbjct: 158 WPTFSQVNEKAIKPLDEGKITQQEAIKEAEGPFREFMYGQTQTKDIKLFVDISGDEYDDY 217

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           D      + +  L+P+F++SELR +F +GFLI +PF++IDM+V++++M+MGMMMLPPT+I
Sbjct: 218 D-----DVPFTTLVPAFILSELRTAFILGFLIYIPFIVIDMVVSSVLMSMGMMMLPPTTI 272

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           S+PFKV+ F+L DGW L++ NLVK+F
Sbjct: 273 SMPFKVLLFILADGWDLVIGNLVKTF 298


>gi|224438396|ref|ZP_03659323.1| flagellar biosynthesis protein FliP [Helicobacter cinaedi CCUG
           18818]
          Length = 274

 Score =  201 bits (512), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 142/201 (70%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T+L IAP L++++T F R +IVF+ LRT +G    PP  V++SLAL +TF++M P   
Sbjct: 77  IITLLVIAPSLVLVMTSFTRIVIVFAFLRTALGTQQSPPTQVLVSLALVLTFFIMEPVAT 136

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S E+GI+P    QI+   A +R   PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 137 KSYEVGIKPYTEKQISYDEAFERAIVPFKDFMIKNTREKDLALFFRIRNLENPQT----V 192

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +LIP+FMISEL+ +F IGFL+ LPFL+IDM++++++MAMGMMMLPP  ISLPFK
Sbjct: 193 DDVPLTVLIPAFMISELKTAFWIGFLLYLPFLVIDMVISSVLMAMGMMMLPPVMISLPFK 252

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+LL+ NLV+ F
Sbjct: 253 ILVFVLVDGWNLLIGNLVQGF 273


>gi|297538204|ref|YP_003673973.1| flagellar biosynthetic protein FliP [Methylotenera sp. 301]
 gi|297257551|gb|ADI29396.1| flagellar biosynthetic protein FliP [Methylotenera sp. 301]
          Length = 258

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 154/241 (63%), Gaps = 6/241 (2%)

Query: 7   FALFLVTPELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIMVTCFPR 64
            A  L+ P    A++ +  V  +PA      + +  +T  + T L+  P  L+M+T F R
Sbjct: 21  LASMLMLPGTALAENGMPLVNALPAAGGGQNYTLSLQTLILLTSLTFLPAALLMMTGFTR 80

Query: 65  FIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTA 124
            IIV S+LR  +G  S PPN V++ LALF+TF+VMSP +D+      QPL  N+IT   A
Sbjct: 81  IIIVLSLLRQALGTQSAPPNQVMVGLALFLTFFVMSPVIDKIYVDAYQPLSENKITMQEA 140

Query: 125 IQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRS 184
           + + A P   FM   TRE DL+LF++MA      T     D +   +L+P+FM SEL+ +
Sbjct: 141 MDKGAAPLKAFMMKQTREGDLALFVNMAKIEKIETP----DQVPLLVLVPAFMTSELKTA 196

Query: 185 FEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKS 244
           F+IGF I +PFLIIDM+VA+++MAMGMMM+ P+ +SLPFK++ FVL+DGW LL+ +LV+S
Sbjct: 197 FQIGFAIFIPFLIIDMVVASVLMAMGMMMVSPSIVSLPFKLMLFVLVDGWQLLLGSLVQS 256

Query: 245 F 245
           F
Sbjct: 257 F 257


>gi|95929864|ref|ZP_01312605.1| flagellar biosynthetic protein FliP [Desulfuromonas acetoxidans DSM
           684]
 gi|95134160|gb|EAT15818.1| flagellar biosynthetic protein FliP [Desulfuromonas acetoxidans DSM
           684]
          Length = 246

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 96/201 (47%), Positives = 141/201 (70%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TILS+AP +L+M T F R ++V S +R  MG   +PPN VI+ L+LF+TF++M+P   
Sbjct: 49  VLTILSVAPAILLMTTAFVRVVVVLSFIRQAMGTQQMPPNQVIVGLSLFLTFFIMAPVYS 108

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
              E  +QP ++ +I +  A+     P   FM + TREKDL+L +D+A +   +T     
Sbjct: 109 VVNERAVQPYLSGEIDQAQALTEAVNPVRDFMYSQTREKDLALLVDIAGNDRPDT----I 164

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +    LIP+FM+SEL R+F+IGF++ +PFL+IDM+VA+++M+MGMMMLPP  ISLPFK
Sbjct: 165 DDVPTTTLIPAFMLSELNRAFQIGFMVYVPFLVIDMVVASVLMSMGMMMLPPPIISLPFK 224

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L+V +LVKSF
Sbjct: 225 LLLFVLVDGWGLVVGSLVKSF 245


>gi|146296296|ref|YP_001180067.1| flagellar biosynthetic protein FliP [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409872|gb|ABP66876.1| flagellar biosynthetic protein FliP [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 251

 Score =  201 bits (511), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 155/221 (70%), Gaps = 11/221 (4%)

Query: 27  MNIPADLSISTWIVRTFGIF-TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNL 85
           MN P D+S +  ++    IF TIL++AP +LIM+T F R +IV   +R  +G   +PPN 
Sbjct: 39  MNNPRDVSSAIQLI----IFLTILTLAPSILIMMTSFTRILIVLGFVRNALGTQQMPPNQ 94

Query: 86  VIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDL 145
           ++I LALF+TF++M+P  +R       P +  QIT   A++R   P   FM  NTR+KDL
Sbjct: 95  ILIGLALFLTFFIMAPVGERIYTQSYLPYIKGQITSQEALKRAEAPIKEFMLKNTRKKDL 154

Query: 146 SLFMDMAHSSHRNTDITKN-DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVAT 204
            LF+ ++     NT+ T N  ++  R++IP+F+ISEL+ +FE+GF+I +PFLIIDM+VA+
Sbjct: 155 DLFIKLS-----NTNPTTNVRNLPLRVVIPAFIISELKSAFEMGFIIYVPFLIIDMVVAS 209

Query: 205 IVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           I+M+MGM+M+PP  ISLPFK++ F+L+DGW L+VE+L+KSF
Sbjct: 210 ILMSMGMLMIPPVMISLPFKILLFILVDGWGLVVESLIKSF 250


>gi|313144838|ref|ZP_07807031.1| flagellar biosynthesis protein FliP [Helicobacter cinaedi CCUG
           18818]
 gi|313129869|gb|EFR47486.1| flagellar biosynthesis protein FliP [Helicobacter cinaedi CCUG
           18818]
          Length = 266

 Score =  201 bits (511), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 142/201 (70%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T+L IAP L++++T F R +IVF+ LRT +G    PP  V++SLAL +TF++M P   
Sbjct: 69  IITLLVIAPSLVLVMTSFTRIVIVFAFLRTALGTQQSPPTQVLVSLALVLTFFIMEPVAT 128

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S E+GI+P    QI+   A +R   PF  FM  NTREKDL+LF  + +  +  T     
Sbjct: 129 KSYEVGIKPYTEKQISYDEAFERAIVPFKDFMIKNTREKDLALFFRIRNLENPQT----V 184

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +LIP+FMISEL+ +F IGFL+ LPFL+IDM++++++MAMGMMMLPP  ISLPFK
Sbjct: 185 DDVPLTVLIPAFMISELKTAFWIGFLLYLPFLVIDMVISSVLMAMGMMMLPPVMISLPFK 244

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+LL+ NLV+ F
Sbjct: 245 ILVFVLVDGWNLLIGNLVQGF 265


>gi|94264046|ref|ZP_01287846.1| Flagellar transport protein FliP [delta proteobacterium MLMS-1]
 gi|93455557|gb|EAT05744.1| Flagellar transport protein FliP [delta proteobacterium MLMS-1]
          Length = 252

 Score =  201 bits (510), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 141/201 (70%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+LS+AP +L+M+TCF R I+VFS LR  +G   +PPN V+I LALF+T ++M+P   
Sbjct: 55  VLTVLSMAPAILLMMTCFTRLIVVFSFLRNAIGTQQMPPNQVLIGLALFLTVFIMAPVFS 114

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  +  + P M+ +I    A++  AEP   FM   TREKDL LF+ ++ S          
Sbjct: 115 QINQQAVGPYMDEEIGIEEALRTAAEPLREFMFKQTREKDLELFLGLSQSPRPQ----NK 170

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +LIP+FMISEL+ +F IGF++ +PFL+IDM+VA+++++MGMMMLPP  I+LPFK
Sbjct: 171 DDVSTFVLIPAFMISELKTAFTIGFILFIPFLVIDMVVASVLLSMGMMMLPPIMIALPFK 230

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L+V +LV+SF
Sbjct: 231 ILLFVLVDGWYLIVGSLVRSF 251


>gi|94266368|ref|ZP_01290067.1| Flagellar transport protein FliP [delta proteobacterium MLMS-1]
 gi|93453020|gb|EAT03508.1| Flagellar transport protein FliP [delta proteobacterium MLMS-1]
          Length = 252

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 141/201 (70%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+LS+AP +L+M+TCF R I+VFS LR  +G   +PPN V+I LALF+T ++M+P   
Sbjct: 55  VLTVLSMAPAILLMMTCFTRLIVVFSFLRNAIGTQQMPPNQVLIGLALFLTVFIMAPVFS 114

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  +  + P M+ +I    A++  AEP   FM   TREKDL LF+ ++ S          
Sbjct: 115 QINQQAVGPYMDEEIGIEEALRTAAEPLREFMFKQTREKDLELFLGLSQSPRPQ----NK 170

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   +LIP+FMISEL+ +F IGF++ +PFL+IDM+VA+++++MGMMMLPP  I+LPFK
Sbjct: 171 DDVSTFVLIPAFMISELKTAFTIGFILFIPFLVIDMVVASVLLSMGMMMLPPIMIALPFK 230

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L+V +LV+SF
Sbjct: 231 ILLFVLVDGWYLIVGSLVRSF 251


>gi|239826628|ref|YP_002949252.1| flagellar biosynthesis protein FliP [Geobacillus sp. WCH70]
 gi|239806921|gb|ACS23986.1| flagellar biosynthetic protein FliP [Geobacillus sp. WCH70]
          Length = 222

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 154/217 (70%), Gaps = 9/217 (4%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P ++S+S   V+   + T+LSIAP +LIM+TCF R +IV S +RT +G   +PPN V++ 
Sbjct: 13  PENVSMS---VKLLLLLTVLSIAPGILIMMTCFTRIVIVLSFVRTSLGTQQMPPNQVLVG 69

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+TF++M+PT     +  +QPL + +I+   A +R + P   FM  +TR+KDL+LF+
Sbjct: 70  LALFLTFFIMAPTFKEINDQALQPLFSEKISLEQAYERASVPIKEFMSKHTRQKDLALFL 129

Query: 150 DMAHSSHRNTDITKN-DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMA 208
                S+   +  K+   I    L+P+F ISE++ +F++GF+I +PFL+IDMIVA+++M+
Sbjct: 130 -----SYSGAEKPKSVQDIPLTTLVPAFAISEIKTAFQMGFMIFIPFLVIDMIVASVLMS 184

Query: 209 MGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MGMMMLPP  ISLPFK++ FVL+DGW L+V++L++SF
Sbjct: 185 MGMMMLPPVMISLPFKILLFVLVDGWYLVVKSLLESF 221


>gi|150019068|ref|YP_001311322.1| flagellar biosynthetic protein FliP [Clostridium beijerinckii NCIMB
           8052]
 gi|149905533|gb|ABR36366.1| flagellar biosynthetic protein FliP [Clostridium beijerinckii NCIMB
           8052]
          Length = 259

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 152/225 (67%), Gaps = 6/225 (2%)

Query: 22  SLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSV 81
           S  D  + P D   S   ++    FTILS+ P ++IM+T F R ++VFS L++ MG+   
Sbjct: 41  SFGDGNSTPQDYVSS---IKILIFFTILSLLPSIVIMMTSFTRIVVVFSFLKSAMGVQQA 97

Query: 82  PPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTR 141
            PN ++  LA+F+T ++M P  +      IQP + N+IT+  A +  ++P   FM   TR
Sbjct: 98  VPNQILTGLAIFLTLFIMQPVYNEVNTKAIQPYLENKITQDQAFEEASKPLKAFMLKQTR 157

Query: 142 EKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMI 201
           EKDL LF+++      N  +TK +++ +  LIP+F ISEL+ +F+IGFLI LPFL+IDM+
Sbjct: 158 EKDLELFVEIGGVDKEN--LTK-ENVSFTTLIPAFAISELKTAFQIGFLIYLPFLVIDMV 214

Query: 202 VATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           V++++M+MGM MLPPT +SLPFK+I FV++DGW LLV++L++SF+
Sbjct: 215 VSSVLMSMGMFMLPPTMVSLPFKLILFVMVDGWYLLVKSLIQSFM 259


>gi|91785622|ref|YP_560828.1| flagellar biosynthesis protein FliP [Burkholderia xenovorans LB400]
 gi|91689576|gb|ABE32776.1| Flagellar transport protein FliP [Burkholderia xenovorans LB400]
          Length = 279

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/242 (42%), Positives = 156/242 (64%), Gaps = 7/242 (2%)

Query: 8   ALFLVTPELVFAKSSLHDVMNI---PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPR 64
           AL L  P L FA+++     N    P   +  +  V+T  + T+LS  P +++M+T F R
Sbjct: 42  ALMLALPTLSFAQAAGLPAFNTSPGPNGGTTYSLSVQTMLLLTMLSFLPAMVLMMTSFTR 101

Query: 65  FIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTA 124
            IIV S+LR  +G  + PPN V++ LALF+T +VMSP LD++   G +P  +  I   TA
Sbjct: 102 IIIVLSLLRQALGTTTTPPNQVLVGLALFLTLFVMSPVLDKAYTDGYKPFSDGTIPMETA 161

Query: 125 IQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRS 184
           + R   PF  FM   TRE DL+LF  ++H++     +   + +   +L+PSF+ SEL+  
Sbjct: 162 VNRGLAPFKTFMLRQTRESDLALFARISHAA----PMQGPEDVPLSLLVPSFVTSELKTG 217

Query: 185 FEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKS 244
           F+IGF I +PFLIIDM+VA+++M+MGMMM+ P +ISLPFK++ FVL+DGW LL+ +L +S
Sbjct: 218 FQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATISLPFKLMLFVLVDGWQLLLGSLAQS 277

Query: 245 FI 246
           F+
Sbjct: 278 FV 279


>gi|154174223|ref|YP_001408145.1| flagellar biosynthesis protein FliP [Campylobacter curvus 525.92]
 gi|112802855|gb|EAU00199.1| flagellar biosynthetic protein FliP [Campylobacter curvus 525.92]
          Length = 245

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 107/200 (53%), Positives = 140/200 (70%), Gaps = 6/200 (3%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           TIL++AP L+ M+T F R IIVFS LR  MG   VPP+ VIISLA+ +TF++M P   +S
Sbjct: 50  TILTLAPSLVFMMTSFLRLIIVFSFLRQAMGTQQVPPSTVIISLAMVLTFFIMEPIGRQS 109

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN-D 165
            + G++P +  QI      +R  +PF  FM  NTREKDL+LF  +     RN     N D
Sbjct: 110 YDEGVKPYLAEQIGYEEMFERSVKPFKNFMVKNTREKDLALFFRI-----RNLQNPSNID 164

Query: 166 HIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKV 225
            I   I + +FMISEL+ +FEI FL+ LPFL+IDM+V++++MAMGMMMLPP  ISLPFK+
Sbjct: 165 DIPLSIAMSAFMISELKTAFEIAFLLYLPFLVIDMVVSSVLMAMGMMMLPPVMISLPFKL 224

Query: 226 IFFVLIDGWSLLVENLVKSF 245
           + FVL+DGW+LLV NLVKSF
Sbjct: 225 LIFVLVDGWNLLVGNLVKSF 244


>gi|116514991|ref|YP_802620.1| flagellar biosynthesis protein FliP [Buchnera aphidicola str. Cc
           (Cinara cedri)]
 gi|116256845|gb|ABJ90527.1| type III protein export, membrane component [Buchnera aphidicola
           str. Cc (Cinara cedri)]
          Length = 244

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/238 (43%), Positives = 165/238 (69%), Gaps = 6/238 (2%)

Query: 10  FLVTPEL-VFAKSSLHDVMN-IPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFII 67
           FL  P + +F K S + + + IP + ++  + V++  I TI+S  P  ++M+TCF R II
Sbjct: 9   FLFFPSVFLFEKFSNNKICSFIPDEFNLLNFSVKSSAILTIISFLPACILMMTCFTRIII 68

Query: 68  VFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQR 127
           V S+LRT +G+   PPN ++I L+LF+TF++MSPTL++     + PL  ++I    A+++
Sbjct: 69  VLSLLRTALGVPYSPPNQILIGLSLFLTFFIMSPTLNKIYNTALIPLYKHEINTEVALKK 128

Query: 128 VAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEI 187
           + +P  +FM   TR+ D+S+F  +A  S       K D+I + IL+PSF+ISEL+ +F+I
Sbjct: 129 IIKPIHIFMLKQTRKSDISVFWKLAKISFP----MKKDNIPFYILLPSFIISELKTAFQI 184

Query: 188 GFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GF ++LPFLIID+++A+I+M++G+MM+ P++ISLP K+I FVL DGW LLV +L KSF
Sbjct: 185 GFTVLLPFLIIDLVIASILMSLGIMMISPSTISLPLKLILFVLSDGWKLLVVSLAKSF 242


>gi|311279110|ref|YP_003941341.1| flagellar biosynthetic protein FliP [Enterobacter cloacae SCF1]
 gi|308748305|gb|ADO48057.1| flagellar biosynthetic protein FliP [Enterobacter cloacae SCF1]
          Length = 245

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 152/227 (66%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  +++ P      +W   V+T    T L+  P +L+M+T F R IIVF +LR+ +G 
Sbjct: 21  AQLPGLVSQPLPGGGQSWSLPVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRSALGT 80

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ LALF+TF++MSP +D+      QP  +N+IT   AI + A+P   FM  
Sbjct: 81  ASAPPNQVLLGLALFLTFFIMSPVIDKIYTDAYQPFNDNKITLEQAIDKGAQPLREFMLR 140

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+LF  ++HS      I   + +  RIL+P+++ SEL+ +F+IGF I +PFLII
Sbjct: 141 QTREADLALFARLSHSE----PIQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLII 196

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 197 DLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|238927449|ref|ZP_04659209.1| flagellar biosynthesis protein FliP [Selenomonas flueggei ATCC
           43531]
 gi|238884731|gb|EEQ48369.1| flagellar biosynthesis protein FliP [Selenomonas flueggei ATCC
           43531]
          Length = 256

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 151/216 (69%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D++ S  I+    + TI+S+AP +L+M T F R ++V   LR  +   +VPPN V+I+
Sbjct: 47  PQDVATSMQIL---AVLTIMSLAPAILVMTTSFVRIVVVIGFLRNALSTQNVPPNQVVIA 103

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TFY+M+P   ++ E GIQP +  QIT+  A++ + +P   FM   TRE DL+LF+
Sbjct: 104 LSLFLTFYIMAPYWGQANENGIQPYLAGQITQEQALENIVDPMREFMLRQTRESDLALFV 163

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           +++ +   N      + +    LIP+F+ISEL+ +F++GF+I +PF++IDMIVA+ +M+M
Sbjct: 164 NLSDAPRPNGP----EDVSTFTLIPAFIISELKTAFQLGFMIYIPFIVIDMIVASTLMSM 219

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FV++DGW LL+++L+ SF
Sbjct: 220 GMMMLPPVMISLPFKILLFVMVDGWHLLIQSLIMSF 255


>gi|99082784|ref|YP_614938.1| flagellar biosynthesis protein FliP [Ruegeria sp. TM1040]
 gi|99039064|gb|ABF65676.1| Flagellar biosynthetic protein fliP [Ruegeria sp. TM1040]
          Length = 248

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 104/239 (43%), Positives = 153/239 (64%), Gaps = 7/239 (2%)

Query: 7   FALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFI 66
           FAL L  P++  A+      +N+    SIS   ++   + T+LS+AP LL+M+TCFP  I
Sbjct: 14  FAL-LAQPQVALAQ---ELSLNLADGQSISARTIQLILLITVLSVAPGLLVMLTCFPFLI 69

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
            V SILR  +G+   PPN+++ISLA+F+T++VM P    + E GI PL++ ++    A++
Sbjct: 70  TVLSILRQAIGLQQAPPNMLMISLAMFLTYFVMEPVFTEAWETGIAPLIDEELEVVPALE 129

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           R  EPF VFM N           D+       +D +    +   +LIPSFM+SE+ R+FE
Sbjct: 130 RAVEPFRVFMANRLDPDTYYAIADL-RPGTEGSDPSPESPLS--VLIPSFMLSEITRAFE 186

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGFL+ LPFL+ID++ A I+M+MGMMM+PP  +SLPFK+ FFV+ DGWSL+   LV+S+
Sbjct: 187 IGFLVFLPFLVIDLVTAAILMSMGMMMVPPALVSLPFKLAFFVVADGWSLIASALVRSY 245


>gi|56419769|ref|YP_147087.1| flagellar biosynthesis protein FliP [Geobacillus kaustophilus
           HTA426]
 gi|56379611|dbj|BAD75519.1| flagellar biosynthetic protein [Geobacillus kaustophilus HTA426]
          Length = 222

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 146/206 (70%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+   + T+LSIAP +LIM+TCF R +IV S +RT +G   +PPN V++ LALF+TF++M
Sbjct: 20  VKLLLLLTVLSIAPGILIMMTCFTRIVIVLSFVRTALGTQQMPPNQVLVGLALFLTFFIM 79

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT     +  +QPL  ++I    A +R A P   FM   TR++DL+LF+  + +    T
Sbjct: 80  APTWKEINDQALQPLFADKIDLEEAYERAAVPLKQFMSQYTRQEDLALFLSYSGAKQPKT 139

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
               ND I    L+P+F ISEL+ +F++GF+I +PFL+IDMIVA+++M+MGMMMLPP  I
Sbjct: 140 ---IND-IPMTALVPAFAISELKTAFQMGFMIFIPFLVIDMIVASVLMSMGMMMLPPVMI 195

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW L+V++L++SF
Sbjct: 196 SLPFKILLFVLVDGWHLVVKSLLQSF 221


>gi|307731352|ref|YP_003908576.1| flagellar biosynthetic protein FliP [Burkholderia sp. CCGE1003]
 gi|307585887|gb|ADN59285.1| flagellar biosynthetic protein FliP [Burkholderia sp. CCGE1003]
          Length = 277

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/242 (42%), Positives = 155/242 (64%), Gaps = 7/242 (2%)

Query: 8   ALFLVTPELVFAKSSLHDVMNI---PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPR 64
           AL L  P L FA+++     N    P   +  +  V+T  + T+LS  P +++M+T F R
Sbjct: 40  ALMLALPTLSFAQTAGLPAFNTSPGPNGGTTYSLSVQTMLLLTMLSFLPAMVLMMTSFTR 99

Query: 65  FIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTA 124
            IIV S+LR  +G  + PPN V++ LALF+T +VMSP LD++   G +P     +   TA
Sbjct: 100 IIIVLSLLRQALGTTTTPPNQVLVGLALFLTLFVMSPVLDKAYTDGYKPFSEGTVPMETA 159

Query: 125 IQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRS 184
           + R   PF  FM   TRE DL+LF  ++H++     +   + +   +L+PSF+ SEL+  
Sbjct: 160 VSRGLAPFKTFMLRQTRESDLALFARISHAA----PMQGPEDVPLSLLVPSFVTSELKTG 215

Query: 185 FEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKS 244
           F+IGF I +PFLIIDM+VA+++M+MGMMM+ P +ISLPFK++ FVL+DGW LL+ +L +S
Sbjct: 216 FQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATISLPFKLMLFVLVDGWQLLLGSLAQS 275

Query: 245 FI 246
           F+
Sbjct: 276 FV 277


>gi|296330850|ref|ZP_06873325.1| flagellar biosynthesis protein FliP [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|296151855|gb|EFG92729.1| flagellar biosynthesis protein FliP [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
          Length = 221

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 145/206 (70%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+   + T+ S+AP +LI++TCF R +IV S +RT +   S+PPN V+I LALF+TF++M
Sbjct: 20  VKLLLLLTVFSVAPGILILMTCFTRIVIVLSFVRTSLATQSMPPNQVLIGLALFLTFFIM 79

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT     +  + PLM+N+I+   A  +  EP   FM  +TR+KDL+LFM+ A      +
Sbjct: 80  APTFSEINKEALTPLMDNKISLDEAYSKAEEPIKEFMSKHTRQKDLALFMNYAKMDKPES 139

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                  I    ++P+F ISEL+ +F+IGF+I +PFLIIDM+VA+++M+MGMMMLPP  I
Sbjct: 140 ----LKDIPLTTMVPAFAISELKTAFQIGFMIFIPFLIIDMVVASVLMSMGMMMLPPVMI 195

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW L+V++L++SF
Sbjct: 196 SLPFKILLFVLVDGWYLIVKSLLQSF 221


>gi|242238991|ref|YP_002987172.1| flagellar biosynthetic protein FliP [Dickeya dadantii Ech703]
 gi|242131048|gb|ACS85350.1| flagellar biosynthetic protein FliP [Dickeya dadantii Ech703]
          Length = 254

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 104/250 (41%), Positives = 164/250 (65%), Gaps = 13/250 (5%)

Query: 1   MIRYCFFALFLVTPELVFAKSS---LHDVMNIPADLSISTWI--VRTFGIFTILSIAPIL 55
           ++R  FF + +V     FA +S   L  +++ P      +W   V+T  + T L+  P +
Sbjct: 11  LVRRSFFTILIV----FFAPNSWAQLPGIISQPLANGAQSWSLPVQTLVLLTSLTFIPAV 66

Query: 56  LIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLM 115
           L+M+T F R IIV  +LR+ +G  + PPN ++I L+LF+TF++MSP L +  +   QP  
Sbjct: 67  LLMMTSFTRIIIVLGLLRSALGTPTAPPNQILIGLSLFLTFFIMSPVLTKVYQDAYQPFS 126

Query: 116 NNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPS 175
            N+I   TAI+R ++P   FM   TRE DL+LF  +A  S     ++  + +  R+L+P+
Sbjct: 127 ENKINMETAIERGSQPLRQFMLRQTRETDLALFARLAEISA----LSGPEAVPMRVLVPA 182

Query: 176 FMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWS 235
           F+ SEL+ +F+IGF I +PFLIID++VA+++MA+GMMM+PP ++SLPFK++ FVL+DGW 
Sbjct: 183 FVTSELKTAFQIGFTIFIPFLIIDLVVASVLMALGMMMVPPATVSLPFKLMLFVLVDGWQ 242

Query: 236 LLVENLVKSF 245
           LL+ +LV+SF
Sbjct: 243 LLLSSLVQSF 252


>gi|206561840|ref|YP_002232605.1| flagellar biosynthesis protein FliP [Burkholderia cenocepacia
           J2315]
 gi|198037882|emb|CAR53826.1| flagellar biosynthetic protein FliP precursor [Burkholderia
           cenocepacia J2315]
          Length = 253

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 154/237 (64%), Gaps = 7/237 (2%)

Query: 12  VTPELVFAKSSLHDVMNI---PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIV 68
           + P L +A+++     N    P   +  +  V+T  + T+LS  P +L+M+T F R IIV
Sbjct: 20  LAPALAYAQANGLPAFNASPGPHGGTTYSLSVQTMLLLTMLSFLPAMLLMMTSFTRIIIV 79

Query: 69  FSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRV 128
            S+LR  +G  + PPN V++ LA+F+TF+VMSP LDR+   G +P  +  +    A+QR 
Sbjct: 80  LSLLRQALGTATTPPNQVLVGLAMFLTFFVMSPVLDRAYNDGYKPFSDGSMPMEQAVQRG 139

Query: 129 AEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIG 188
             PF  FM   TRE DL+LF  ++ ++     +   D +   +L+P+F+ SEL+  F+IG
Sbjct: 140 VAPFKTFMLKQTRETDLALFAKISKAA----PMQGPDDVPLSLLVPAFVTSELKTGFQIG 195

Query: 189 FLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           F + +PFLIIDM+VA+++M+MGMMM+ P+++SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 196 FTVFIPFLIIDMVVASVLMSMGMMMVSPSTVSLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|83647846|ref|YP_436281.1| flagellar biosynthesis protein FliP [Hahella chejuensis KCTC 2396]
 gi|83635889|gb|ABC31856.1| flagellar biosynthetic protein FliP [Hahella chejuensis KCTC 2396]
          Length = 253

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 101/249 (40%), Positives = 159/249 (63%), Gaps = 9/249 (3%)

Query: 2   IRYCFFALFLVTPELVFAKS-----SLHDVMNIPADLSISTWIVRTFGIFTILSIAPILL 56
           +R  +  LFL+ P + ++       ++  V N P      +  ++   + T L+  P  L
Sbjct: 7   LRLTYLILFLMLPGVAWSAQDAILPAVKLVTN-PDGTQEYSVTLQILALMTALTFIPAFL 65

Query: 57  IMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMN 116
           +M+T F R IIVFSILR  +G+   P N +++ +ALF+TF++M PT  ++ E+ +QP + 
Sbjct: 66  MMMTSFTRIIIVFSILRQALGLQQAPSNQILVGIALFLTFFIMGPTFKQANEVALQPYLA 125

Query: 117 NQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSF 176
            Q+T   A+ + +EPF  FM   TRE DL LF+ +A   ++  +    + + + IL+P+F
Sbjct: 126 EQLTAQEAVAKASEPFREFMLRQTRESDLGLFIRLAGDENKYAN---PEEVPFTILMPAF 182

Query: 177 MISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSL 236
           + SEL+ +F+IGFLI +PFLIIDM+VA+++MAMGMMML P  ISLPFK++ FVL+DGW+L
Sbjct: 183 VTSELKTAFQIGFLIFIPFLIIDMVVASVLMAMGMMMLSPIIISLPFKIMLFVLVDGWAL 242

Query: 237 LVENLVKSF 245
           ++  L  SF
Sbjct: 243 IMGTLAASF 251


>gi|78064698|ref|YP_367467.1| flagellar biosynthesis protein FliP [Burkholderia sp. 383]
 gi|77965443|gb|ABB06823.1| Flagellar transport protein FliP [Burkholderia sp. 383]
          Length = 253

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 157/246 (63%), Gaps = 7/246 (2%)

Query: 3   RYCFFALFLVTPELVFAKSSLHDVMNI---PADLSISTWIVRTFGIFTILSIAPILLIMV 59
           R+    +  + P L FA+++     N    P   +  +  V+T  + T+LS  P +L+M+
Sbjct: 11  RFAPVLILCLAPALAFAQANGLPAFNASPGPHGGTTYSLSVQTMLLLTMLSFLPAMLLMM 70

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R IIV S+LR  +G  + PPN V++ LA+F+TF+VMSP LDR+   G +P  +  +
Sbjct: 71  TSFTRIIIVLSLLRQALGTATTPPNQVLVGLAMFLTFFVMSPVLDRAYNDGYKPFSDGSM 130

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
               A+QR   PF  FM   TRE DL+LF  ++ ++     +   + +   +L+P+F+ S
Sbjct: 131 PMEQAVQRGVAPFKTFMLKQTRETDLALFAKISKAA----PMQGPEDVPLSLLVPAFVTS 186

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+  F+IGF + +PFLIIDM+VA+++M+MGMMM+ P+++SLPFK++ FVL+DGW LL+ 
Sbjct: 187 ELKTGFQIGFTVFIPFLIIDMVVASVLMSMGMMMVSPSTVSLPFKLMLFVLVDGWQLLIG 246

Query: 240 NLVKSF 245
           +L +SF
Sbjct: 247 SLAQSF 252


>gi|42524694|ref|NP_970074.1| flagellar biosynthesis protein FliP [Bdellovibrio bacteriovorus
           HD100]
 gi|39576904|emb|CAE78133.1| flagellar protein required for flagellar formation [Bdellovibrio
           bacteriovorus HD100]
          Length = 252

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+   + T+L++AP +LIM+T F R IIV S LR  MG+  +PPN +++ LALF+TF+VM
Sbjct: 50  VKLIMVMTVLTLAPAILIMMTGFTRIIIVLSFLRQAMGVQQMPPNQLLVGLALFLTFFVM 109

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            P  +     GIQP M   I++  AI+R   P   FM N TR+ DL+LF+ ++      T
Sbjct: 110 QPAFNEMNTNGIQPYMAGTISQDQAIERTFAPLRKFMFNQTRDSDLALFIKLSKVEKPKT 169

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                  +   +L+P+F++SEL+ +F+IGF+I LPFL+ID++ A+++MAMGMMMLPP  I
Sbjct: 170 ----RADVPTMVLVPAFVVSELKTAFQIGFIIFLPFLVIDIVAASVLMAMGMMMLPPVVI 225

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ ++VKSF
Sbjct: 226 SLPFKIMLFVLVDGWGLLIGSMVKSF 251


>gi|259417183|ref|ZP_05741102.1| flagellar biosynthetic protein FliP [Silicibacter sp. TrichCH4B]
 gi|259346089|gb|EEW57903.1| flagellar biosynthetic protein FliP [Silicibacter sp. TrichCH4B]
          Length = 248

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 153/237 (64%), Gaps = 6/237 (2%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIV 68
           + LV P++  A+      +N+    SIS   ++   + T+LS+AP LL+M+TCFP  I V
Sbjct: 15  VLLVQPQVALAQ---ELSLNLADGQSISARTIQLILLITVLSVAPGLLVMLTCFPFLITV 71

Query: 69  FSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRV 128
            SILR  +G+   PPN+++ISLA+F+T++VM P    + + GI PL++ ++    A++R 
Sbjct: 72  LSILRQAIGLQQAPPNMLMISLAMFLTYFVMEPVFTEAWDTGIAPLIDEELEVVPALERA 131

Query: 129 AEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIG 188
            EPF VFM N           D+     + +D +    +   +LIPSFM+SE+ R+FEIG
Sbjct: 132 VEPFRVFMANRLDPDTYYAIADL-RPGTQGSDPSPESPLS--VLIPSFMLSEITRAFEIG 188

Query: 189 FLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FL+ LPFL+ID++ A ++M+MGMMM+PP  +SLPFK+ FFV+ DGWSL+   LV+S+
Sbjct: 189 FLVFLPFLVIDLVTAAVLMSMGMMMVPPALVSLPFKLAFFVVADGWSLIASALVRSY 245


>gi|16078698|ref|NP_389517.1| flagellar biosynthesis protein FliP [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221309513|ref|ZP_03591360.1| flagellar biosynthesis protein FliP [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313837|ref|ZP_03595642.1| flagellar biosynthesis protein FliP [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318760|ref|ZP_03600054.1| flagellar biosynthesis protein FliP [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323032|ref|ZP_03604326.1| flagellar biosynthesis protein FliP [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321315402|ref|YP_004207689.1| flagellar biosynthesis protein FliP [Bacillus subtilis BSn5]
 gi|544315|sp|P35528|FLIP_BACSU RecName: Full=Flagellar biosynthetic protein fliP
 gi|142931|gb|AAA22453.1| flagellar protein [Bacillus subtilis]
 gi|2634007|emb|CAB13508.1| component of the flagellar export machinery [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|291484188|dbj|BAI85263.1| flagellar biosynthesis protein FliP [Bacillus subtilis subsp. natto
           BEST195]
 gi|320021676|gb|ADV96662.1| flagellar biosynthesis protein FliP [Bacillus subtilis BSn5]
          Length = 221

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 145/206 (70%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+   + T+ S+AP +LI++TCF R +IV S +RT +   S+PPN V+I LALF+TF++M
Sbjct: 20  VKLLLLLTVFSVAPGILILMTCFTRIVIVLSFVRTSLATQSMPPNQVLIGLALFLTFFIM 79

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT     +  + PLM+N+I+   A  +  EP   FM  +TR+KDL+LFM+ A      +
Sbjct: 80  APTFSEINKEALTPLMDNKISLDEAYTKAEEPIKEFMSKHTRQKDLALFMNYAKMDKPES 139

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                  I    ++P+F ISEL+ +F+IGF+I +PFLIIDM+VA+++M+MGMMMLPP  I
Sbjct: 140 ----LKDIPLTTMVPAFAISELKTAFQIGFMIFIPFLIIDMVVASVLMSMGMMMLPPVMI 195

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW L+V++L++SF
Sbjct: 196 SLPFKILLFVLVDGWYLIVKSLLQSF 221


>gi|304438440|ref|ZP_07398380.1| flagellar biosynthetic protein FliP [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|304368523|gb|EFM22208.1| flagellar biosynthetic protein FliP [Selenomonas sp. oral taxon 149
           str. 67H29BP]
          Length = 249

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 151/218 (69%), Gaps = 7/218 (3%)

Query: 28  NIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVI 87
           N P D++ S   ++   + T++S+AP + +M T F R ++V   LR  +   +VPPN V+
Sbjct: 38  NNPQDVATS---MQVLAVLTVMSLAPAIFVMTTSFVRIVVVIGFLRNALSTQNVPPNQVV 94

Query: 88  ISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSL 147
           I+L+LF+TFY+M+P   ++ E GIQP +  QIT+  A++ + +P   FM   TRE DL+L
Sbjct: 95  IALSLFLTFYIMAPYWGQANENGIQPYLEGQITQEQALENIVDPMREFMLRQTRESDLAL 154

Query: 148 FMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVM 207
           F++++ +   +      + +    LIP+F+ISEL+ +F+IGF+I +PF++IDMIVA+ +M
Sbjct: 155 FVNLSDAPRPDGP----EDVSTFTLIPAFIISELKTAFQIGFMIYIPFIVIDMIVASTLM 210

Query: 208 AMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +MGMMMLPP  ISLPFK++ FV++DGW LL+++L+ SF
Sbjct: 211 SMGMMMLPPVMISLPFKILLFVMVDGWHLLIQSLIMSF 248


>gi|261419434|ref|YP_003253116.1| flagellar biosynthesis protein FliP [Geobacillus sp. Y412MC61]
 gi|297530591|ref|YP_003671866.1| flagellar biosynthetic protein FliP [Geobacillus sp. C56-T3]
 gi|319766249|ref|YP_004131750.1| flagellar biosynthetic protein FliP [Geobacillus sp. Y412MC52]
 gi|261375891|gb|ACX78634.1| flagellar biosynthetic protein FliP [Geobacillus sp. Y412MC61]
 gi|297253843|gb|ADI27289.1| flagellar biosynthetic protein FliP [Geobacillus sp. C56-T3]
 gi|317111115|gb|ADU93607.1| flagellar biosynthetic protein FliP [Geobacillus sp. Y412MC52]
          Length = 222

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 146/206 (70%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+   + T+LSIAP +LIM+TCF R +IV S +RT +G   +PPN V++ LALF+TF++M
Sbjct: 20  VKLLLLLTVLSIAPGILIMMTCFTRIVIVLSFVRTALGTQQMPPNQVLVGLALFLTFFIM 79

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT     +  +QPL  ++I    A +R A P   FM   TR++DL+LF+  + +    T
Sbjct: 80  APTWKDINDQALQPLFADKIDLEEAYERAAVPLKQFMSQYTRQEDLALFLSYSGAKQPKT 139

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
               ND I    L+P+F ISEL+ +F++GF+I +PFL+IDMIVA+++M+MGMMMLPP  I
Sbjct: 140 ---IND-IPMTALVPAFAISELKTAFQMGFMIFIPFLVIDMIVASVLMSMGMMMLPPVMI 195

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW L+V++L++SF
Sbjct: 196 SLPFKILLFVLVDGWHLVVKSLLQSF 221


>gi|187925750|ref|YP_001897392.1| flagellar biosynthesis protein FliP [Burkholderia phytofirmans
           PsJN]
 gi|187716944|gb|ACD18168.1| flagellar biosynthetic protein FliP [Burkholderia phytofirmans
           PsJN]
          Length = 277

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 153/236 (64%), Gaps = 7/236 (2%)

Query: 14  PELVFAKSSLHDVMNI---PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFS 70
           P L FA+++     N    P   +  +  V+T  + T+LS  P +L+M+T F R IIV S
Sbjct: 46  PTLSFAQAAGLPAFNTSPGPNGGTTYSLSVQTMLLLTMLSFLPAMLLMMTSFTRIIIVLS 105

Query: 71  ILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAE 130
           +LR  +G  + PPN V++ LALF+T +VMSP LD++   G +P  +  I   TA+ R   
Sbjct: 106 LLRQALGTSTTPPNQVLVGLALFLTLFVMSPVLDKAYTDGYKPFSDGTIPMETAVNRGLA 165

Query: 131 PFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFL 190
           PF  FM   TRE DL+LF  ++H++     +   + +   +L+PSF+ SEL+  F+IGF 
Sbjct: 166 PFKTFMLRQTRESDLALFARISHAA----PMQGPEDVPLSLLVPSFVTSELKTGFQIGFT 221

Query: 191 IILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           I +PFLIIDM+VA+++M+MGMMM+ P +ISLPFK++ FVL+DGW LL+ +L +SF+
Sbjct: 222 IFIPFLIIDMVVASVLMSMGMMMVSPATISLPFKLMLFVLVDGWQLLLGSLAQSFV 277


>gi|253702494|ref|YP_003023683.1| flagellar biosynthesis protein FliP [Geobacter sp. M21]
 gi|251777344|gb|ACT19925.1| flagellar biosynthetic protein FliP [Geobacter sp. M21]
          Length = 247

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 149/216 (68%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           PAD+S+   +++ F + T++S+AP LL+M T F R ++V S LR+ +G    P N ++I 
Sbjct: 38  PADVSV---VLQIFFLMTVISLAPSLLMMTTSFTRIVVVLSFLRSALGTQQAPSNQIVIG 94

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TF++M+P   +     +QP   +QIT+  A++R   P   FM +  REKDL+LF+
Sbjct: 95  LSLFLTFFIMAPVWQQVNANALQPYRASQITQEEAVKRGVAPLRKFMLSQVREKDLALFI 154

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           +++            D I    LIP++M+SEL+ +F+IGFLI +PFL++DM+VA+++M+M
Sbjct: 155 NLSKLPRPK----NADDIPTLTLIPAYMVSELKTAFQIGFLIFIPFLVLDMVVASVLMSM 210

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FVL+DGW L++ +LVKSF
Sbjct: 211 GMMMLPPVMISLPFKILLFVLVDGWGLVIGSLVKSF 246


>gi|315453643|ref|YP_004073913.1| flagellar biosynthesis protein [Helicobacter felis ATCC 49179]
 gi|315132695|emb|CBY83323.1| flagellar biosynthesis protein [Helicobacter felis ATCC 49179]
          Length = 252

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 142/195 (72%), Gaps = 6/195 (3%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP L++ +T F R I+VFS LRT +G    PP  +++SLAL +TF++M PT  +S ++ I
Sbjct: 59  APSLVLTMTSFIRLIVVFSFLRTALGTQQTPPTQILVSLALILTFFIMEPTAKKSYKIAI 118

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN-DHIEYR 170
           +P +  +I+ T A +R   PF  FM  NTREKDL+LF  +     RN +  K+ + +   
Sbjct: 119 KPYLAEKISYTQAFERGVVPFKEFMLKNTREKDLALFFRI-----RNLENPKDVNSVPLS 173

Query: 171 ILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVL 230
           +L+P+FMISEL+ +F+IGFL+ LPFL+IDM+V++I+MAMGMMMLPP  ISLPFK++ F+L
Sbjct: 174 VLVPAFMISELKTAFQIGFLLYLPFLVIDMVVSSILMAMGMMMLPPVMISLPFKILVFIL 233

Query: 231 IDGWSLLVENLVKSF 245
           +DG++LL+ENLV SF
Sbjct: 234 VDGFNLLIENLVASF 248


>gi|255322335|ref|ZP_05363481.1| flagellar biosynthetic protein FliP [Campylobacter showae RM3277]
 gi|255300708|gb|EET79979.1| flagellar biosynthetic protein FliP [Campylobacter showae RM3277]
          Length = 246

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 141/195 (72%), Gaps = 6/195 (3%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP L+ M+T F R IIVFS LR  MG   +PP+ V+ISLA+ +TF++M P   ++ E G+
Sbjct: 56  APSLVFMMTSFLRLIIVFSFLRQAMGTQQMPPSTVLISLAMVLTFFIMEPVGKQAYEAGV 115

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN-DHIEYR 170
           QP ++ QI    A +R  +PF  FM  NTREKDL+LF+ +     RN    ++ D I   
Sbjct: 116 QPYLSEQIGYQEAFERGVKPFREFMIKNTREKDLALFLRI-----RNMPNPQSFDDIPLT 170

Query: 171 ILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVL 230
           +++ +FMISE++ +FEI FL+ LPFL+IDM+V++++MAMGMMMLPPT ISLPFK++ FVL
Sbjct: 171 VVMSAFMISEMKTAFEIAFLLYLPFLVIDMVVSSVLMAMGMMMLPPTMISLPFKLLIFVL 230

Query: 231 IDGWSLLVENLVKSF 245
           +DGW+LLV NLVKSF
Sbjct: 231 VDGWNLLVMNLVKSF 245


>gi|92114088|ref|YP_574016.1| flagellar biosynthesis protein FliP [Chromohalobacter salexigens
           DSM 3043]
 gi|91797178|gb|ABE59317.1| flagellar biosynthetic protein FliP [Chromohalobacter salexigens
           DSM 3043]
          Length = 249

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 105/247 (42%), Positives = 158/247 (63%), Gaps = 7/247 (2%)

Query: 1   MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIM 58
           M+R     L L  P   + +  +  +++ P       W +  +T    + L+  P LL+ 
Sbjct: 6   MLRCGLAVLLLAWPAFGWGQE-ISGIVSEPTGDGGQQWSLSLQTLLFLSSLAFLPALLLG 64

Query: 59  VTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQ 118
           +TCF R IIV S+LRT +G  S PPN V++ LALFMTF++MSP LDR  E    P    +
Sbjct: 65  MTCFTRIIIVLSLLRTAIGTQSTPPNQVLLGLALFMTFFIMSPVLDRVHEQAWVPFSEER 124

Query: 119 ITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMI 178
           I+   A+++ ++PF  FM   TRE DL+LF  MA +     ++   + +  R+LIP+F+ 
Sbjct: 125 ISLEQALEQGSQPFREFMFGQTRETDLALFARMADAD----EMQGPEDVPMRLLIPAFLT 180

Query: 179 SELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLV 238
           SEL+ +F+IGF I +PFLIID++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+
Sbjct: 181 SELKTAFQIGFSIFIPFLIIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLI 240

Query: 239 ENLVKSF 245
            +L +SF
Sbjct: 241 GSLAESF 247


>gi|311068157|ref|YP_003973080.1| flagellar biosynthesis protein FliP [Bacillus atrophaeus 1942]
 gi|310868674|gb|ADP32149.1| flagellar biosynthesis protein FliP [Bacillus atrophaeus 1942]
          Length = 221

 Score =  198 bits (504), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 145/206 (70%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+   + T+ S+AP +LI++TCF R +IV S +RT +   S+PPN V+I LALF+TF++M
Sbjct: 20  VKLLLLLTVFSVAPGILILMTCFTRIVIVLSFVRTSLATQSMPPNQVLIGLALFLTFFIM 79

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT     +  + PLM+N+I+   A  +  EP   FM  +TR+KDL+LFM+ A      +
Sbjct: 80  APTFSDINKEALTPLMDNKISLDEAYTKAEEPIKEFMSKHTRQKDLALFMNYAKMDKPES 139

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                  I    ++P+F ISEL+ +F+IGF+I +PFLIIDM+VA+++M+MGMMMLPP  I
Sbjct: 140 ----LKDIPLTTMVPAFAISELKTAFQIGFMIFIPFLIIDMVVASVLMSMGMMMLPPVMI 195

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW L+V++L++SF
Sbjct: 196 SLPFKILLFVLVDGWYLIVKSLLQSF 221


>gi|197120185|ref|YP_002140612.1| flagellar biosynthesis protein FliP [Geobacter bemidjiensis Bem]
 gi|197089545|gb|ACH40816.1| flagellar biogenesis protein FliP [Geobacter bemidjiensis Bem]
          Length = 247

 Score =  198 bits (504), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 95/216 (43%), Positives = 149/216 (68%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           PAD+S+   +++ F + T++S+AP LL+M T F R ++V S LR+ +G    P N +++ 
Sbjct: 38  PADVSV---VLQIFFLMTVISLAPSLLMMTTSFTRIVVVLSFLRSALGTQQAPSNQIVVG 94

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TF++M+P   +     +QP   +QIT+  A++R   P   FM +  REKDL+LF+
Sbjct: 95  LSLFLTFFIMAPVWQQVNANALQPYRASQITQEEAVKRGVAPLRKFMLSQVREKDLALFI 154

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           +++            D I    LIP++M+SEL+ +F+IGFLI +PFL++DM+VA+++M+M
Sbjct: 155 NLSKLPRPK----NADDIPTLTLIPAYMVSELKTAFQIGFLIFIPFLVLDMVVASVLMSM 210

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FVL+DGW L++ +LVKSF
Sbjct: 211 GMMMLPPVMISLPFKILLFVLVDGWGLVIGSLVKSF 246


>gi|332284032|ref|YP_004415943.1| flagellar biosynthesis protein FliP [Pusillimonas sp. T7-7]
 gi|330427985|gb|AEC19319.1| flagellar biosynthesis protein FliP [Pusillimonas sp. T7-7]
          Length = 257

 Score =  198 bits (504), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 153/234 (65%), Gaps = 6/234 (2%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSI 71
           P +  A+++L  + +        TW   ++T  + T++S  P +L+M+T F R IIV  +
Sbjct: 26  PAMGLAQTTLPALTSAVNPDGSQTWSLSIQTLVLLTMMSFLPAMLMMMTGFTRIIIVLGL 85

Query: 72  LRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEP 131
           LR  MG G+ PPN ++I LALF+TF+ MSP  D+      QPL N  I    A++R  +P
Sbjct: 86  LRNAMGTGASPPNSILIGLALFLTFFAMSPVFDQIYADAYQPLSNGVIAFEEALERGIKP 145

Query: 132 FWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLI 191
              FM + TRE DL++F +MA+ +   T     + +  R+L+P+FM SEL+ +F+IGF I
Sbjct: 146 LHSFMLHQTREADLTMFANMANVAELQTA----EEVPLRVLVPAFMASELKTAFQIGFTI 201

Query: 192 ILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
            +PFLIID++VA+++MA+GMMM+PP +ISLPFK++ FVL DGW LL+ +L +SF
Sbjct: 202 FIPFLIIDLVVASVLMALGMMMVPPVTISLPFKLMLFVLADGWHLLLGSLARSF 255


>gi|194014385|ref|ZP_03053002.1| flagellar biosynthetic protein FliP [Bacillus pumilus ATCC 7061]
 gi|194013411|gb|EDW22976.1| flagellar biosynthetic protein FliP [Bacillus pumilus ATCC 7061]
          Length = 221

 Score =  198 bits (504), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 153/222 (68%), Gaps = 7/222 (3%)

Query: 25  DVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPN 84
           D+ N     +IST  VR   + T+ S+AP +LI++TCF R +IV S +RT +   S+PPN
Sbjct: 6   DLFNSSGAGNISTS-VRLLLLLTVFSVAPGILILMTCFTRIVIVLSFVRTSLATNSMPPN 64

Query: 85  LVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKD 144
            V++ LALF+TF++M+PT     +  + PL+N+ IT   A ++   P   FM  +TR+KD
Sbjct: 65  QVLVGLALFLTFFIMAPTFSEINKEALTPLLNDDITLNQAYEKAEVPIKEFMSKHTRQKD 124

Query: 145 LSLFMDMAHSSHRNTDITKN-DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVA 203
           L+LF+     S+   D  ++   I    ++P+F ISEL+ +F+IGF+I +PFLIIDM+VA
Sbjct: 125 LALFL-----SYAKIDTPESIKDIPLTAMVPAFAISELKTAFQIGFMIFIPFLIIDMVVA 179

Query: 204 TIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +++M+MGMMMLPP  ISLPFK++ FVL+DGW L+V++L++SF
Sbjct: 180 SVLMSMGMMMLPPVMISLPFKILLFVLVDGWYLIVKSLLQSF 221


>gi|170694404|ref|ZP_02885558.1| flagellar biosynthetic protein FliP [Burkholderia graminis C4D1M]
 gi|170140827|gb|EDT09001.1| flagellar biosynthetic protein FliP [Burkholderia graminis C4D1M]
          Length = 284

 Score =  198 bits (504), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 155/242 (64%), Gaps = 7/242 (2%)

Query: 8   ALFLVTPELVFAKSSLHDVMNI---PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPR 64
           A+ L  P L FA+++     N    P   +  +  V+T  + T+LS  P +++M+T F R
Sbjct: 47  AIMLALPTLSFAQTAGLPAFNTSPGPNGGTTYSLSVQTMLLLTMLSFLPAMVLMMTSFTR 106

Query: 65  FIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTA 124
            IIV S+LR  +G  + PPN V++ LALF+T +VMSP LD++   G +P     +   TA
Sbjct: 107 IIIVLSLLRQALGTTTTPPNQVLVGLALFLTLFVMSPVLDKAYTDGYKPFSEGTVPMETA 166

Query: 125 IQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRS 184
           + R   PF  FM   TRE DL+LF  ++H++     +   + +   +L+PSF+ SEL+  
Sbjct: 167 VSRGLAPFKTFMLRQTRESDLALFARISHAA----PMQGPEDVPLSLLVPSFVTSELKTG 222

Query: 185 FEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKS 244
           F+IGF I +PFLIIDM+VA+++M+MGMMM+ P +ISLPFK++ FVL+DGW LL+ +L +S
Sbjct: 223 FQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATISLPFKLMLFVLVDGWQLLLGSLAQS 282

Query: 245 FI 246
           F+
Sbjct: 283 FV 284


>gi|322421721|ref|YP_004200944.1| flagellar biosynthetic protein FliP [Geobacter sp. M18]
 gi|320128108|gb|ADW15668.1| flagellar biosynthetic protein FliP [Geobacter sp. M18]
          Length = 252

 Score =  198 bits (504), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 150/217 (69%), Gaps = 9/217 (4%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           PAD+S+   +++ F + T++S+AP LL+M T F R ++V S LR+ +G    P N +++ 
Sbjct: 43  PADVSV---VLQIFFVMTVISLAPSLLMMTTSFTRIVVVLSFLRSALGTQQAPSNQIVVG 99

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TF++M+P   +     +QP   N IT+  A++R   P   FM +  REKDL+LF+
Sbjct: 100 LSLFLTFFIMAPVWQQVNTQALQPYKANTITQEEALKRGVAPLRKFMLSQVREKDLALFI 159

Query: 150 DMAHSSHRNTDITKN-DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMA 208
           +++          KN D I    LIP++M+SEL+ +F+IGFL+ +PFL++DM+VA+++M+
Sbjct: 160 NLSKLPR-----PKNADDIPTMTLIPAYMVSELKTAFQIGFLVFIPFLVLDMVVASVLMS 214

Query: 209 MGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MGMMMLPP  ISLPFK++ FVL+DGW L++ +LVKSF
Sbjct: 215 MGMMMLPPVMISLPFKILLFVLVDGWGLVIGSLVKSF 251


>gi|302384102|ref|YP_003819925.1| flagellar biosynthetic protein FliP [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302194730|gb|ADL02302.1| flagellar biosynthetic protein FliP [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 325

 Score =  198 bits (503), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 151/219 (68%), Gaps = 4/219 (1%)

Query: 27  MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLV 86
           +++     ++  +V+  G+ T+LS+AP ++IM T F R I+V S+LRT +GM   PPN V
Sbjct: 104 LDLGTGAGLTERVVQLVGLMTVLSLAPSIVIMTTSFVRIIVVLSLLRTALGMQQSPPNAV 163

Query: 87  IISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLS 146
           ++SLALF++  VM+PT   + + GI+PLM+ Q+    A    +EP   FM     + DL+
Sbjct: 164 LVSLALFLSAIVMAPTWQDAYDSGIRPLMDQQMELPQAFDLASEPVKTFMLAQVDQGDLA 223

Query: 147 LFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIV 206
           LF  ++    R    T+   +  R++ P+FMISEL+++FEIGFL+ +PFL+ID++VA+++
Sbjct: 224 LFTRLS----RIEAPTQTVDLPLRVVTPAFMISELKKAFEIGFLLFVPFLVIDLVVASVL 279

Query: 207 MAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           M+MGMMMLPP  ISLPFK+IFFVL+DGW L+  +LV+SF
Sbjct: 280 MSMGMMMLPPVVISLPFKLIFFVLVDGWRLVAGSLVESF 318


>gi|118581840|ref|YP_903090.1| flagellar biosynthesis protein FliP [Pelobacter propionicus DSM
           2379]
 gi|118504550|gb|ABL01033.1| flagellar biosynthetic protein FliP [Pelobacter propionicus DSM
           2379]
          Length = 257

 Score =  198 bits (503), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 104/210 (49%), Positives = 144/210 (68%), Gaps = 6/210 (2%)

Query: 37  TWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTF 96
           T  ++ F + TILS+AP LLIM T F R ++V S LRT MG    P N VI+ L++F+TF
Sbjct: 52  TTTIQIFFLLTILSLAPGLLIMTTAFTRIVVVLSFLRTAMGTQGAPSNQVILGLSMFLTF 111

Query: 97  YVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSH 156
           ++MSP   +      QP    QI++T AI R   P   FM + TREKDL+LF+ ++    
Sbjct: 112 FIMSPVWQQINNEAYQPWKAQQISQTIAIDRAIMPVRRFMLSQTREKDLALFVSLS---- 167

Query: 157 RNTDITKN-DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLP 215
            N    KN + I    +IP+FMISELR +F+IGFLI +PF+++DM+VA+++M+MGMMMLP
Sbjct: 168 -NLPRPKNANDIPTLTIIPAFMISELRTAFQIGFLIYIPFIVVDMVVASVLMSMGMMMLP 226

Query: 216 PTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           P  ISLPFK++ FVL+DGW L++ +LVKSF
Sbjct: 227 PVMISLPFKILLFVLVDGWGLVISSLVKSF 256


>gi|77918770|ref|YP_356585.1| flagellar biosynthesis protein FliP [Pelobacter carbinolicus DSM
           2380]
 gi|77544853|gb|ABA88415.1| flagellar biosynthetic protein FliP [Pelobacter carbinolicus DSM
           2380]
          Length = 248

 Score =  198 bits (503), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 141/201 (70%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T+LS+AP +L+M T F R  +V S LR  MG   +PPN VII L+LF+TF+VMSP  +
Sbjct: 49  IMTVLSVAPAILLMTTAFIRLAVVLSFLRQAMGTQQMPPNQVIIGLSLFLTFFVMSPVFN 108

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  +  +QP +  +I +  A+    EP   FM + T E +LSL M++  S H   D    
Sbjct: 109 QINDQAVQPYLTQKIDQKQALTLAVEPMRQFMFSQTTESELSLLMEI--SGH--PDPAGK 164

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           + +    LIP+FM+SEL+R+F+IGF+I +PFL+IDMIVA+++M+MGMMMLPP  ISLPFK
Sbjct: 165 EDVPTLTLIPAFMLSELKRAFQIGFMIYIPFLVIDMIVASVLMSMGMMMLPPIIISLPFK 224

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L+V +LV+SF
Sbjct: 225 LLLFVLVDGWTLIVGSLVQSF 245


>gi|313673292|ref|YP_004051403.1| flagellar biosynthetic protein flip [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312940048|gb|ADR19240.1| flagellar biosynthetic protein FliP [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 244

 Score =  198 bits (503), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 150/217 (69%), Gaps = 7/217 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D++++  I+    + TILSIAP +LIM+T F R IIVFS LR+ MG    PPN V+I 
Sbjct: 35  PKDVAVTLQIIF---LITILSIAPAILIMMTSFTRIIIVFSFLRSAMGTQQTPPNQVLIG 91

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+TF++MSP      +  + P ++ +I  T A++   +P   FM  NTR+KD+  F+
Sbjct: 92  LALFLTFFIMSPVFSEMNKNALAPYLDGKIAFTDALKEAKKPLRKFMLENTRKKDIMTFL 151

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            ++ S    T     D I   +L+P+F+ SEL+ +FEIGFL+ LPFLIID +V++++++M
Sbjct: 152 QVSKSPMPKT----VDDIPDMVLLPAFVTSELQTAFEIGFLLFLPFLIIDFVVSSVLLSM 207

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           GMMMLPP  IS+PFK++ FVL+DGW+L+V +LVKSF+
Sbjct: 208 GMMMLPPVMISMPFKILLFVLVDGWNLIVMSLVKSFM 244


>gi|157692315|ref|YP_001486777.1| flagellar biosynthesis protein FliP [Bacillus pumilus SAFR-032]
 gi|157681073|gb|ABV62217.1| flagellar biosynthesis protein FliP [Bacillus pumilus SAFR-032]
          Length = 221

 Score =  198 bits (503), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 153/222 (68%), Gaps = 7/222 (3%)

Query: 25  DVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPN 84
           D+ N     +IST  VR   + T+ S+AP +LI++TCF R +IV S +RT +   S+PPN
Sbjct: 6   DLFNSSGAGNISTS-VRLLLLLTVFSVAPGILILMTCFTRIVIVLSFVRTSLATNSMPPN 64

Query: 85  LVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKD 144
            V++ LALF+TF++M+PT     +  + PL+N+ IT   A ++   P   FM  +TR+KD
Sbjct: 65  QVLVGLALFLTFFIMAPTFSEINKEALTPLLNDDITLNQAYEKAEVPIKEFMSKHTRQKD 124

Query: 145 LSLFMDMAHSSHRNTDITKN-DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVA 203
           L+LF+     S+   D  ++   I    ++P+F ISEL+ +F+IGF+I +PFLIIDM+VA
Sbjct: 125 LALFL-----SYAKMDTPESIKDIPLTAMVPAFAISELKTAFQIGFMIFIPFLIIDMVVA 179

Query: 204 TIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +++M+MGMMMLPP  ISLPFK++ FVL+DGW L+V++L++SF
Sbjct: 180 SVLMSMGMMMLPPVMISLPFKILLFVLVDGWYLIVKSLLQSF 221


>gi|56695119|ref|YP_165466.1| flagellar biosynthesis protein FliP [Ruegeria pomeroyi DSS-3]
 gi|56676856|gb|AAV93522.1| flagellar biosynthetic protein FliP [Ruegeria pomeroyi DSS-3]
          Length = 247

 Score =  198 bits (503), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 98/240 (40%), Positives = 153/240 (63%), Gaps = 4/240 (1%)

Query: 8   ALFLVTPELVFAKSSLHDV-MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFI 66
           A+ L+T  ++    +  D+ +++    S+S   ++   + T+LS+AP L IM+TCFP  +
Sbjct: 10  AITLLTGAMLAGPVAAQDISLSLGEGGSVSARTIQLILLITVLSLAPGLAIMITCFPFLV 69

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
            V +ILR G+G+   PPN++I+SLALF+T++VM P    +   GI P+M  ++    A++
Sbjct: 70  TVLAILRQGIGLQQSPPNMLIVSLALFLTYFVMEPVFTEAWTTGIAPMMAEELALEPALE 129

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           +   PF  FM       D   F  MA+       +T        +L+PSFM+SE+ R+F+
Sbjct: 130 KAIAPFKAFMAARL---DADTFFAMANLRPDGAALTATPEAPLSVLVPSFMLSEIARAFQ 186

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           IGFL+ LPFLIID++VA ++M+MGMMM+PP ++SLPFK+ FFVL DGWSL+   LV+S++
Sbjct: 187 IGFLVFLPFLIIDLVVAAVLMSMGMMMVPPATVSLPFKLAFFVLADGWSLIASALVRSYM 246


>gi|254433683|ref|ZP_05047191.1| flagellar biosynthetic protein FliP [Nitrosococcus oceani AFC27]
 gi|207090016|gb|EDZ67287.1| flagellar biosynthetic protein FliP [Nitrosococcus oceani AFC27]
          Length = 243

 Score =  198 bits (503), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 145/209 (69%), Gaps = 4/209 (1%)

Query: 37  TWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTF 96
           T  ++  G+ T+L++ P  ++++T F R I+VFSILR  +G+   P + ++I LALF+TF
Sbjct: 35  TVTLQILGLMTVLTLLPAAVMVMTSFTRIIVVFSILRQALGLAQTPSSQILIGLALFLTF 94

Query: 97  YVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSH 156
           ++MSP LD++ + G++P    +I+ T A+ RV EPF  FM   TRE DL LF   A  S 
Sbjct: 95  FIMSPVLDKAYQEGVKPYFQEEISVTDALARVREPFHHFMIAQTRETDLKLF---AEISG 151

Query: 157 RNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPP 216
           R       + + + +L+P+F+ SEL+ +F+IGFL+ +PFLIID++VA+++MAMGMMML P
Sbjct: 152 REA-FESPEQVPFSLLVPAFITSELKTAFQIGFLLFIPFLIIDLVVASVLMAMGMMMLSP 210

Query: 217 TSISLPFKVIFFVLIDGWSLLVENLVKSF 245
             +SLPFK++ FVLIDGWSLL+  L  SF
Sbjct: 211 MLVSLPFKLLLFVLIDGWSLLMGTLASSF 239


>gi|291280091|ref|YP_003496926.1| flagellar transport protein FliP [Deferribacter desulfuricans SSM1]
 gi|290754793|dbj|BAI81170.1| flagellar transport protein FliP [Deferribacter desulfuricans SSM1]
          Length = 246

 Score =  197 bits (502), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 97/199 (48%), Positives = 141/199 (70%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           TIL++AP +L+MVT F R IIVFS LR+ +G    PPN V+I LALF+TF++MSP L+  
Sbjct: 51  TILTLAPAILLMVTSFTRLIIVFSFLRSALGTQQSPPNQVLIGLALFLTFFIMSPVLNDM 110

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            +  +QP M+ ++  T A+    +P   F+  NTR+K+L  F++++      T     D 
Sbjct: 111 YKNAVQPYMDGKLNFTQALVEAKKPLRKFLLKNTRKKELLTFIEISKVQRPKTP----DD 166

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           I   +LIP+F+ SEL+ +FEIGFL+ LPFL+ID +VA+++++MGMMMLPP  ISLPFK++
Sbjct: 167 IPDSVLIPAFITSELQTAFEIGFLLFLPFLVIDFVVASVLLSMGMMMLPPVMISLPFKIL 226

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW L+V ++VKSF
Sbjct: 227 LFVLVDGWGLIVGSMVKSF 245


>gi|288553049|ref|YP_003424984.1| flagellar biosynthesis protein FliP [Bacillus pseudofirmus OF4]
 gi|288544209|gb|ADC48092.1| flagellar biosynthesis protein FliP [Bacillus pseudofirmus OF4]
          Length = 234

 Score =  197 bits (502), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 141/201 (70%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+LS+AP +LI++T F R +IV S +R G+   S+PPN V+I LALF+TF++M+P   
Sbjct: 37  VLTVLSLAPGILILMTSFTRIVIVLSFVRQGLATQSMPPNQVLIGLALFLTFFIMAPIFA 96

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
              E  + P +  ++T+  A+++ A P   FM  +TREKDL+LFM  A      +     
Sbjct: 97  EVNEQALTPFLEGELTQEEALEQAAVPMKEFMAQHTREKDLALFMGYAGMDRPES----L 152

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D I    LIP+F ISEL+ +F+IGFLI +PFL+IDMIVA+++M+MGMMMLPP  I+LPFK
Sbjct: 153 DDIPLTALIPAFAISELKTAFQIGFLIFVPFLVIDMIVASVLMSMGMMMLPPVMIALPFK 212

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L+V++L+ SF
Sbjct: 213 ILLFVLVDGWYLIVQSLLLSF 233


>gi|32266191|ref|NP_860223.1| flagellar biosynthesis protein FliP [Helicobacter hepaticus ATCC
           51449]
 gi|32262241|gb|AAP77289.1| flagellar basal body protein FliP [Helicobacter hepaticus ATCC
           51449]
          Length = 265

 Score =  197 bits (502), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 159/242 (65%), Gaps = 19/242 (7%)

Query: 19  AKSSLHDVMNIP-------ADLSIS-----TWIVRTFGI---FTILSIAPILLIMVTCFP 63
           A SS+  V +IP        DLS++     T +V T  I    T+L IAP L++++T F 
Sbjct: 27  APSSIPSVPSIPNNPILPSVDLSLTAPKEPTELVATLNIVLIITLLVIAPSLVLVMTSFT 86

Query: 64  RFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETT 123
           R +IVF+ LRT +G    PP  V++SLAL +TF++M P   +S E+GI+P    +I+   
Sbjct: 87  RIVIVFAFLRTALGTQQSPPTQVLVSLALILTFFIMEPVATKSYEVGIKPYAEKKISYDE 146

Query: 124 AIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRR 183
           A +R   PF  FM  NTREKDL+LF  +    +  +    ND +   +L+P+FMISEL+ 
Sbjct: 147 AFERAIVPFKDFMIKNTREKDLALFFRIRQLENPQS---VND-VPLTVLLPAFMISELKT 202

Query: 184 SFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVK 243
           +F IGFL+ LPFL+IDM++++++MAMGMMMLPP  ISLPFK++ F+L+DGW+LL+ NLV+
Sbjct: 203 AFWIGFLLYLPFLVIDMVISSVLMAMGMMMLPPVMISLPFKILVFILVDGWNLLIGNLVQ 262

Query: 244 SF 245
            F
Sbjct: 263 GF 264


>gi|77165627|ref|YP_344152.1| flagellar biosynthesis protein FliP [Nitrosococcus oceani ATCC
           19707]
 gi|76883941|gb|ABA58622.1| Flagellar transport protein FliP [Nitrosococcus oceani ATCC 19707]
          Length = 262

 Score =  197 bits (502), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 145/209 (69%), Gaps = 4/209 (1%)

Query: 37  TWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTF 96
           T  ++  G+ T+L++ P  ++++T F R I+VFSILR  +G+   P + ++I LALF+TF
Sbjct: 54  TVTLQILGLMTVLTLLPAAVMVMTSFTRIIVVFSILRQALGLAQTPSSQILIGLALFLTF 113

Query: 97  YVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSH 156
           ++MSP LD++ + G++P    +I+ T A+ RV EPF  FM   TRE DL LF   A  S 
Sbjct: 114 FIMSPVLDKAYQEGVKPYFQEEISVTDALARVREPFHHFMIAQTRETDLKLF---AEISG 170

Query: 157 RNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPP 216
           R       + + + +L+P+F+ SEL+ +F+IGFL+ +PFLIID++VA+++MAMGMMML P
Sbjct: 171 REA-FESPEQVPFSLLVPAFITSELKTAFQIGFLLFIPFLIIDLVVASVLMAMGMMMLSP 229

Query: 217 TSISLPFKVIFFVLIDGWSLLVENLVKSF 245
             +SLPFK++ FVLIDGWSLL+  L  SF
Sbjct: 230 MLVSLPFKLLLFVLIDGWSLLMGTLASSF 258


>gi|118474799|ref|YP_891929.1| flagellar biosynthesis protein FliP [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118414025|gb|ABK82445.1| flagellar biosynthetic protein FliP [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 244

 Score =  197 bits (502), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 102/201 (50%), Positives = 140/201 (69%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+L++AP L+ ++T F R IIVFS LR  MG   +PP  V+ISLAL +TF++M P   
Sbjct: 47  VLTLLALAPSLIFVMTSFLRLIIVFSFLRQAMGTQQMPPTNVLISLALILTFFIMEPVAK 106

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +S   GI+P +  +I    A    A+PF  FM  NTREKDL+LF  +    + NT     
Sbjct: 107 QSYNEGIKPYLEEKIGYQDAFALGAKPFKEFMVRNTREKDLALFYRIRALPNPNTV---- 162

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D I + I  P+F+ISEL+ +FEIGFL+ LPFL+IDM+V++++M+MGMMMLPP  ISLPFK
Sbjct: 163 DDIPFTIAAPAFIISELKTAFEIGFLLYLPFLVIDMVVSSVLMSMGMMMLPPVMISLPFK 222

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+LL+ NLV SF
Sbjct: 223 LLIFVLVDGWNLLIGNLVASF 243


>gi|238796941|ref|ZP_04640445.1| Flagellar biosynthetic protein fliP [Yersinia mollaretii ATCC
           43969]
 gi|238719201|gb|EEQ11013.1| Flagellar biosynthetic protein fliP [Yersinia mollaretii ATCC
           43969]
          Length = 245

 Score =  197 bits (502), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 96/206 (46%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T L+  P +L+M+T F R IIV  +LR  +G  S PPN V++ LALF+TFYVM
Sbjct: 42  VQTLVLLTSLTFLPAILLMMTGFTRIIIVLGLLRNALGTPSTPPNQVLLGLALFLTFYVM 101

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP  ++  +   QPL  ++I+  TA++R  +P   FM   TRE DL+L+  MA    +  
Sbjct: 102 SPVFNQIYKEAWQPLSEDKISMETALERGVQPLRTFMLEQTRETDLALYTRMA----KEE 157

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           +    D +  RIL+P+F+ SEL+  F+IGF + +PFLIID++VA+++MA+GMMM+PP +I
Sbjct: 158 NFQSQDDVPLRILLPAFVTSELKTGFQIGFTVFIPFLIIDLVVASVLMALGMMMVPPATI 217

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 218 SLPFKLMLFVLVDGWQLLMGSLAQSF 243


>gi|320354332|ref|YP_004195671.1| flagellar biosynthetic protein FliP [Desulfobulbus propionicus DSM
           2032]
 gi|320122834|gb|ADW18380.1| flagellar biosynthetic protein FliP [Desulfobulbus propionicus DSM
           2032]
          Length = 246

 Score =  197 bits (502), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 95/216 (43%), Positives = 149/216 (68%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           PA++S +   ++   + TIL++AP +L+M T F R +IV S +R  MG  + PPN V++ 
Sbjct: 37  PAEVSTA---LQALLVLTILTVAPAILLMTTAFTRIVIVLSFVRQAMGTQNTPPNQVLLG 93

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+TF+VM+P+L+   +  +QP +  +IT+  A++R  E    FM +  +E +L LF+
Sbjct: 94  LALFLTFFVMAPSLNAINDQALQPYIQEKITQQQALERSMEVMRDFMFSQVQESELQLFI 153

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           D+               +   ILIP+FM+SEL+R+F++GF+I +PFL+IDM+V++++M+M
Sbjct: 154 DITKEEQP----ADKKAVSSSILIPAFMLSELKRAFQMGFMIYVPFLVIDMLVSSVLMSM 209

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FVL+DGW L+V +L+KSF
Sbjct: 210 GMMMLPPIVISLPFKLLLFVLVDGWQLVVGSLMKSF 245


>gi|107021595|ref|YP_619922.1| flagellar biosynthesis protein FliP [Burkholderia cenocepacia AU
           1054]
 gi|116688061|ref|YP_833684.1| flagellar biosynthesis protein FliP [Burkholderia cenocepacia
           HI2424]
 gi|170731411|ref|YP_001763358.1| flagellar biosynthesis protein FliP [Burkholderia cenocepacia
           MC0-3]
 gi|254246638|ref|ZP_04939959.1| Flagellar biosynthesis pathway, component FliP [Burkholderia
           cenocepacia PC184]
 gi|105891784|gb|ABF74949.1| flagellar biosynthetic protein FliP [Burkholderia cenocepacia AU
           1054]
 gi|116646150|gb|ABK06791.1| flagellar biosynthetic protein FliP [Burkholderia cenocepacia
           HI2424]
 gi|124871414|gb|EAY63130.1| Flagellar biosynthesis pathway, component FliP [Burkholderia
           cenocepacia PC184]
 gi|169814653|gb|ACA89236.1| flagellar biosynthetic protein FliP [Burkholderia cenocepacia
           MC0-3]
          Length = 253

 Score =  197 bits (502), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 97/237 (40%), Positives = 154/237 (64%), Gaps = 7/237 (2%)

Query: 12  VTPELVFAKSSLHDVMNI---PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIV 68
           + P L +A+++     N    P   +  +  V+T  + T+LS  P +L+M+T F R IIV
Sbjct: 20  LAPALAYAQANGLPAFNASPGPHGGTTYSLSVQTMLLLTMLSFLPAMLLMMTSFTRIIIV 79

Query: 69  FSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRV 128
            S+LR  +G  + PPN V++ LA+F+TF+VMSP LDR+   G +P  +  +    A+QR 
Sbjct: 80  LSLLRQALGTATTPPNQVLVGLAMFLTFFVMSPVLDRAYNDGYKPFSDGSMPMEQAVQRG 139

Query: 129 AEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIG 188
             PF  FM   TRE DL+LF  ++ ++     +   + +   +L+P+F+ SEL+  F+IG
Sbjct: 140 VAPFKTFMLKQTRETDLALFAKISKAA----PMQGPEDVPLSLLVPAFVTSELKTGFQIG 195

Query: 189 FLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           F + +PFLIIDM+VA+++M+MGMMM+ P+++SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 196 FTVFIPFLIIDMVVASVLMSMGMMMVSPSTVSLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|311030115|ref|ZP_07708205.1| flagellar biosynthesis protein FliP [Bacillus sp. m3-13]
          Length = 221

 Score =  197 bits (501), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 97/199 (48%), Positives = 144/199 (72%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+ S+AP +LI++T F R IIV S +RT +   S+PPN V+I LALF+TF++M+PT  + 
Sbjct: 27  TVFSLAPAILILMTSFTRIIIVLSFVRTSLATQSMPPNQVLIGLALFLTFFIMAPTFSQV 86

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            +  +QPL N +IT   A ++ + P   FM  +TR+KDL+LF+D A    R   I   + 
Sbjct: 87  NDQALQPLFNEEITLDEAYEKASIPLKEFMSKHTRQKDLALFIDYA-GMERPESI---ED 142

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           I   +L+P+F ISEL+ +F+IGF+I +PFL+IDM+VA+++M+MGMMMLPP  ISLPFK++
Sbjct: 143 IPLTVLVPAFAISELKTAFQIGFMIFIPFLVIDMVVASVLMSMGMMMLPPVMISLPFKIL 202

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW L+V++L+ +F
Sbjct: 203 LFVLVDGWYLIVKSLLLTF 221


>gi|293605018|ref|ZP_06687413.1| flagellar biosynthetic protein FliP [Achromobacter piechaudii ATCC
           43553]
 gi|292816587|gb|EFF75673.1| flagellar biosynthetic protein FliP [Achromobacter piechaudii ATCC
           43553]
          Length = 263

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 102/234 (43%), Positives = 149/234 (63%), Gaps = 6/234 (2%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIMVTCFPRFIIVFSI 71
           P  V A+++L  +   P      T+ +  +T  + T LS  P  L+M+T F R IIV  +
Sbjct: 32  PAGVVAQATLPALTATPGPNGSETYSLSMQTMLLMTSLSFLPAALLMMTGFTRIIIVLGL 91

Query: 72  LRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEP 131
           LR+ MG    PPN V+I LALF+TFY MSP  D+      +PL    I   TA++R A P
Sbjct: 92  LRSAMGTAMSPPNHVLIGLALFLTFYTMSPVFDKIYADAYKPLSEGSIQFETAVERAAGP 151

Query: 132 FWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLI 191
              FM + TRE DLSLF ++A    +   +     +  RIL+P+F+ SEL+ +F+IGF I
Sbjct: 152 LRTFMLHQTRENDLSLFANLA----KQPALEDPSQVPLRILVPAFITSELKTAFQIGFTI 207

Query: 192 ILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
            +PFLIID++VA+++MA+GMMM+PP +++LPFK++ FVL DGW+LL+ +L +SF
Sbjct: 208 FIPFLIIDLVVASVLMALGMMMVPPVTVALPFKLMLFVLADGWNLLMGSLAQSF 261


>gi|149182519|ref|ZP_01860992.1| flagellar biosynthesis protein P [Bacillus sp. SG-1]
 gi|148849779|gb|EDL63956.1| flagellar biosynthesis protein P [Bacillus sp. SG-1]
          Length = 221

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 145/206 (70%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+   +FT+LSIAP +LI++T F R +IV S +RT +    +PPN V++ L+LF+TF++M
Sbjct: 20  VKLLLLFTVLSIAPGILILMTSFTRIVIVLSFVRTSLATQQMPPNQVLVGLSLFLTFFIM 79

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT     E  + PL N +I    A +  A PF  FM  +TR+KDL LF++ +  + R  
Sbjct: 80  APTFQEVNETALTPLFNEEINLEQAYENAAGPFKDFMSKHTRQKDLELFLNYS-GAERPE 138

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            I   D I    L+P+F +SE++ +F+IGF+I +PFL+IDM+VA+I+M+MGMMMLPP  I
Sbjct: 139 SI---DDIPLTALVPAFALSEIKTAFQIGFMIFIPFLVIDMVVASILMSMGMMMLPPVMI 195

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW L+V++L++SF
Sbjct: 196 SLPFKILLFVLVDGWYLVVKSLLQSF 221


>gi|260598457|ref|YP_003211028.1| flagellar biosynthetic protein fliP [Cronobacter turicensis z3032]
 gi|260217634|emb|CBA31933.1| Flagellar biosynthetic protein fliP [Cronobacter turicensis z3032]
          Length = 223

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 96/206 (46%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L+  P +L+M+T F R IIVF +LR  +G  S PPN V++ LALF+TF++M
Sbjct: 20  VQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIM 79

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP +D+      QP   N+I+   A+ R A+P   FM   TRE DL+LF  +A++     
Sbjct: 80  SPVIDKIYSDAYQPFTENKISMEVALDRGAQPLREFMLRQTREADLALFAKLANTQ---- 135

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            I   + +  RIL+P+++ SEL+ +F+IGF + +PFLIID++VA+++MA+GMMM+PP SI
Sbjct: 136 PIQGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFLIIDLVVASVLMALGMMMVPPASI 195

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL+DGW LLV +L +SF
Sbjct: 196 ALPFKLMLFVLVDGWQLLVGSLAQSF 221


>gi|189426339|ref|YP_001953516.1| flagellar biosynthesis protein FliP [Geobacter lovleyi SZ]
 gi|189422598|gb|ACD96996.1| flagellar biosynthetic protein FliP [Geobacter lovleyi SZ]
          Length = 256

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 94/216 (43%), Positives = 146/216 (67%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           PA+++ +   ++ F + T+LS+AP LLIM T F R ++V S LRT +G    P N +I++
Sbjct: 47  PAEVATT---IQIFLLLTVLSLAPSLLIMTTSFTRIVVVLSFLRTALGTQQAPSNQIILA 103

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TF++M+P   +      QP     +++  A ++  +P   FM + TREKDL LF+
Sbjct: 104 LSLFLTFFIMTPVWQQVNRDAYQPYKAGTLSQEQAFEKAVQPVRKFMLSQTREKDLGLFV 163

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            ++  +         D I    ++P+FMISELR +F+IGFLI +PF+++DM+VA+++M+M
Sbjct: 164 SLSKQARPK----NADDIPTLTIVPAFMISELRTAFQIGFLIYIPFIVVDMVVASVLMSM 219

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FVL+DGW L++ +LVKSF
Sbjct: 220 GMMMLPPVMISLPFKILLFVLVDGWGLVISSLVKSF 255


>gi|326791526|ref|YP_004309347.1| flagellar biosynthetic protein FliP [Clostridium lentocellum DSM
           5427]
 gi|326542290|gb|ADZ84149.1| flagellar biosynthetic protein FliP [Clostridium lentocellum DSM
           5427]
          Length = 261

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 96/201 (47%), Positives = 138/201 (68%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I TI+S+AP +LIM+T F R II    +R+ +G  ++PPN +++ LALF+TF+VMSP   
Sbjct: 60  IITIISLAPSILIMMTSFLRIIIALHFVRSAIGTQTMPPNQILVGLALFLTFFVMSPVFM 119

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +     I PL   QIT+  AI+R  +P   FM   TR++D++LFMD+AH      D    
Sbjct: 120 QIKTNAIDPLEKQQITQEQAIERGIQPLKEFMLKQTRDEDITLFMDLAHLEPYTEDTDLV 179

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
             +   ++IP+F+ISELR  F IGFL+ +PF+IIDM+VA  +M+MGMMMLPP  ISLPFK
Sbjct: 180 KEMPLHVIIPAFIISELRAGFIIGFLVYIPFIIIDMVVAATLMSMGMMMLPPAMISLPFK 239

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           V+ F+L+DGW+L +  L+++F
Sbjct: 240 VLLFILVDGWNLFIGQLIQTF 260


>gi|157161419|ref|YP_001458737.1| flagellar biosynthesis protein FliP [Escherichia coli HS]
 gi|157067099|gb|ABV06354.1| flagellar biosynthetic protein FliP [Escherichia coli HS]
          Length = 245

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/239 (43%), Positives = 158/239 (66%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+LVTP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLVTP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ISEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVISELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|239817147|ref|YP_002946057.1| flagellar biosynthetic protein FliP [Variovorax paradoxus S110]
 gi|239803724|gb|ACS20791.1| flagellar biosynthetic protein FliP [Variovorax paradoxus S110]
          Length = 253

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/227 (43%), Positives = 147/227 (64%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
             L  + + P      TW   V+T  + T LS  P LL+ +T F R +IV  +LRT +G 
Sbjct: 29  QGLPGLTSTPGPGGSQTWSLSVQTLVMLTSLSFLPALLLSMTSFTRILIVLGLLRTAIGT 88

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN +++ L+LF+TF+VM+P  D+  +   +P   N+IT   A+++   PF  FM  
Sbjct: 89  QSSPPNQILVGLSLFLTFFVMAPVFDKVHDEAYKPFSENKITAEKALEKGIAPFKSFMLK 148

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+LF  +A    +  D+   + +  RIL+PSF+ISEL+ +F+IGF I +PFLII
Sbjct: 149 QTRENDLALFARLA----KIPDMQGPEEVPLRILLPSFVISELKTAFQIGFTIFIPFLII 204

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D++VA+++M+MGMMM+PP SI+LPFK++ FV+ DGW LL+  L +SF
Sbjct: 205 DLVVASVLMSMGMMMVPPASIALPFKLMLFVMADGWQLLIGALAQSF 251


>gi|21672367|ref|NP_660434.1| type III secretion system protein [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25008468|sp|Q8KA37|FLIP_BUCAP RecName: Full=Flagellar biosynthetic protein fliP
 gi|21622972|gb|AAM67645.1| flagellar biosynthetic protein FliP [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 379

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 142/213 (66%), Gaps = 8/213 (3%)

Query: 36  STWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
            TW   V+T    T L+  P  L+M+T F R IIVF +LR  +G    PPN +++ LALF
Sbjct: 170 QTWSLPVQTLIFLTSLTFLPAFLLMMTSFTRIIIVFGLLRNALGTPYAPPNQILLGLALF 229

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +TF++MSPT D+  +    P    +I    AI + A P   FM N TR  DL LF  +AH
Sbjct: 230 LTFFIMSPTFDQVYKEAYLPFSQEKINMDEAIIKGAVPLKKFMLNQTRNSDLELFSKLAH 289

Query: 154 -SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMM 212
            SS++N      D I  RIL+PSF+ SEL+ +F+IGF I +PFLIID++VA+++MA+GMM
Sbjct: 290 ISSYKN-----KDEIPMRILLPSFITSELKTAFQIGFTIFIPFLIIDLVVASVLMALGMM 344

Query: 213 MLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           M+PP++ISLPFK++ FVL+DGW LLV +L +SF
Sbjct: 345 MVPPSTISLPFKLMLFVLVDGWQLLVTSLSQSF 377


>gi|304404260|ref|ZP_07385922.1| flagellar biosynthetic protein FliP [Paenibacillus curdlanolyticus
           YK9]
 gi|304347238|gb|EFM13070.1| flagellar biosynthetic protein FliP [Paenibacillus curdlanolyticus
           YK9]
          Length = 256

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 145/202 (71%), Gaps = 6/202 (2%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+LS+AP +L+++T F R +IV   +RT +G   +PPN V+I LA+F+TF+VM+PTL 
Sbjct: 57  LLTVLSVAPAILVLMTSFTRIVIVLGFVRTSLGTQQMPPNQVLIGLAMFLTFFVMAPTLS 116

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  ++ +QP +  +IT+  A  + A P   FM + TREKDL LFM      +  T+  K+
Sbjct: 117 QVNQVALQPYLKGEITQMQAFDKAAVPMKKFMFSQTREKDLLLFMK-----YTKTEKPKS 171

Query: 165 -DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPF 223
            + I   +L+P++ ISEL+ +F++GF+I +PFLIIDM+V++ +MAMGMMMLPP  ISLPF
Sbjct: 172 YEDIPITVLVPAYAISELKTAFQMGFMIFIPFLIIDMVVSSTLMAMGMMMLPPVMISLPF 231

Query: 224 KVIFFVLIDGWSLLVENLVKSF 245
           K++ FVL+DGW L+V++L+ SF
Sbjct: 232 KILLFVLVDGWYLIVKSLLISF 253


>gi|323527702|ref|YP_004229855.1| flagellar biosynthetic protein FliP [Burkholderia sp. CCGE1001]
 gi|323384704|gb|ADX56795.1| flagellar biosynthetic protein FliP [Burkholderia sp. CCGE1001]
          Length = 277

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 152/236 (64%), Gaps = 7/236 (2%)

Query: 14  PELVFAKSSLHDVMNI---PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFS 70
           P L FA+++     N    P   +  +  V+T  + T+LS  P +++M+T F R IIV S
Sbjct: 46  PSLSFAQTAGLPAFNTSPGPNGGTTYSLSVQTMLLLTMLSFLPAMVLMMTSFTRIIIVLS 105

Query: 71  ILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAE 130
           +LR  +G  + PPN V++ LALF+T +VMSP LD++   G +P     +   TA+ R   
Sbjct: 106 LLRQALGTTTTPPNQVLVGLALFLTLFVMSPVLDKAYTDGYKPFSEGTVPMETAVSRGLA 165

Query: 131 PFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFL 190
           PF  FM   TRE DL+LF  ++H++     +   + +   +L+PSF+ SEL+  F+IGF 
Sbjct: 166 PFKTFMLRQTRESDLALFARISHAA----PMQGPEDVPLSLLVPSFVTSELKTGFQIGFT 221

Query: 191 IILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           I +PFLIIDM+VA+++M+MGMMM+ P +ISLPFK++ FVL+DGW LL+ +L +SF+
Sbjct: 222 IFIPFLIIDMVVASVLMSMGMMMVSPATISLPFKLMLFVLVDGWQLLLGSLAQSFV 277


>gi|254418891|ref|ZP_05032615.1| flagellar biosynthetic protein FliP [Brevundimonas sp. BAL3]
 gi|196185068|gb|EDX80044.1| flagellar biosynthetic protein FliP [Brevundimonas sp. BAL3]
          Length = 266

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 149/219 (68%), Gaps = 4/219 (1%)

Query: 27  MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLV 86
           +++ +   ++  +V+  G+ T+LS+AP ++IM T F R ++V S+LRT +GM   PPN V
Sbjct: 45  IDLGSGAGLTQRVVQLVGLMTVLSLAPSIVIMTTSFVRIVVVLSLLRTALGMQQSPPNAV 104

Query: 87  IISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLS 146
           ++SLALF++  VM+PT   + + GI+PL++ Q+    A    +EP   FM       DL+
Sbjct: 105 LVSLALFLSAIVMAPTWQDAYDSGIRPLLDQQMELPQAFDAASEPVKTFMLAQVDRGDLA 164

Query: 147 LFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIV 206
           LF  ++    R         +  R++ P+FMISEL+++FEIGFL+ +PFL+ID++VA+++
Sbjct: 165 LFTRLS----RVEAPANLQELPLRVVTPAFMISELKKAFEIGFLLFVPFLVIDLVVASVL 220

Query: 207 MAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           M+MGMMMLPP  +SLPFK+IFFVL+DGW L+  +LV+SF
Sbjct: 221 MSMGMMMLPPVVVSLPFKLIFFVLVDGWRLVAGSLVESF 259


>gi|148261126|ref|YP_001235253.1| flagellar biosynthesis protein FliP [Acidiphilium cryptum JF-5]
 gi|326404527|ref|YP_004284609.1| flagellar biosynthetic protein FliP [Acidiphilium multivorum
           AIU301]
 gi|146402807|gb|ABQ31334.1| flagellar biosynthetic protein FliP [Acidiphilium cryptum JF-5]
 gi|325051389|dbj|BAJ81727.1| flagellar biosynthetic protein FliP [Acidiphilium multivorum
           AIU301]
          Length = 253

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 89/207 (42%), Positives = 142/207 (68%), Gaps = 4/207 (1%)

Query: 39  IVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYV 98
           +++   +  ++S+AP LL+M+T F R +IV S+LRT +G  + PPN V+I LALF+T++V
Sbjct: 46  LIQLIALIGVISLAPSLLVMLTAFTRIVIVLSLLRTALGTQTTPPNSVLIGLALFLTYFV 105

Query: 99  MSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRN 158
           M+P   +S   G+ P+    +     ++  A PF  F+ +N R  D+ +F+ +AH     
Sbjct: 106 MAPVFSQSWHTGLLPMTQGDVGTLEGLKLAAAPFHTFLADNARPADVRVFLSLAHIKPP- 164

Query: 159 TDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTS 218
                   + +R LIP F++ ELRR FE+GF+I LPF++ID+++++I+M++GMMMLPPT+
Sbjct: 165 ---ANMQDVPWRALIPGFVVGELRRGFEMGFMIFLPFMVIDIVISSILMSLGMMMLPPTA 221

Query: 219 ISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +SLPFK+IFFVL+DGW L+  +LV+SF
Sbjct: 222 VSLPFKIIFFVLVDGWQLVCGSLVRSF 248


>gi|156933432|ref|YP_001437348.1| flagellar biosynthesis protein FliP [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156531686|gb|ABU76512.1| hypothetical protein ESA_01250 [Cronobacter sakazakii ATCC BAA-894]
          Length = 245

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 96/206 (46%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L+  P +L+M+T F R IIVF +LR  +G  S PPN V++ LALF+TF++M
Sbjct: 42  VQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIM 101

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP +D+      QP   N+I+   A+ R A+P   FM   TRE DL+LF  +A++     
Sbjct: 102 SPVIDKIYSDAYQPFNENKISMEVALDRGAQPLREFMLRQTREADLALFAKLANTQ---- 157

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            I   + +  RIL+P+++ SEL+ +F+IGF + +PFLIID++VA+++MA+GMMM+PP SI
Sbjct: 158 PIQGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFLIIDLVVASVLMALGMMMVPPASI 217

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL+DGW LLV +L +SF
Sbjct: 218 ALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|291276476|ref|YP_003516248.1| flagellar biosynthesis protein [Helicobacter mustelae 12198]
 gi|290963670|emb|CBG39502.1| flagellar biosynthesis protein [Helicobacter mustelae 12198]
          Length = 247

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 142/201 (70%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+L +AP L++++T F R +IVFS LRT +G    PP  +++SLA+ +TF++M P + 
Sbjct: 50  VLTLLVLAPSLVLVMTSFTRLVIVFSFLRTALGTQQSPPTQILVSLAMVLTFFIMEPVVR 109

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
            S +  I P ++ +I+  TA  R  +PF  FM  NTREKDL+LF  +    +  T    +
Sbjct: 110 ESYQKAIVPYLDAKISYETAFDRGVQPFKDFMLKNTREKDLALFYRIRKLENPKT----S 165

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
             +    LIP+FMISEL+ +F+IGFL+ LPFL+IDM+V++I+MAMGMMMLPP  ISLPFK
Sbjct: 166 ADVSLTTLIPAFMISELKTAFQIGFLLYLPFLVIDMVVSSILMAMGMMMLPPVMISLPFK 225

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DG++LL+ NLV+SF
Sbjct: 226 ILIFVLVDGFNLLIGNLVESF 246


>gi|187478200|ref|YP_786224.1| flagellar biosynthesis protein FliP [Bordetella avium 197N]
 gi|115422786|emb|CAJ49314.1| flagellar biosynthetic protein [Bordetella avium 197N]
          Length = 255

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 103/236 (43%), Positives = 148/236 (62%), Gaps = 6/236 (2%)

Query: 12  VTPELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIMVTCFPRFIIVF 69
           V P    A+++L  +   P      T+ +  +T  + T LS  P  L+M+T F R IIV 
Sbjct: 22  VMPSGAIAQATLPALTTTPGVNGSQTYSLSMQTLLLMTSLSFLPAALLMMTGFTRIIIVL 81

Query: 70  SILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVA 129
            +LR+ MG    PPN V++ +ALF+TFY MSP  D+      QPL    I   TA++R  
Sbjct: 82  GLLRSAMGTAMSPPNHVLVGIALFLTFYTMSPVFDKIYTEAYQPLSTGSIPFETALERAG 141

Query: 130 EPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGF 189
            P   FM + TRE DL+LF ++A+       I     +  RILIP+F+ SEL+ +F+IGF
Sbjct: 142 APLHTFMLHQTRENDLALFANLANIP----KIEDPSKVPMRILIPAFITSELKTAFQIGF 197

Query: 190 LIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
            I +PFLIID++VA+++MA+GMMM+PP ++SLPFK++ FVL DGW+LL+ +L KSF
Sbjct: 198 TIFIPFLIIDLVVASVLMALGMMMVPPVTVSLPFKLMLFVLADGWNLLLGSLAKSF 253


>gi|294636880|ref|ZP_06715210.1| flagellar biosynthetic protein FliP [Edwardsiella tarda ATCC 23685]
 gi|291089910|gb|EFE22471.1| flagellar biosynthetic protein FliP [Edwardsiella tarda ATCC 23685]
          Length = 246

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T LS  P +L+++T F R IIV  +LR  +G  S PPN V++ LALF+TF++M
Sbjct: 43  VQTLVFLTSLSFLPAVLLLMTSFTRIIIVLGLLRNALGTPSAPPNQVLLGLALFLTFFIM 102

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD+  +   QP    +I+  TA++R A+P   FM   TRE DL+LF  +A    +  
Sbjct: 103 SPVLDKIYQDAYQPFSEQKISMETALERGAKPLRAFMLRQTRETDLALFARLA----KQP 158

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +  RIL+P+++ SEL+ +F+IGF + +PFLIID++VA+++MA+GMMM+PP +I
Sbjct: 159 QMQGPEDVPLRILLPAYVTSELKTAFQIGFTVFIPFLIIDLVVASVLMALGMMMVPPATI 218

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 219 SLPFKLMLFVLVDGWQLLLGSLAQSF 244


>gi|223040127|ref|ZP_03610407.1| flagellar biosynthetic protein FliP [Campylobacter rectus RM3267]
 gi|222878604|gb|EEF13705.1| flagellar biosynthetic protein FliP [Campylobacter rectus RM3267]
          Length = 246

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 140/195 (71%), Gaps = 6/195 (3%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP L+ M+T F R IIVFS LR  MG   +PP+ V+ISLA+ +TF++M P   ++ E G+
Sbjct: 56  APSLVFMMTSFLRLIIVFSFLRQAMGTQQMPPSTVLISLAMVLTFFIMEPVGKQAYEAGV 115

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN-DHIEYR 170
           +P +  QI    A +R  +PF  FM  NTREKDL+LF+ +     RN    ++ D I   
Sbjct: 116 RPYLGEQIGYQEAFERGVKPFREFMIKNTREKDLALFLRI-----RNMPNPQSFDDIPLT 170

Query: 171 ILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVL 230
           +++ +FMISE++ +FEI FL+ LPFL+IDM+V++++MAMGMMMLPPT ISLPFK++ F+L
Sbjct: 171 VVMSAFMISEMKTAFEIAFLLYLPFLVIDMVVSSVLMAMGMMMLPPTMISLPFKLLIFIL 230

Query: 231 IDGWSLLVENLVKSF 245
           +DGW+LLV NLVKSF
Sbjct: 231 VDGWNLLVMNLVKSF 245


>gi|291536019|emb|CBL09131.1| flagellar biosynthetic protein FliP [Roseburia intestinalis M50/1]
 gi|291538511|emb|CBL11622.1| flagellar biosynthetic protein FliP [Roseburia intestinalis XB6B4]
          Length = 299

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 97/217 (44%), Positives = 145/217 (66%), Gaps = 11/217 (5%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           VR   + TI++++P LLIM+T + R +IV   LRT +G  + PPN ++I LALF+TF++M
Sbjct: 82  VRALLLLTIIAVSPSLLIMLTSYTRIVIVLHFLRTAIGTQTAPPNQILIGLALFLTFFIM 141

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSH--- 156
            PT  +  E  IQPL N  IT   A++    P   FM    + KD+ LF+DMA  S+   
Sbjct: 142 WPTFQQINENAIQPLDNGDITIEEALKEAEVPIRQFMYGQVQRKDVKLFVDMAGDSYDID 201

Query: 157 --------RNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMA 208
                     +  +  D I   I+IPSF+I ELR++F +GF+I +PF++IDM+VA+++M+
Sbjct: 202 SAALEKEYEESGQSAYDAIPMTIMIPSFIIGELRQAFIMGFVIYIPFIVIDMVVASVLMS 261

Query: 209 MGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MGMMMLPPT+ISLPFK++ F+L DGW+L++ ++VK+F
Sbjct: 262 MGMMMLPPTTISLPFKILLFILADGWNLVIGSVVKTF 298


>gi|240145488|ref|ZP_04744089.1| flagellar biosynthetic protein FliP [Roseburia intestinalis L1-82]
 gi|257202303|gb|EEV00588.1| flagellar biosynthetic protein FliP [Roseburia intestinalis L1-82]
          Length = 299

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 97/217 (44%), Positives = 145/217 (66%), Gaps = 11/217 (5%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           VR   + TI++++P LLIM+T + R +IV   LRT +G  + PPN ++I LALF+TF++M
Sbjct: 82  VRALLLLTIIAVSPSLLIMLTSYTRIVIVLHFLRTAIGTQTAPPNQILIGLALFLTFFIM 141

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSH--- 156
            PT  +  E  IQPL N  IT   A++    P   FM    + KD+ LF+DMA  S+   
Sbjct: 142 WPTFQQINENAIQPLDNGDITIEEALKEAEVPIRQFMYGQVQRKDVKLFVDMAGDSYDID 201

Query: 157 --------RNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMA 208
                     +  +  D I   I+IPSF+I ELR++F +GF+I +PF++IDM+VA+++M+
Sbjct: 202 SAALEKEYEESGQSAYDAIPMTIMIPSFVIGELRQAFIMGFVIYIPFIVIDMVVASVLMS 261

Query: 209 MGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MGMMMLPPT+ISLPFK++ F+L DGW+L++ ++VK+F
Sbjct: 262 MGMMMLPPTTISLPFKILLFILADGWNLVIGSVVKTF 298


>gi|300113613|ref|YP_003760188.1| flagellar biosynthetic protein FliP [Nitrosococcus watsonii C-113]
 gi|299539550|gb|ADJ27867.1| flagellar biosynthetic protein FliP [Nitrosococcus watsonii C-113]
          Length = 262

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 144/206 (69%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++  G+ T+L++ P  ++++T F R I+VFSILR  +G+   P + ++I LALF+TF++M
Sbjct: 57  LQILGLMTVLTLLPAAVMVMTSFTRIIVVFSILRQALGLAQTPSSQILIGLALFLTFFIM 116

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD++ + G++P    +I+   A+ RV EPF  FM   TRE DL LF ++   S R  
Sbjct: 117 SPVLDKAYQEGVKPYFQEEISVADALARVREPFHHFMIAQTRETDLKLFAEI---SGREA 173

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                + + + +L+P+F+ SEL+ +F+IGFL+ +PFLIID++VA+++MAMGMMML P  +
Sbjct: 174 -FESPEQVPFSLLVPAFITSELKTAFQIGFLLFIPFLIIDLVVASVLMAMGMMMLSPMLV 232

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVLIDGWSLL+  L  SF
Sbjct: 233 SLPFKLLLFVLIDGWSLLMGTLASSF 258


>gi|311105950|ref|YP_003978803.1| flagellar biosynthetic protein FliP [Achromobacter xylosoxidans A8]
 gi|310760639|gb|ADP16088.1| flagellar biosynthetic protein FliP [Achromobacter xylosoxidans A8]
          Length = 263

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 148/234 (63%), Gaps = 6/234 (2%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIMVTCFPRFIIVFSI 71
           P  V A+++L  +   P      T+ +  +T  + T LS  P  L+M+T F R IIV  +
Sbjct: 32  PAGVVAQATLPALTATPGPNGSETYSLSMQTLLLMTSLSFLPAALLMMTGFTRIIIVLGL 91

Query: 72  LRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEP 131
           LR+ MG    PPN V+I LALF+TFY MSP  D+      +PL    I    A++R A P
Sbjct: 92  LRSAMGTAMSPPNHVLIGLALFLTFYTMSPVFDKIYTDAYKPLSEGSIQFEAAVERAAGP 151

Query: 132 FWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLI 191
              FM + TRE DLSLF ++A    +   +     +  RIL+P+F+ SEL+ +F+IGF I
Sbjct: 152 LRTFMLHQTRENDLSLFANLA----KQPALEDPSQVPLRILVPAFITSELKTAFQIGFTI 207

Query: 192 ILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
            +PFLIID++VA+++MA+GMMM+PP +++LPFK++ FVL DGW+LL+ +L +SF
Sbjct: 208 FIPFLIIDLVVASVLMALGMMMVPPVTVALPFKLMLFVLADGWNLLMGSLAQSF 261


>gi|302389676|ref|YP_003825497.1| flagellar biosynthetic protein FliP [Thermosediminibacter oceani
           DSM 16646]
 gi|302200304|gb|ADL07874.1| flagellar biosynthetic protein FliP [Thermosediminibacter oceani
           DSM 16646]
          Length = 254

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 141/194 (72%), Gaps = 3/194 (1%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIM+T F R +IVFS +R+G+G   +PPN V+I LALF+TF+VM+P  D   +  I
Sbjct: 63  APSILIMMTSFIRIVIVFSFVRSGLGTQQIPPNQVLIGLALFITFFVMAPVFDDINKNAI 122

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QP M  +IT   A+Q   +P   FM   TREKDL+LF+   H+  +N   T +D   Y +
Sbjct: 123 QPYMREEITTQEALQLAQKPLRDFMFRQTREKDLALFL--YHAKLQNQVRTLDDVPTY-V 179

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           LIP+F+ISEL+ +F++GF+I +PFL+IDMIVA+ +M+MGM+MLPP  ISLPFK++ FV++
Sbjct: 180 LIPAFIISELKTAFQMGFIIFVPFLVIDMIVASTLMSMGMLMLPPVMISLPFKILLFVMV 239

Query: 232 DGWSLLVENLVKSF 245
           DGW+L+V +L+ SF
Sbjct: 240 DGWNLVVSSLLSSF 253


>gi|85706151|ref|ZP_01037246.1| flagellar biosynthetic protein FliP [Roseovarius sp. 217]
 gi|85669315|gb|EAQ24181.1| flagellar biosynthetic protein FliP [Roseovarius sp. 217]
          Length = 245

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 143/220 (65%), Gaps = 3/220 (1%)

Query: 27  MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLV 86
           ++I  D S+S   ++   + T+LS+AP + IMVTCFP  + V SILR G+G+   PPN++
Sbjct: 29  LSIGDDASLSARTIQIIALITVLSLAPGIAIMVTCFPFIVTVLSILRQGIGLQQSPPNML 88

Query: 87  IISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLS 146
           I+SLALF+T++VM P    +   GI+PL+  +++   A + V  PF  FM       D  
Sbjct: 89  IVSLALFLTYFVMEPVFTEAWTNGIEPLLEERLSPERATEMVIAPFRQFMLGRV---DPE 145

Query: 147 LFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIV 206
            F  MA      +           +LIPSFM+SE+ R+F+IGFL+ LPFL+ID++VA I+
Sbjct: 146 TFASMAALRPEASVTVAGSDAPLSVLIPSFMLSEIARAFQIGFLVFLPFLVIDLVVAAIL 205

Query: 207 MAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           M+MGMMM+PP  +SLPFK+ FFV+ DGW+L+ E+LVK ++
Sbjct: 206 MSMGMMMVPPAIVSLPFKLAFFVIADGWTLIAESLVKGYM 245


>gi|225850263|ref|YP_002730497.1| flagellar biosynthetic protein FliP [Persephonella marina EX-H1]
 gi|225646564|gb|ACO04750.1| flagellar biosynthetic protein FliP [Persephonella marina EX-H1]
          Length = 222

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 101/199 (50%), Positives = 138/199 (69%), Gaps = 5/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           TILS+AP +LI VT F R +IV S+LR  +G+   PPN VII+ +LF+TF+VM P  D  
Sbjct: 28  TILSLAPSILITVTAFVRIVIVLSLLRHALGIPQSPPNQVIIAFSLFLTFFVMKPVFDDI 87

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
               IQP +  +I +  AI+R  EP   FM  NTR++DL LF+D+A    ++      D 
Sbjct: 88  NGNAIQPYLKKEIGDMEAIERAKEPVKKFMLKNTRKEDLKLFLDIAGEKPKSP-----DE 142

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           +    LIP+FMISE++ +FEI F+I LPFLIIDM+VA+I+M+MGMMM+PP  ISLPFK+I
Sbjct: 143 VSMVSLIPAFMISEIKTAFEIVFIIFLPFLIIDMLVASILMSMGMMMIPPMLISLPFKLI 202

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL DG+ LL + L++S+
Sbjct: 203 LFVLADGFELLTKALIQSY 221


>gi|295098284|emb|CBK87374.1| flagellar biosynthetic protein FliP [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 245

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 95/227 (41%), Positives = 152/227 (66%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  +++ P      +W   V+T    T L+  P +L+M+T F R IIVF +LR  +G 
Sbjct: 21  AQLPGLVSTPLANGGQSWSLSVQTLVFITSLTFIPAILLMMTSFTRIIIVFGLLRNALGT 80

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ LALF+TF++MSP +D+      QP   ++I+   A+++ A+P   FM  
Sbjct: 81  PSAPPNQVLLGLALFLTFFIMSPVIDKIYTEAYQPFSEDKISMQVALEKGAQPLREFMLR 140

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+LF  +A++     ++   + +  RIL+P+++ SEL+ +F+IGF I +PFLII
Sbjct: 141 QTREADLALFARLANTG----ELQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLII 196

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 197 DLVIASVLMALGMMMVPPATIALPFKIMLFVLVDGWQLLVSSLAQSF 243


>gi|225375339|ref|ZP_03752560.1| hypothetical protein ROSEINA2194_00964 [Roseburia inulinivorans DSM
           16841]
 gi|225212828|gb|EEG95182.1| hypothetical protein ROSEINA2194_00964 [Roseburia inulinivorans DSM
           16841]
          Length = 273

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 98/206 (47%), Positives = 142/206 (68%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+   + TILS+AP +LIM+T + R IIV   LRT +G  + PPN V+I+LALF+TF++M
Sbjct: 72  VKMLLVLTILSLAPSILIMLTSYTRIIIVLHFLRTAIGTQTAPPNQVLIALALFLTFFIM 131

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PT  +     IQPL   +IT   A      P   FM   T+EKDL LF+D++  ++ + 
Sbjct: 132 WPTFQQINTEAIQPLDKGEITTEEAFTVAQGPIREFMYGQTQEKDLKLFVDISDETYDS- 190

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                D +    LIP+F++SELR +F IGF+I +PF++IDM+VA+++M+MGMMMLPPT+I
Sbjct: 191 ----YDDVPMTTLIPAFILSELRAAFIIGFVIYIPFIVIDMVVASVLMSMGMMMLPPTTI 246

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ F+L DGW L++ +LVK+F
Sbjct: 247 SLPFKILLFILADGWDLVIGSLVKTF 272


>gi|261340413|ref|ZP_05968271.1| flagellar biosynthetic protein FliP [Enterobacter cancerogenus ATCC
           35316]
 gi|288317505|gb|EFC56443.1| flagellar biosynthetic protein FliP [Enterobacter cancerogenus ATCC
           35316]
          Length = 245

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 95/227 (41%), Positives = 152/227 (66%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  +++ P      +W   V+T    T L+  P +L+M+T F R IIVF +LR  +G 
Sbjct: 21  AQLPGLISTPMAGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRIIIVFGLLRNALGT 80

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ LALF+TF++MSP +D+      QP   ++I+   A+++ A+P   FM  
Sbjct: 81  PSAPPNQVLLGLALFLTFFIMSPVIDKIYTDAYQPFSEDKISMEVALEKGAQPLREFMLR 140

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+LF  +A++     ++   + +  RIL+P+++ SEL+ +F+IGF I +PFLII
Sbjct: 141 QTREADLALFARLANTG----ELQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLII 196

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 197 DLVIASVLMALGMMMVPPATIALPFKIMLFVLVDGWQLLVSSLAQSF 243


>gi|170759449|ref|YP_001787969.1| flagellar biosynthesis protein FliP [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169406438|gb|ACA54849.1| flagellar biosynthetic protein FliP [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 258

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 97/199 (48%), Positives = 140/199 (70%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+L++ P  ++M+T F R I+VF  LR  MG    PPN V+I LALF+T ++M P     
Sbjct: 63  TVLTLLPSFIVMMTSFVRTIVVFGFLRNAMGTQQSPPNQVMIGLALFLTLFIMQPVYSEI 122

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
               IQP M N+IT+  A++  A+P   FM   TR+KDL LF+D+A     N  +TK++ 
Sbjct: 123 NTKAIQPYMKNKITQEQAVETGAKPLRQFMLKQTRQKDLKLFVDLAKP---NFKVTKDNA 179

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
             Y I++P+F+ISEL+ +F+IGFL+ +PFLIID++VA+++M+MGM MLPP  ISLPFK++
Sbjct: 180 PLY-IVVPAFIISELKTAFQIGFLLFIPFLIIDLVVASVLMSMGMFMLPPVMISLPFKLL 238

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FV++DGW LLV++LV SF
Sbjct: 239 LFVMVDGWYLLVKSLVMSF 257


>gi|186477688|ref|YP_001859158.1| flagellar biosynthesis protein FliP [Burkholderia phymatum STM815]
 gi|184194147|gb|ACC72112.1| flagellar biosynthetic protein FliP [Burkholderia phymatum STM815]
          Length = 281

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 100/242 (41%), Positives = 153/242 (63%), Gaps = 7/242 (2%)

Query: 8   ALFLVTPELVFAKSSLHDVMNI---PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPR 64
           AL L  P L  A+++     N    P   +  +  V+T  + T+LS  P +++M+T F R
Sbjct: 44  ALMLAAPTLSHAQTAGLPAFNTSPGPNGGTTYSLSVQTMLLLTMLSFLPAMVLMMTSFTR 103

Query: 65  FIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTA 124
            IIV S+LR  +G  + PPN V++ LALF+T +VMSP LD++   G +P     I    A
Sbjct: 104 IIIVLSLLRQAIGAPTTPPNQVLVGLALFLTLFVMSPVLDKAYNDGYKPFSEGTIQMDEA 163

Query: 125 IQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRS 184
           ++R   PF  FM   TRE DL+LF  ++H+      +   + +   +L+PSF+ SEL+  
Sbjct: 164 VKRGVAPFKAFMLKQTRESDLALFARISHAP----PMQGPEDVPLSLLVPSFVTSELKTG 219

Query: 185 FEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKS 244
           F+IGF + +PF+IIDM+VA+++M+MGMMM+ P +ISLPFK++ FVL+DGW L+V +L +S
Sbjct: 220 FQIGFTVFIPFVIIDMVVASVLMSMGMMMISPATISLPFKLMLFVLVDGWQLIVGSLAQS 279

Query: 245 FI 246
           F+
Sbjct: 280 FV 281


>gi|238920321|ref|YP_002933836.1| flagellar biosynthetic protein FliP, [Edwardsiella ictaluri 93-146]
 gi|238869890|gb|ACR69601.1| flagellar biosynthetic protein FliP, putative [Edwardsiella
           ictaluri 93-146]
          Length = 246

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 141/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T LS  P  L+++T F R IIV  +LR  +G  S PPN V++ LALF+TF++M
Sbjct: 43  VQTLVFLTSLSFLPAALLLMTSFTRIIIVLGLLRNALGTPSAPPNQVLLGLALFLTFFIM 102

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD+  +   QP    +I+  TA+ R A+P   FM   TRE DL+LF  +A    +  
Sbjct: 103 SPVLDKIYQEAYQPFSEQKISMETALDRGAKPLRAFMLRQTRETDLALFSRLA----KQP 158

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           ++   + +  RIL+P+++ SEL+ +F+IGF + +PFLIID++VA+++MA+GMMM+PP +I
Sbjct: 159 EMQGPEDVPMRILLPAYVTSELKTAFQIGFTVFIPFLIIDLVVASVLMALGMMMVPPATI 218

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 219 SLPFKLMLFVLVDGWQLLLGSLAQSF 244


>gi|78043022|ref|YP_359852.1| flagellar biosynthesis protein FliP [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77995137|gb|ABB14036.1| flagellar biosynthetic protein FliP [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 254

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 137/193 (70%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P  L+++T F R ++V S+LR  MG    PPN V+I LALF+T ++MSP +++  +  IQ
Sbjct: 65  PAFLLLMTSFTRIVVVLSLLRNAMGTQQAPPNQVLIGLALFLTIFIMSPVINKINQDAIQ 124

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P +NNQIT+  AI+    P   FM   TREKDL+LF+++A      T     D + + ++
Sbjct: 125 PYLNNQITQEQAIRAAEAPLKDFMLKQTREKDLALFIELAKLPRPQT----KDDVPFTVV 180

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+F+ISEL+ +F++GF++ LPFLIIDM+VA+I+M+MGM M+PP  ++LPFK++ FVL D
Sbjct: 181 VPAFIISELKTAFQMGFMLFLPFLIIDMVVASILMSMGMFMIPPMLVALPFKLLLFVLAD 240

Query: 233 GWSLLVENLVKSF 245
           GW L+V++LV SF
Sbjct: 241 GWYLVVKSLVSSF 253


>gi|188492613|ref|ZP_02999883.1| flagellar biosynthetic protein FliP [Escherichia coli 53638]
 gi|188487812|gb|EDU62915.1| flagellar biosynthetic protein FliP [Escherichia coli 53638]
          Length = 245

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 157/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+LVTP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLVTP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVNAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|331663444|ref|ZP_08364354.1| flagellar biosynthetic protein FliP [Escherichia coli TA143]
 gi|331059243|gb|EGI31220.1| flagellar biosynthetic protein FliP [Escherichia coli TA143]
          Length = 249

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 157/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+LVTP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLVTP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|330839520|ref|YP_004414100.1| flagellar biosynthetic protein FliP [Selenomonas sputigena ATCC
           35185]
 gi|329747284|gb|AEC00641.1| flagellar biosynthetic protein FliP [Selenomonas sputigena ATCC
           35185]
          Length = 252

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 144/216 (66%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D++ S  I+    + TILS+ P +L+M T F R ++V   LR  M   +VPPN V+++
Sbjct: 43  PQDVATSLQIL---ALLTILSLVPSILVMTTSFVRIVVVIGFLRNAMSTQNVPPNQVVLA 99

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TFY+M P    + + GIQP +  QIT+  AI     P   FM   TRE DL+LF+
Sbjct: 100 LSLFLTFYIMQPYWSEANQQGIQPYLAGQITQEQAIDNTLAPLREFMFRQTRESDLALFV 159

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           +++ +    +       +    LIP+F+ISEL+ +F+IGF+I +PF++IDMIVA+ +M+M
Sbjct: 160 NLSDAERPES----QADVSTATLIPAFVISELKTAFQIGFMIYIPFIVIDMIVASTLMSM 215

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FV++DGW LL+++L+ SF
Sbjct: 216 GMMMLPPVMISLPFKILLFVMVDGWHLLIKSLIMSF 251


>gi|260886649|ref|ZP_05897912.1| flagellar biosynthetic protein FliP [Selenomonas sputigena ATCC
           35185]
 gi|260863792|gb|EEX78292.1| flagellar biosynthetic protein FliP [Selenomonas sputigena ATCC
           35185]
          Length = 251

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 144/216 (66%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D++ S  I+    + TILS+ P +L+M T F R ++V   LR  M   +VPPN V+++
Sbjct: 42  PQDVATSLQIL---ALLTILSLVPSILVMTTSFVRIVVVIGFLRNAMSTQNVPPNQVVLA 98

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TFY+M P    + + GIQP +  QIT+  AI     P   FM   TRE DL+LF+
Sbjct: 99  LSLFLTFYIMQPYWSEANQQGIQPYLAGQITQEQAIDNTLAPLREFMFRQTRESDLALFV 158

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           +++ +    +       +    LIP+F+ISEL+ +F+IGF+I +PF++IDMIVA+ +M+M
Sbjct: 159 NLSDAERPES----QADVSTATLIPAFVISELKTAFQIGFMIYIPFIVIDMIVASTLMSM 214

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FV++DGW LL+++L+ SF
Sbjct: 215 GMMMLPPVMISLPFKILLFVMVDGWHLLIKSLIMSF 250


>gi|163856448|ref|YP_001630746.1| flagellar biosynthesis protein FliP [Bordetella petrii DSM 12804]
 gi|163260176|emb|CAP42478.1| flagellar biosynthesis protein FliP [Bordetella petrii]
          Length = 262

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 100/234 (42%), Positives = 148/234 (63%), Gaps = 6/234 (2%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIMVTCFPRFIIVFSI 71
           P  V A+++L  +   P      T+ +  +T  + T LS  P  L+M+T F R IIV  +
Sbjct: 31  PAGVVAQATLPALTATPGPGGAQTYSLSMQTLLLMTSLSFLPAALLMMTGFTRIIIVLGL 90

Query: 72  LRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEP 131
           LR+ +G    PPN V+I LALF+TFY MSP  DR      +PL    I   TA++R A P
Sbjct: 91  LRSALGTAMSPPNHVLIGLALFLTFYTMSPVFDRIYSEAYKPLSEGSIPFETAVERAAAP 150

Query: 132 FWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLI 191
              FM + TRE DL+LF ++A+       +     +  +IL+P+F+ SEL+ +F+IGF I
Sbjct: 151 LHTFMLHQTRENDLTLFANLAN----QPALEDPSQVPMKILVPAFITSELKTAFQIGFTI 206

Query: 192 ILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
            +PFLIID++VA+++MA+GMMM+PP +++LPFK++ FVL DGW+LL+ +L  SF
Sbjct: 207 FIPFLIIDLVVASVLMALGMMMVPPVTVALPFKLMLFVLADGWNLLLGSLASSF 260


>gi|225849157|ref|YP_002729321.1| flagellar biosynthetic protein FliP [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644291|gb|ACN99341.1| flagellar biosynthetic protein FliP [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 239

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 140/199 (70%), Gaps = 5/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+LSIAP +LI +T F R +IV S+LR  +G+ + PPN VI+ LALF+TF++M P  D+ 
Sbjct: 44  TVLSIAPAILISMTSFVRIVIVLSLLRHALGIPTAPPNQVIVGLALFLTFFIMKPVFDKI 103

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            E+ + P +  QI++  AI+   +P   FM  NTR++DL LF+D++    +     K + 
Sbjct: 104 NEVSLTPYLKKQISDVQAIENAKQPLKEFMLKNTRKEDLKLFIDISKEKPQ-----KLED 158

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           +    LIP+FMISE++ +FEI F+I LPF++ID +VA+I+M+MGMMM+PP  ISLPFK++
Sbjct: 159 VSMTTLIPAFMISEIKTAFEIVFIIYLPFIVIDFVVASILMSMGMMMVPPMFISLPFKLM 218

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL DGW LL + L++S+
Sbjct: 219 LFVLADGWELLTKALIQSY 237


>gi|56413108|ref|YP_150183.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362034|ref|YP_002141671.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|56127365|gb|AAV76871.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093511|emb|CAR58972.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 245

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 100/240 (41%), Positives = 155/240 (64%), Gaps = 9/240 (3%)

Query: 8   ALFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRF 65
            L+L +P    A + L  +++ P      +W   V+T    T L+  P +L+M+T F R 
Sbjct: 11  GLWLFSPA---AAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRI 67

Query: 66  IIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAI 125
           IIVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A+
Sbjct: 68  IIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEAL 127

Query: 126 QRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSF 185
            + A+P   FM   TRE DL+LF  +A+S      +   + +  RIL+P+++ SEL+ +F
Sbjct: 128 DKGAQPLCAFMLRQTREADLALFARLANSG----PLQGPEAVPMRILLPAYVTSELKTAF 183

Query: 186 EIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 184 QIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|323961992|gb|EGB57591.1| flagellar biosynthetic protein FliP [Escherichia coli H489]
          Length = 245

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 101/237 (42%), Positives = 155/237 (65%), Gaps = 5/237 (2%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIV 68
           L+LVTP L FA+    +   +P      +  V+T    T L+  P +L+M+T F R IIV
Sbjct: 12  LWLVTP-LAFAQLPGINSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRIIIV 70

Query: 69  FSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRV 128
           F +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A+++ 
Sbjct: 71  FGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALEKG 130

Query: 129 AEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIG 188
           A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+IG
Sbjct: 131 AQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQIG 186

Query: 189 FLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           F I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 187 FTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|218689943|ref|YP_002398155.1| flagellar biosynthesis protein FliP [Escherichia coli ED1a]
 gi|300818632|ref|ZP_07098840.1| flagellar biosynthetic protein FliP [Escherichia coli MS 107-1]
 gi|218427507|emb|CAR08402.2| flagellar biosynthesis protein [Escherichia coli ED1a]
 gi|300528804|gb|EFK49866.1| flagellar biosynthetic protein FliP [Escherichia coli MS 107-1]
          Length = 245

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 157/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+LVTP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLVTP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|254487121|ref|ZP_05100326.1| flagellar biosynthetic protein FliP [Roseobacter sp. GAI101]
 gi|214043990|gb|EEB84628.1| flagellar biosynthetic protein FliP [Roseobacter sp. GAI101]
          Length = 245

 Score =  195 bits (495), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 141/212 (66%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           ++S   ++ F + T+LS+AP + +MVTCFP  + V SILR  +G+   PPN++I+SLALF
Sbjct: 36  ALSARTIQLFVLITVLSLAPGIAVMVTCFPFLVTVLSILRQAIGLQQSPPNMLIVSLALF 95

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T+++M P    + E G++PL N QI   TA  +  EPF  FM       D + F  MA 
Sbjct: 96  LTYFIMEPVFTAAWENGLEPLANEQIDVETAFAQAMEPFRQFMVGRL---DPATFTAMAE 152

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                  +  +      +L+PSFM+SE+ R+F+IGFL+ LPFLIID++VA I+M+MGMMM
Sbjct: 153 LRPDTAGLALDLDAPLSVLVPSFMLSEITRAFQIGFLVYLPFLIIDLVVAAILMSMGMMM 212

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +PP  +SLPFK+ FFV+ DGWSL+  +LV+S+
Sbjct: 213 VPPAVVSLPFKLAFFVVADGWSLIAGSLVRSY 244


>gi|296157442|ref|ZP_06840277.1| flagellar biosynthetic protein FliP [Burkholderia sp. Ch1-1]
 gi|295892214|gb|EFG71997.1| flagellar biosynthetic protein FliP [Burkholderia sp. Ch1-1]
          Length = 279

 Score =  195 bits (495), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 100/234 (42%), Positives = 152/234 (64%), Gaps = 7/234 (2%)

Query: 16  LVFAKSSLHDVMNI---PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSIL 72
           L FA+++     N    P   +  +  V+T  + T+LS  P +++M+T F R IIV S+L
Sbjct: 50  LSFAQAAGLPAFNTSPGPNGGTTYSLSVQTMLLLTMLSFLPAMVLMMTSFTRIIIVLSLL 109

Query: 73  RTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPF 132
           R  +G  + PPN V++ LALF+T +VMSP LD++   G +P  +  I   TA+ R   PF
Sbjct: 110 RQALGTTTTPPNQVLVGLALFLTLFVMSPVLDKAYTDGYKPFSDGSIPMETAVNRGLAPF 169

Query: 133 WVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLII 192
             FM   TRE DL+LF  ++H++     +   + +   +L+PSF+ SEL+  F+IGF I 
Sbjct: 170 KTFMLRQTRESDLALFARISHAA----PMQGPEDVPLSLLVPSFVTSELKTGFQIGFTIF 225

Query: 193 LPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           +PFLIIDM+VA+++M+MGMMM+ P +ISLPFK++ FVL+DGW LL+ +L +SF+
Sbjct: 226 IPFLIIDMVVASVLMSMGMMMVSPATISLPFKLMLFVLVDGWQLLLGSLAQSFV 279


>gi|188997535|ref|YP_001931786.1| flagellar biosynthetic protein FliP [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188932602|gb|ACD67232.1| flagellar biosynthetic protein FliP [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 337

 Score =  195 bits (495), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 135/196 (68%), Gaps = 5/196 (2%)

Query: 50  SIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEM 109
           SIAP LLI VT F R +IV S+LR  +G+ + PPN VI+ LALF+T +VM PT D+  E+
Sbjct: 146 SIAPALLISVTAFVRIVIVLSLLRHALGIPTAPPNQVIVGLALFLTIFVMKPTFDKINEV 205

Query: 110 GIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEY 169
            I P +  QI++  AI+   EP   FM  NTR++DL LF+D+A     N        I  
Sbjct: 206 SISPYLKKQISDIQAIENAKEPLKEFMLKNTRKEDLKLFLDLA-----NEKPLSPKDISI 260

Query: 170 RILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFV 229
             LIP+FMISE++ +FEI F+I LPFL+ID IVA+I+M+MGMMM+PP  ISLPFK++ FV
Sbjct: 261 STLIPAFMISEIKTAFEIVFIIYLPFLVIDFIVASILMSMGMMMIPPMFISLPFKLMLFV 320

Query: 230 LIDGWSLLVENLVKSF 245
           L DG+ LLV+ LV S+
Sbjct: 321 LADGFELLVKALVSSY 336


>gi|170019719|ref|YP_001724673.1| flagellar biosynthesis protein FliP [Escherichia coli ATCC 8739]
 gi|187730211|ref|YP_001879727.1| flagellar biosynthesis protein FliP [Shigella boydii CDC 3083-94]
 gi|209919370|ref|YP_002293454.1| flagellar biosynthesis protein FliP [Escherichia coli SE11]
 gi|218705441|ref|YP_002412960.1| flagellar biosynthesis protein FliP [Escherichia coli UMN026]
 gi|260855923|ref|YP_003229814.1| flagellar biosynthesis protein FliP [Escherichia coli O26:H11 str.
           11368]
 gi|260868541|ref|YP_003234943.1| flagellar biosynthesis protein FliP [Escherichia coli O111:H- str.
           11128]
 gi|293405431|ref|ZP_06649423.1| flagellar biosynthetic protein fliP [Escherichia coli FVEC1412]
 gi|298381075|ref|ZP_06990674.1| flagellar biosynthetic protein fliP [Escherichia coli FVEC1302]
 gi|300822282|ref|ZP_07102423.1| flagellar biosynthetic protein FliP [Escherichia coli MS 119-7]
 gi|300899205|ref|ZP_07117481.1| flagellar biosynthetic protein FliP [Escherichia coli MS 198-1]
 gi|300904838|ref|ZP_07122664.1| flagellar biosynthetic protein FliP [Escherichia coli MS 84-1]
 gi|300931161|ref|ZP_07146508.1| flagellar biosynthetic protein FliP [Escherichia coli MS 187-1]
 gi|300951573|ref|ZP_07165406.1| flagellar biosynthetic protein FliP [Escherichia coli MS 116-1]
 gi|300956536|ref|ZP_07168818.1| flagellar biosynthetic protein FliP [Escherichia coli MS 175-1]
 gi|301018202|ref|ZP_07182717.1| flagellar biosynthetic protein FliP [Escherichia coli MS 69-1]
 gi|301304257|ref|ZP_07210372.1| flagellar biosynthetic protein FliP [Escherichia coli MS 124-1]
 gi|301327735|ref|ZP_07220940.1| flagellar biosynthetic protein FliP [Escherichia coli MS 78-1]
 gi|301644593|ref|ZP_07244582.1| flagellar biosynthetic protein FliP [Escherichia coli MS 146-1]
 gi|307312466|ref|ZP_07592100.1| flagellar biosynthetic protein FliP [Escherichia coli W]
 gi|312967145|ref|ZP_07781363.1| flagellar biosynthetic protein FliP [Escherichia coli 2362-75]
 gi|331668639|ref|ZP_08369487.1| flagellar biosynthetic protein FliP [Escherichia coli TA271]
 gi|331673461|ref|ZP_08374229.1| flagellar biosynthetic protein FliP [Escherichia coli TA280]
 gi|169754647|gb|ACA77346.1| flagellar biosynthetic protein FliP [Escherichia coli ATCC 8739]
 gi|187427203|gb|ACD06477.1| flagellar biosynthetic protein FliP [Shigella boydii CDC 3083-94]
 gi|209912629|dbj|BAG77703.1| flagellar biosynthetic protein FliP [Escherichia coli SE11]
 gi|218432538|emb|CAR13431.1| flagellar biosynthesis protein [Escherichia coli UMN026]
 gi|257754572|dbj|BAI26074.1| flagellar biosynthesis protein FliP [Escherichia coli O26:H11 str.
           11368]
 gi|257764897|dbj|BAI36392.1| flagellar biosynthesis protein FliP [Escherichia coli O111:H- str.
           11128]
 gi|291427639|gb|EFF00666.1| flagellar biosynthetic protein fliP [Escherichia coli FVEC1412]
 gi|298278517|gb|EFI20031.1| flagellar biosynthetic protein fliP [Escherichia coli FVEC1302]
 gi|300316636|gb|EFJ66420.1| flagellar biosynthetic protein FliP [Escherichia coli MS 175-1]
 gi|300357186|gb|EFJ73056.1| flagellar biosynthetic protein FliP [Escherichia coli MS 198-1]
 gi|300399789|gb|EFJ83327.1| flagellar biosynthetic protein FliP [Escherichia coli MS 69-1]
 gi|300403265|gb|EFJ86803.1| flagellar biosynthetic protein FliP [Escherichia coli MS 84-1]
 gi|300449200|gb|EFK12820.1| flagellar biosynthetic protein FliP [Escherichia coli MS 116-1]
 gi|300461018|gb|EFK24511.1| flagellar biosynthetic protein FliP [Escherichia coli MS 187-1]
 gi|300525165|gb|EFK46234.1| flagellar biosynthetic protein FliP [Escherichia coli MS 119-7]
 gi|300840514|gb|EFK68274.1| flagellar biosynthetic protein FliP [Escherichia coli MS 124-1]
 gi|300845735|gb|EFK73495.1| flagellar biosynthetic protein FliP [Escherichia coli MS 78-1]
 gi|301077068|gb|EFK91874.1| flagellar biosynthetic protein FliP [Escherichia coli MS 146-1]
 gi|306907637|gb|EFN38140.1| flagellar biosynthetic protein FliP [Escherichia coli W]
 gi|309702237|emb|CBJ01554.1| flagellar biosynthetic protein FliP [Escherichia coli ETEC H10407]
 gi|312288609|gb|EFR16511.1| flagellar biosynthetic protein FliP [Escherichia coli 2362-75]
 gi|315061248|gb|ADT75575.1| flagellar biosynthesis protein [Escherichia coli W]
 gi|315257220|gb|EFU37188.1| flagellar biosynthetic protein FliP [Escherichia coli MS 85-1]
 gi|323152721|gb|EFZ38993.1| flagellar biosynthetic protein FliP [Escherichia coli EPECa14]
 gi|323180799|gb|EFZ66339.1| flagellar biosynthetic protein FliP [Escherichia coli 1180]
 gi|323378175|gb|ADX50443.1| flagellar biosynthetic protein FliP [Escherichia coli KO11]
 gi|323937218|gb|EGB33498.1| flagellar biosynthetic protein FliP [Escherichia coli E1520]
 gi|323940393|gb|EGB36584.1| flagellar biosynthetic protein FliP [Escherichia coli E482]
 gi|323968364|gb|EGB63771.1| flagellar biosynthetic protein FliP [Escherichia coli M863]
 gi|323977871|gb|EGB72957.1| flagellar biosynthetic protein FliP [Escherichia coli TW10509]
 gi|324118997|gb|EGC12886.1| flagellar biosynthetic protein FliP [Escherichia coli E1167]
 gi|327253080|gb|EGE64734.1| flagellar biosynthetic protein FliP [Escherichia coli STEC_7v]
 gi|331063833|gb|EGI35744.1| flagellar biosynthetic protein FliP [Escherichia coli TA271]
 gi|331069659|gb|EGI41046.1| flagellar biosynthetic protein FliP [Escherichia coli TA280]
 gi|332093095|gb|EGI98159.1| flagellar biosynthetic protein FliP [Shigella boydii 5216-82]
          Length = 245

 Score =  195 bits (495), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 157/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+LVTP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLVTP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|269139497|ref|YP_003296198.1| flagellar biosynthesis pathway, component FliP [Edwardsiella tarda
           EIB202]
 gi|267985158|gb|ACY84987.1| flagellar biosynthesis pathway, component FliP [Edwardsiella tarda
           EIB202]
 gi|304559386|gb|ADM42050.1| Flagellar biosynthesis protein FliP [Edwardsiella tarda FL6-60]
          Length = 246

 Score =  194 bits (494), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 141/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T LS  P  L+++T F R IIV  +LR  +G  S PPN V++ LALF+TF++M
Sbjct: 43  VQTLVFLTSLSFLPAALLLMTSFTRIIIVLGLLRNALGTPSAPPNQVLLGLALFLTFFIM 102

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD+  +   QP    +I+  TA+ R A+P   FM   TRE DL+LF  +A    +  
Sbjct: 103 SPVLDKIYQDAYQPFSEQKISMETALDRGAKPLRAFMLRQTRETDLALFSRLA----KQP 158

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           ++   + +  RIL+P+++ SEL+ +F+IGF + +PFLIID++VA+++MA+GMMM+PP +I
Sbjct: 159 EMQGPEDVPMRILLPAYVTSELKTAFQIGFTVFIPFLIIDLVVASVLMALGMMMVPPATI 218

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 219 SLPFKLMLFVLVDGWQLLLGSLAQSF 244


>gi|325525522|gb|EGD03321.1| flagellar biosynthesis protein FliP [Burkholderia sp. TJI49]
          Length = 229

 Score =  194 bits (494), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +++M+T F R IIV S+LR  +G  + PPN V++ LALF+TF+VM
Sbjct: 27  VQTMLLLTMLSFLPAMVLMMTSFTRIIIVLSLLRQALGTATTPPNQVLVGLALFLTFFVM 86

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+   G +P  +  +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 87  SPVLDRAYTDGYKPFSDGSVPMEQAVQRGLAPFKGFMLKQTRETDLALFAKISKAAP--- 143

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P+++
Sbjct: 144 -MQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPSTV 202

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 203 SLPFKLMLFVLVDGWQLLIGSLAQSF 228


>gi|302343742|ref|YP_003808271.1| flagellar biosynthetic protein FliP [Desulfarculus baarsii DSM
           2075]
 gi|301640355|gb|ADK85677.1| flagellar biosynthetic protein FliP [Desulfarculus baarsii DSM
           2075]
          Length = 258

 Score =  194 bits (494), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 92/202 (45%), Positives = 142/202 (70%), Gaps = 6/202 (2%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+L++AP +L+M T F R  + FS+LR  +G   VPP  +I+ L+LF+TF++M+P  D
Sbjct: 61  LLTVLTLAPAILVMTTSFVRIAVSFSLLRNALGAPQVPPTQIIVGLSLFLTFFIMAPVFD 120

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  +  ++P ++  I+++   +  A+P   FM   TR+KDL LFM +A       D  +N
Sbjct: 121 QVHDKALKPYLDGAISQSAFFEEAAKPMREFMLKQTRKKDLGLFMKIA-----GEDRPRN 175

Query: 165 DH-IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPF 223
           +  +    L+P+F+ISELR +FEIGFL+ +PFL+IDM+VA+++++MGMMMLPP  ISLPF
Sbjct: 176 EQDVTMSALVPAFVISELRTAFEIGFLLYVPFLVIDMVVASVLLSMGMMMLPPVMISLPF 235

Query: 224 KVIFFVLIDGWSLLVENLVKSF 245
           K++ FVL+DGW LLV +LV+SF
Sbjct: 236 KLMLFVLVDGWYLLVGSLVRSF 257


>gi|16760923|ref|NP_456540.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29141385|ref|NP_804727.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|62180554|ref|YP_216971.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161502899|ref|YP_001570011.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|167552788|ref|ZP_02346539.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|168234152|ref|ZP_02659210.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168239219|ref|ZP_02664277.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168462479|ref|ZP_02696410.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168823022|ref|ZP_02835022.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194444637|ref|YP_002041244.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194468817|ref|ZP_03074801.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194737682|ref|YP_002115013.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197247593|ref|YP_002146044.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197264056|ref|ZP_03164130.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198244709|ref|YP_002215107.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200391063|ref|ZP_03217674.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204931035|ref|ZP_03221861.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|207856508|ref|YP_002243159.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213023112|ref|ZP_03337559.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213163376|ref|ZP_03349086.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213417182|ref|ZP_03350326.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213424995|ref|ZP_03357745.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213584779|ref|ZP_03366605.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213650743|ref|ZP_03380796.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213855268|ref|ZP_03383508.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224583522|ref|YP_002637320.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|25316655|pir||AD0753 flagellar biosynthetic protein FliP [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503220|emb|CAD05727.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137012|gb|AAO68576.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|62128187|gb|AAX65890.1| flagellar biosynthesis [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|160864246|gb|ABX20869.1| hypothetical protein SARI_00958 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|194403300|gb|ACF63522.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194455181|gb|EDX44020.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194713184|gb|ACF92405.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195634044|gb|EDX52396.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197211296|gb|ACH48693.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197242311|gb|EDY24931.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197288073|gb|EDY27460.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197939225|gb|ACH76558.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199603508|gb|EDZ02054.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204320079|gb|EDZ05284.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205322623|gb|EDZ10462.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205331887|gb|EDZ18651.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205340666|gb|EDZ27430.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|206708311|emb|CAR32614.1| flagellar biosynthetic protein flip precursor [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|224468049|gb|ACN45879.1| flagellar biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|320085402|emb|CBY95183.1| Flagellar biosynthetic protein fliP Flagellar biosynthetic protein
           mopC [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|322715030|gb|EFZ06601.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|326622855|gb|EGE29200.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 245

 Score =  194 bits (494), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 100/240 (41%), Positives = 155/240 (64%), Gaps = 9/240 (3%)

Query: 8   ALFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRF 65
            L+L +P    A + L  +++ P      +W   V+T    T L+  P +L+M+T F R 
Sbjct: 11  GLWLFSPA---AAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRI 67

Query: 66  IIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAI 125
           IIVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A+
Sbjct: 68  IIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEAL 127

Query: 126 QRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSF 185
            + A+P   FM   TRE DL+LF  +A+S      +   + +  RIL+P+++ SEL+ +F
Sbjct: 128 DKGAQPLRAFMLRQTREADLALFARLANSG----PLQGPEAVPMRILLPAYVTSELKTAF 183

Query: 186 EIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 184 QIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|118443404|ref|YP_877989.1| flagellar biosynthesis protein FliP [Clostridium novyi NT]
 gi|118133860|gb|ABK60904.1| flagellar biosynthetic protein fliP [Clostridium novyi NT]
          Length = 257

 Score =  194 bits (494), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 144/201 (71%), Gaps = 3/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T++S+ P  L+M+T F R I+V   +R  +G    PPN +++ LALF+T ++M+PT  
Sbjct: 58  MLTVISLLPSFLVMMTSFTRIIVVLGFMRNALGTQQAPPNQILVGLALFLTIFIMTPTYK 117

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
              +  I+P + N+IT+T A+   A+P   FM   TR+KDL LF+D++ +  +N  ITK 
Sbjct: 118 TINKEAIKPFLENKITQTEALNNAAKPMREFMLKQTRDKDLELFLDVSKTDKKN--ITK- 174

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           +++   ++IPSF+ISEL+ +F+IGFL+ +PFLIID++VA+++M+MGM MLPP  ISLPFK
Sbjct: 175 ENVPMYVVIPSFIISELKTAFKIGFLLFVPFLIIDIVVASVLMSMGMFMLPPVMISLPFK 234

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FV++DGW LLV++LV  +
Sbjct: 235 LLLFVMVDGWYLLVKSLVMGY 255


>gi|325497690|gb|EGC95549.1| flagellar biosynthesis protein FliP [Escherichia fergusonii ECD227]
          Length = 245

 Score =  194 bits (494), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 156/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+LVTP    A + L  ++  P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLVTP---CALAQLPGLVTQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL+LF  +A++      I   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLALFARLANTG----PIQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|322378387|ref|ZP_08052842.1| flagellar biosynthesis protein FliP [Helicobacter suis HS1]
 gi|322380261|ref|ZP_08054481.1| flagellar biosynthesis protein FliP [Helicobacter suis HS5]
 gi|321147298|gb|EFX41978.1| flagellar biosynthesis protein FliP [Helicobacter suis HS5]
 gi|321149200|gb|EFX43645.1| flagellar biosynthesis protein FliP [Helicobacter suis HS1]
          Length = 250

 Score =  194 bits (494), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 99/195 (50%), Positives = 139/195 (71%), Gaps = 6/195 (3%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP L++++T F R I+VFS LRT +G    PP  +++SLAL +TF++M P   +S E  I
Sbjct: 57  APSLVLVMTSFIRLIVVFSFLRTALGTQQTPPTQILVSLALILTFFIMEPAAKQSYESAI 116

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN-DHIEYR 170
           +P +  +I+ T A ++   PF  FM  NTREKDL+LF  +     R  +  KN   +   
Sbjct: 117 KPYLVEKISYTEAFEKGIVPFKEFMLKNTREKDLALFFRI-----RRLENPKNASAVPLN 171

Query: 171 ILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVL 230
           IL+P+FMISEL+ +F+IGFL+ LPFL+IDM+V++I+MAMGMMMLPP  ISLPFK++ F+L
Sbjct: 172 ILVPAFMISELKTAFQIGFLLYLPFLVIDMVVSSILMAMGMMMLPPVMISLPFKILVFIL 231

Query: 231 IDGWSLLVENLVKSF 245
           +DG++LLVENLV SF
Sbjct: 232 VDGFNLLVENLVASF 246


>gi|126738561|ref|ZP_01754266.1| flagellar biosynthetic protein FliP [Roseobacter sp. SK209-2-6]
 gi|126720360|gb|EBA17066.1| flagellar biosynthetic protein FliP [Roseobacter sp. SK209-2-6]
          Length = 247

 Score =  194 bits (494), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 97/212 (45%), Positives = 142/212 (66%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           SIS   ++   + T+LS+AP +LIM+TCFP  + V SILR G+G+   PPN+++ISLALF
Sbjct: 37  SISARSIQLILLITVLSLAPGMLIMITCFPFLVTVLSILRQGLGLQQAPPNMLMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T++VM P    + + GI PL+  QI   T + R  EPF  FM N           D+  
Sbjct: 97  LTYFVMEPVFTEAWQTGISPLIEEQIDVETGLIRSLEPFRGFMANRLDPDTFYAIADL-R 155

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            + +  D T +  I   +L+PSF++SE+ R+F+IGFL+ LPFL+ID++VA ++M+MGMMM
Sbjct: 156 PATKGIDPTVDAPIS--VLVPSFLLSEIARAFQIGFLVFLPFLVIDLVVAAVLMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +PP  +SLPFK+ FFV+ DGWSL+   LV+S+
Sbjct: 214 VPPAVVSLPFKLAFFVVADGWSLIATALVRSY 245


>gi|218549273|ref|YP_002383064.1| flagellar biosynthesis protein FliP [Escherichia fergusonii ATCC
           35469]
 gi|218356814|emb|CAQ89442.1| flagellar biosynthesis protein [Escherichia fergusonii ATCC 35469]
          Length = 245

 Score =  194 bits (494), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 156/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+LVTP    A + L  ++  P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLVTP---CALAQLPGLVTQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL+LF  +A++      I   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLALFARLANTG----PIQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|294678995|ref|YP_003579610.1| flagellar biosynthetic protein FliP [Rhodobacter capsulatus SB
           1003]
 gi|294477815|gb|ADE87203.1| flagellar biosynthetic protein FliP [Rhodobacter capsulatus SB
           1003]
          Length = 240

 Score =  194 bits (494), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 134/199 (67%), Gaps = 3/199 (1%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+LS+AP L IMVTCFP  + V SILR  MG+   PPN++IISLALF+T++VM PT   S
Sbjct: 44  TLLSLAPGLAIMVTCFPFIVTVLSILRQAMGLQQSPPNMLIISLALFLTWFVMEPTFMAS 103

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            + GI+PL+  +I   TA +R  EPF +FM   T   D   F  +A      T       
Sbjct: 104 YQAGIEPLIAQKIDIVTAFERGVEPFRIFMAGRT---DPETFTQLAAIREGATYTGTARE 160

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
               IL+PSFM+SE+ R+FEIGFL+ LPFLIID++V+ I+M+MGMMM+PP  ++LPFK+ 
Sbjct: 161 APLSILVPSFMLSEITRAFEIGFLVFLPFLIIDLVVSAILMSMGMMMVPPAVVALPFKLA 220

Query: 227 FFVLIDGWSLLVENLVKSF 245
           FFV+ +GW LL   LV+S+
Sbjct: 221 FFVVANGWVLLSGALVRSY 239


>gi|268679749|ref|YP_003304180.1| flagellar biosynthetic protein FliP [Sulfurospirillum deleyianum
           DSM 6946]
 gi|268617780|gb|ACZ12145.1| flagellar biosynthetic protein FliP [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 238

 Score =  194 bits (494), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 95/195 (48%), Positives = 141/195 (72%), Gaps = 6/195 (3%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP L+ M+T F R +IVFS LR  +G   +PP+ V++SLA+ +TF++M P +  S ++ I
Sbjct: 48  APSLIFMMTSFLRLLIVFSFLRQALGTQQMPPSQVMVSLAMILTFFIMEPVMKESYDVAI 107

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN-DHIEYR 170
           +P +  +++   A ++ + PF  FM  NTREKDL+LF  +     RN +  KN + +   
Sbjct: 108 KPYLAEKMSYQEAFEKGSAPFKAFMIRNTREKDLALFFRI-----RNLENPKNIEDVPLT 162

Query: 171 ILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVL 230
           + +P+FMISEL+ +FEIGFL+ LPFL+IDM+V++++MAMGMMMLPP  ISLPFK++ FVL
Sbjct: 163 VAMPAFMISELKTAFEIGFLLYLPFLVIDMVVSSVLMAMGMMMLPPAMISLPFKLLIFVL 222

Query: 231 IDGWSLLVENLVKSF 245
           +DGW+LLV+ LV+SF
Sbjct: 223 VDGWNLLVQRLVESF 237


>gi|317051545|ref|YP_004112661.1| flagellar biosynthetic protein FliP [Desulfurispirillum indicum S5]
 gi|316946629|gb|ADU66105.1| flagellar biosynthetic protein FliP [Desulfurispirillum indicum S5]
          Length = 253

 Score =  194 bits (494), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 139/195 (71%), Gaps = 4/195 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +L+++T F R +IV S LR  MG    PPN V++SLALF+TFY+M PT  +  ++ +
Sbjct: 61  APSILVLMTSFVRILIVLSFLRQAMGTMQSPPNQVLVSLALFLTFYIMMPTFQQINDVAL 120

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QP +N +I    A+   A P   FM  +TREKDL+LF+   H S      TK D + +  
Sbjct: 121 QPYLNQEIGTQEALDNAARPLSEFMLKHTREKDLALFV---HFSGDERPATKED-VSFFT 176

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F+ISEL+ +F++GF+I +PFLIIDM+VA+ +M+MGMMMLPP  IS+PFKVI FVL+
Sbjct: 177 LVPAFVISELKTAFQMGFMIFIPFLIIDMVVASTLMSMGMMMLPPAMISMPFKVILFVLV 236

Query: 232 DGWSLLVENLVKSFI 246
           DGW+L++ +L++SF+
Sbjct: 237 DGWNLVMSSLLRSFV 251


>gi|296273474|ref|YP_003656105.1| flagellar biosynthetic protein FliP [Arcobacter nitrofigilis DSM
           7299]
 gi|296097648|gb|ADG93598.1| flagellar biosynthetic protein FliP [Arcobacter nitrofigilis DSM
           7299]
          Length = 242

 Score =  194 bits (494), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 133/194 (68%), Gaps = 6/194 (3%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P LL+MVT F R IIV S+LR  MG+   PPN ++IS+AL +T ++M P    S   GI+
Sbjct: 53  PTLLLMVTSFTRLIIVLSLLRQAMGLQQAPPNQIVISMALILTIFIMEPYAKTSYNEGIK 112

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN-DHIEYRI 171
           P M  +I    A  +  +PF  FM  NTRE+D++LF  +    +      KN D +   +
Sbjct: 113 PYMEEKIGYEEAFAKSVKPFKEFMIKNTREEDIALFYRIKKEKN-----PKNIDDVALTL 167

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F++SELR +FEIGFLI LPFL+ID+IVA+I+M++GMMMLPP  ISLP KVIFF++I
Sbjct: 168 LMPAFIVSELRTAFEIGFLIFLPFLVIDIIVASILMSLGMMMLPPVMISLPIKVIFFIII 227

Query: 232 DGWSLLVENLVKSF 245
           DGW L++ NL +SF
Sbjct: 228 DGWQLIIGNLAQSF 241


>gi|146312185|ref|YP_001177259.1| flagellar biosynthesis protein FliP [Enterobacter sp. 638]
 gi|145319061|gb|ABP61208.1| flagellar biosynthetic protein FliP [Enterobacter sp. 638]
          Length = 245

 Score =  194 bits (494), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 150/227 (66%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  +++ P      +W   V+T    T L+  P +L+M+T F R IIVF +LR  +G 
Sbjct: 21  AQLPGLISTPMAGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRIIIVFGLLRNALGT 80

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ LALF+TF++MSP +D+      QP   ++I+   A+++ A+P   FM  
Sbjct: 81  PSAPPNQVLLGLALFLTFFIMSPVIDKIYADAYQPFSEDKISMQVALEKGAQPLREFMLR 140

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+LF  +A+       I   + +  RIL+P+++ SEL+ +F+IGF I +PFLII
Sbjct: 141 QTREADLALFARLANEG----PIQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLII 196

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 197 DLVIASVLMALGMMMVPPATIALPFKIMLFVLVDGWQLLVGSLAQSF 243


>gi|238916764|ref|YP_002930281.1| triacylglycerol lipase [Eubacterium eligens ATCC 27750]
 gi|238872124|gb|ACR71834.1| triacylglycerol lipase [Eubacterium eligens ATCC 27750]
          Length = 267

 Score =  194 bits (493), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 137/201 (68%), Gaps = 2/201 (0%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T++S+AP +LIM+T F R +IV    R  +G  +VPPN VII L+LF+TF+VMSPT  
Sbjct: 68  VLTVISLAPSILIMLTSFTRIVIVLHFTRAAIGTQTVPPNQVIIGLSLFLTFFVMSPTFT 127

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
              +  ++PL NN+I+   A +   +P   FM   T  KDL  F  +A   +    +T  
Sbjct: 128 EIYDSALKPLSNNEISVEEAYETGVKPLKTFMLKQTSTKDLDTFFKIA--GYEEGSVTSE 185

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D I   +L+PSF+ISELR +F IGFLI +PF+IIDM+V++ +M+MGMMMLPPT+IS PFK
Sbjct: 186 DDISMTVLVPSFIISELRIAFIIGFLIYIPFIIIDMVVSSTLMSMGMMMLPPTTISAPFK 245

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FV+ DGW+L++ NL+ +F
Sbjct: 246 ILLFVMADGWNLIIGNLITTF 266


>gi|322806978|emb|CBZ04548.1| flagellar biosynthesis protein FliP [Clostridium botulinum H04402
           065]
          Length = 258

 Score =  194 bits (493), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 97/199 (48%), Positives = 140/199 (70%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+L++ P  ++M+T F R I+VF  LR  MG    PPN V+I LALF+T ++M P     
Sbjct: 63  TVLTLLPSFIVMMTSFVRTIVVFGFLRNAMGTQQSPPNQVMIGLALFLTLFIMQPVYSEI 122

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
               IQP M N+IT+  A++  A+P   FM   TR+KDL LF+D+A     N  +TK++ 
Sbjct: 123 NTKAIQPYMKNKITQEQAVEIGAKPLRQFMLKQTRQKDLKLFVDLAKP---NFKVTKDNA 179

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
             Y I++P+F+ISEL+ +F+IGFL+ +PFLIID++VA+++M+MGM MLPP  ISLPFK++
Sbjct: 180 PLY-IVVPAFIISELKTAFQIGFLLFIPFLIIDLVVASVLMSMGMFMLPPVMISLPFKLL 238

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FV++DGW LLV++LV SF
Sbjct: 239 LFVMVDGWYLLVKSLVMSF 257


>gi|322616972|gb|EFY13880.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618211|gb|EFY15103.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625882|gb|EFY22701.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626334|gb|EFY23144.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632749|gb|EFY29494.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322639091|gb|EFY35784.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322640407|gb|EFY37063.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647232|gb|EFY43731.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649920|gb|EFY46341.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655528|gb|EFY51836.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660306|gb|EFY56544.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662987|gb|EFY59194.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668172|gb|EFY64331.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674069|gb|EFY70163.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675579|gb|EFY71653.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683010|gb|EFY79026.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686704|gb|EFY82682.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323195408|gb|EFZ80588.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198064|gb|EFZ83181.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204464|gb|EFZ89470.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207554|gb|EFZ92502.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211007|gb|EFZ95867.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217539|gb|EGA02258.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220728|gb|EGA05172.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226685|gb|EGA10882.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323231561|gb|EGA15674.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323236004|gb|EGA20083.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240574|gb|EGA24617.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245466|gb|EGA29466.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323247584|gb|EGA31535.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253953|gb|EGA37777.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255519|gb|EGA39280.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262117|gb|EGA45680.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266240|gb|EGA49730.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323270651|gb|EGA54092.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 245

 Score =  194 bits (493), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 100/240 (41%), Positives = 155/240 (64%), Gaps = 9/240 (3%)

Query: 8   ALFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRF 65
            L+L +P    A + L  +++ P      +W   V+T    T L+  P +L+M+T F R 
Sbjct: 11  GLWLFSPT---AAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRI 67

Query: 66  IIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAI 125
           IIVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A+
Sbjct: 68  IIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEAL 127

Query: 126 QRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSF 185
            + A+P   FM   TRE DL+LF  +A+S      +   + +  RIL+P+++ SEL+ +F
Sbjct: 128 DKGAQPLRAFMLRQTREADLALFARLANSG----PLQGPEAVPMRILLPAYVTSELKTAF 183

Query: 186 EIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 184 QIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|15802383|ref|NP_288409.1| flagellar biosynthesis protein FliP [Escherichia coli O157:H7
           EDL933]
 gi|15831941|ref|NP_310714.1| flagellar biosynthesis protein FliP [Escherichia coli O157:H7 str.
           Sakai]
 gi|16129895|ref|NP_416458.1| flagellar biosynthesis protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89108780|ref|AP_002560.1| flagellar biosynthesis protein [Escherichia coli str. K-12 substr.
           W3110]
 gi|157156523|ref|YP_001463250.1| flagellar biosynthesis protein FliP [Escherichia coli E24377A]
 gi|168751877|ref|ZP_02776899.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758262|ref|ZP_02783269.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764426|ref|ZP_02789433.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4501]
 gi|168771555|ref|ZP_02796562.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777375|ref|ZP_02802382.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783345|ref|ZP_02808352.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4076]
 gi|168790292|ref|ZP_02815299.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC869]
 gi|168802295|ref|ZP_02827302.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC508]
 gi|170081592|ref|YP_001730912.1| flagellar biosynthesis protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170682430|ref|YP_001743297.1| flagellar biosynthesis protein FliP [Escherichia coli SMS-3-5]
 gi|191168304|ref|ZP_03030097.1| flagellar biosynthetic protein FliP [Escherichia coli B7A]
 gi|193066380|ref|ZP_03047428.1| flagellar biosynthetic protein FliP [Escherichia coli E22]
 gi|193071148|ref|ZP_03052072.1| flagellar biosynthetic protein FliP [Escherichia coli E110019]
 gi|194429937|ref|ZP_03062447.1| flagellar biosynthetic protein FliP [Escherichia coli B171]
 gi|194439571|ref|ZP_03071644.1| flagellar biosynthetic protein FliP [Escherichia coli 101-1]
 gi|195939254|ref|ZP_03084636.1| flagellar biosynthesis protein FliP [Escherichia coli O157:H7 str.
           EC4024]
 gi|208810650|ref|ZP_03252526.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816935|ref|ZP_03258055.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4045]
 gi|208819585|ref|ZP_03259905.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400543|ref|YP_002271065.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4115]
 gi|217328816|ref|ZP_03444897.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           TW14588]
 gi|218554528|ref|YP_002387441.1| flagellar biosynthesis protein FliP [Escherichia coli IAI1]
 gi|218695553|ref|YP_002403220.1| flagellar biosynthesis protein FliP [Escherichia coli 55989]
 gi|237705907|ref|ZP_04536388.1| flagellar biosynthetic protein fliP [Escherichia sp. 3_2_53FAA]
 gi|238901153|ref|YP_002926949.1| flagellar biosynthesis protein [Escherichia coli BW2952]
 gi|253773103|ref|YP_003035934.1| flagellar biosynthesis protein FliP [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254793598|ref|YP_003078435.1| flagellar biosynthesis protein FliP [Escherichia coli O157:H7 str.
           TW14359]
 gi|256017859|ref|ZP_05431724.1| flagellar biosynthesis protein FliP [Shigella sp. D9]
 gi|256022394|ref|ZP_05436259.1| flagellar biosynthesis protein FliP [Escherichia sp. 4_1_40B]
 gi|260844347|ref|YP_003222125.1| flagellar biosynthesis protein FliP [Escherichia coli O103:H2 str.
           12009]
 gi|261227557|ref|ZP_05941838.1| flagellar biosynthesis protein [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254619|ref|ZP_05947152.1| flagellar biosynthesis protein FliP [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283125|ref|YP_003499943.1| Flagellar biosynthetic protein fliP precursor [Escherichia coli
           O55:H7 str. CB9615]
 gi|293415258|ref|ZP_06657901.1| flagellar biosynthetic protein FliP [Escherichia coli B185]
 gi|293446328|ref|ZP_06662750.1| flagellar biosynthetic protein FliP [Escherichia coli B088]
 gi|300920167|ref|ZP_07136617.1| flagellar biosynthetic protein FliP [Escherichia coli MS 115-1]
 gi|300923889|ref|ZP_07139904.1| flagellar biosynthetic protein FliP [Escherichia coli MS 182-1]
 gi|301029405|ref|ZP_07192499.1| flagellar biosynthetic protein FliP [Escherichia coli MS 196-1]
 gi|307138615|ref|ZP_07497971.1| flagellar biosynthesis protein FliP [Escherichia coli H736]
 gi|309795945|ref|ZP_07690358.1| flagellar biosynthetic protein FliP [Escherichia coli MS 145-7]
 gi|312973835|ref|ZP_07788007.1| flagellar biosynthetic protein FliP [Escherichia coli 1827-70]
 gi|331642569|ref|ZP_08343704.1| flagellar biosynthetic protein FliP [Escherichia coli H736]
 gi|331677830|ref|ZP_08378505.1| flagellar biosynthetic protein FliP [Escherichia coli H591]
 gi|332278885|ref|ZP_08391298.1| flagellar biosynthesis protein [Shigella sp. D9]
 gi|81175289|sp|P0AC06|FLIP_ECO57 RecName: Full=Flagellar biosynthetic protein fliP; Flags: Precursor
 gi|81175290|sp|P0AC05|FLIP_ECOLI RecName: Full=Flagellar biosynthetic protein fliP; Flags: Precursor
 gi|12516055|gb|AAG56963.1|AE005417_5 flagellar biosynthesis [Escherichia coli O157:H7 str. EDL933]
 gi|347243|gb|AAC36859.1| flagellar protein [Escherichia coli]
 gi|1736614|dbj|BAA15773.1| flagellar biosynthesis protein [Escherichia coli str. K12 substr.
           W3110]
 gi|1788259|gb|AAC75015.1| flagellar biosynthesis protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13362155|dbj|BAB36110.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           Sakai]
 gi|157078553|gb|ABV18261.1| flagellar biosynthetic protein FliP [Escherichia coli E24377A]
 gi|169889427|gb|ACB03134.1| flagellar biosynthesis protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170520148|gb|ACB18326.1| flagellar biosynthetic protein FliP [Escherichia coli SMS-3-5]
 gi|187767404|gb|EDU31248.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014148|gb|EDU52270.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999261|gb|EDU68247.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354902|gb|EDU73321.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4401]
 gi|189359722|gb|EDU78141.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365562|gb|EDU83978.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370182|gb|EDU88598.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC869]
 gi|189375715|gb|EDU94131.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC508]
 gi|190901676|gb|EDV61432.1| flagellar biosynthetic protein FliP [Escherichia coli B7A]
 gi|192925965|gb|EDV80611.1| flagellar biosynthetic protein FliP [Escherichia coli E22]
 gi|192955543|gb|EDV86022.1| flagellar biosynthetic protein FliP [Escherichia coli E110019]
 gi|194412026|gb|EDX28338.1| flagellar biosynthetic protein FliP [Escherichia coli B171]
 gi|194421480|gb|EDX37494.1| flagellar biosynthetic protein FliP [Escherichia coli 101-1]
 gi|208725166|gb|EDZ74873.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4206]
 gi|208731278|gb|EDZ79967.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739708|gb|EDZ87390.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161943|gb|ACI39376.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           EC4115]
 gi|209766788|gb|ACI81706.1| flagellar biosynthetic protein FliP [Escherichia coli]
 gi|209766790|gb|ACI81707.1| flagellar biosynthetic protein FliP [Escherichia coli]
 gi|209766792|gb|ACI81708.1| flagellar biosynthetic protein FliP [Escherichia coli]
 gi|209766794|gb|ACI81709.1| flagellar biosynthetic protein FliP [Escherichia coli]
 gi|209766796|gb|ACI81710.1| flagellar biosynthetic protein FliP [Escherichia coli]
 gi|217318163|gb|EEC26590.1| flagellar biosynthetic protein FliP [Escherichia coli O157:H7 str.
           TW14588]
 gi|218352285|emb|CAU98042.1| flagellar biosynthesis protein [Escherichia coli 55989]
 gi|218361296|emb|CAQ98880.1| flagellar biosynthesis protein [Escherichia coli IAI1]
 gi|226900664|gb|EEH86923.1| flagellar biosynthetic protein fliP [Escherichia sp. 3_2_53FAA]
 gi|238861098|gb|ACR63096.1| flagellar biosynthesis protein [Escherichia coli BW2952]
 gi|253324147|gb|ACT28749.1| flagellar biosynthetic protein FliP [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254592998|gb|ACT72359.1| flagellar biosynthesis protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|257759494|dbj|BAI30991.1| flagellar biosynthesis protein FliP [Escherichia coli O103:H2 str.
           12009]
 gi|260448939|gb|ACX39361.1| flagellar biosynthetic protein FliP [Escherichia coli DH1]
 gi|284921856|emb|CBG34931.1| flagellar biosynthetic protein FliP [Escherichia coli 042]
 gi|290762998|gb|ADD56959.1| Flagellar biosynthetic protein fliP precursor [Escherichia coli
           O55:H7 str. CB9615]
 gi|291323158|gb|EFE62586.1| flagellar biosynthetic protein FliP [Escherichia coli B088]
 gi|291432906|gb|EFF05885.1| flagellar biosynthetic protein FliP [Escherichia coli B185]
 gi|299877709|gb|EFI85920.1| flagellar biosynthetic protein FliP [Escherichia coli MS 196-1]
 gi|300412824|gb|EFJ96134.1| flagellar biosynthetic protein FliP [Escherichia coli MS 115-1]
 gi|300419852|gb|EFK03163.1| flagellar biosynthetic protein FliP [Escherichia coli MS 182-1]
 gi|308120395|gb|EFO57657.1| flagellar biosynthetic protein FliP [Escherichia coli MS 145-7]
 gi|310332430|gb|EFP99665.1| flagellar biosynthetic protein FliP [Escherichia coli 1827-70]
 gi|315136585|dbj|BAJ43744.1| flagellar biosynthetic protein fliP precursor [Escherichia coli
           DH1]
 gi|315286656|gb|EFU46089.1| flagellar biosynthetic protein FliP [Escherichia coli MS 110-3]
 gi|320191922|gb|EFW66569.1| Flagellar biosynthesis protein FliP [Escherichia coli O157:H7 str.
           EC1212]
 gi|320198639|gb|EFW73239.1| Flagellar biosynthesis protein FliP [Escherichia coli EC4100B]
 gi|320641796|gb|EFX11184.1| flagellar biosynthesis protein FliP [Escherichia coli O157:H7 str.
           G5101]
 gi|320647155|gb|EFX15988.1| flagellar biosynthesis protein FliP [Escherichia coli O157:H- str.
           493-89]
 gi|320652439|gb|EFX20737.1| flagellar biosynthesis protein FliP [Escherichia coli O157:H- str.
           H 2687]
 gi|320658041|gb|EFX25803.1| flagellar biosynthesis protein FliP [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320658613|gb|EFX26307.1| flagellar biosynthesis protein FliP [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320668511|gb|EFX35338.1| flagellar biosynthesis protein FliP [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323158573|gb|EFZ44587.1| flagellar biosynthetic protein FliP [Escherichia coli E128010]
 gi|323174672|gb|EFZ60292.1| flagellar biosynthetic protein FliP [Escherichia coli LT-68]
 gi|323183932|gb|EFZ69319.1| flagellar biosynthetic protein FliP [Escherichia coli 1357]
 gi|323948348|gb|EGB44335.1| flagellar biosynthetic protein FliP [Escherichia coli H120]
 gi|323956344|gb|EGB52087.1| flagellar biosynthetic protein FliP [Escherichia coli H263]
 gi|324018857|gb|EGB88076.1| flagellar biosynthetic protein FliP [Escherichia coli MS 117-3]
 gi|326342359|gb|EGD66140.1| Flagellar biosynthesis protein FliP [Escherichia coli O157:H7 str.
           1044]
 gi|326344863|gb|EGD68610.1| Flagellar biosynthesis protein FliP [Escherichia coli O157:H7 str.
           1125]
 gi|331039367|gb|EGI11587.1| flagellar biosynthetic protein FliP [Escherichia coli H736]
 gi|331074290|gb|EGI45610.1| flagellar biosynthetic protein FliP [Escherichia coli H591]
 gi|332101237|gb|EGJ04583.1| flagellar biosynthesis protein [Shigella sp. D9]
          Length = 245

 Score =  194 bits (493), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 157/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+L+TP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLITP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|26248217|ref|NP_754257.1| flagellar biosynthesis protein FliP [Escherichia coli CFT073]
 gi|110642054|ref|YP_669784.1| flagellar biosynthesis protein FliP [Escherichia coli 536]
 gi|110805917|ref|YP_689437.1| flagellar biosynthesis protein FliP [Shigella flexneri 5 str. 8401]
 gi|161485898|ref|NP_707833.2| flagellar biosynthesis protein FliP [Shigella flexneri 2a str. 301]
 gi|191173282|ref|ZP_03034812.1| flagellar biosynthetic protein FliP [Escherichia coli F11]
 gi|218699491|ref|YP_002407120.1| flagellar biosynthesis protein FliP [Escherichia coli IAI39]
 gi|227885623|ref|ZP_04003428.1| flagellar biosynthesis protein FliP [Escherichia coli 83972]
 gi|300940403|ref|ZP_07154988.1| flagellar biosynthetic protein FliP [Escherichia coli MS 21-1]
 gi|300975537|ref|ZP_07173048.1| flagellar biosynthetic protein FliP [Escherichia coli MS 45-1]
 gi|301050691|ref|ZP_07197552.1| flagellar biosynthetic protein FliP [Escherichia coli MS 185-1]
 gi|306814229|ref|ZP_07448395.1| flagellar biosynthesis protein FliP [Escherichia coli NC101]
 gi|331647542|ref|ZP_08348634.1| flagellar biosynthetic protein FliP [Escherichia coli M605]
 gi|26108621|gb|AAN80824.1|AE016762_77 Flagellar biosynthetic protein fliP precursor [Escherichia coli
           CFT073]
 gi|110343646|gb|ABG69883.1| flagellar biosynthetic protein FliP precursor [Escherichia coli
           536]
 gi|110615465|gb|ABF04132.1| flagellar biosynthetic protein FliP [Shigella flexneri 5 str. 8401]
 gi|190906399|gb|EDV66008.1| flagellar biosynthetic protein FliP [Escherichia coli F11]
 gi|218369477|emb|CAR17242.1| flagellar biosynthesis protein [Escherichia coli IAI39]
 gi|222033687|emb|CAP76428.1| flagellar biosynthetic protein fliP [Escherichia coli LF82]
 gi|227837196|gb|EEJ47662.1| flagellar biosynthesis protein FliP [Escherichia coli 83972]
 gi|281179010|dbj|BAI55340.1| flagellar biosynthetic protein FliP [Escherichia coli SE15]
 gi|300297614|gb|EFJ53999.1| flagellar biosynthetic protein FliP [Escherichia coli MS 185-1]
 gi|300410306|gb|EFJ93844.1| flagellar biosynthetic protein FliP [Escherichia coli MS 45-1]
 gi|300454797|gb|EFK18290.1| flagellar biosynthetic protein FliP [Escherichia coli MS 21-1]
 gi|305852388|gb|EFM52839.1| flagellar biosynthesis protein FliP [Escherichia coli NC101]
 gi|307553961|gb|ADN46736.1| flagellar biosynthetic protein FliP [Escherichia coli ABU 83972]
 gi|312946541|gb|ADR27368.1| flagellar biosynthesis protein FliP [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|315290265|gb|EFU49643.1| flagellar biosynthetic protein FliP [Escherichia coli MS 153-1]
 gi|315296482|gb|EFU55779.1| flagellar biosynthetic protein FliP [Escherichia coli MS 16-3]
 gi|320194339|gb|EFW68970.1| Flagellar biosynthesis protein FliP [Escherichia coli WV_060327]
 gi|323186704|gb|EFZ72026.1| flagellar biosynthetic protein FliP [Escherichia coli RN587/1]
 gi|324005853|gb|EGB75072.1| flagellar biosynthetic protein FliP [Escherichia coli MS 57-2]
 gi|324013503|gb|EGB82722.1| flagellar biosynthetic protein FliP [Escherichia coli MS 60-1]
 gi|330911754|gb|EGH40264.1| flagellar biosynthesis protein FliP [Escherichia coli AA86]
 gi|331043266|gb|EGI15404.1| flagellar biosynthetic protein FliP [Escherichia coli M605]
 gi|333004053|gb|EGK23587.1| flagellar biosynthetic protein FliP [Shigella flexneri K-272]
 gi|333017826|gb|EGK37133.1| flagellar biosynthetic protein FliP [Shigella flexneri K-227]
          Length = 245

 Score =  194 bits (493), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 157/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+L+TP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLITP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|329890585|ref|ZP_08268928.1| flagellar biosynthetic protein FliP [Brevundimonas diminuta ATCC
           11568]
 gi|328845886|gb|EGF95450.1| flagellar biosynthetic protein FliP [Brevundimonas diminuta ATCC
           11568]
          Length = 238

 Score =  194 bits (493), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 95/218 (43%), Positives = 147/218 (67%), Gaps = 4/218 (1%)

Query: 28  NIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVI 87
           ++ +   ++  +V+  G+ T+LS+AP ++IM T F R ++V S+LRT +GM   PPN V+
Sbjct: 18  DLGSGAGLTQRVVQLVGLMTVLSLAPSIVIMTTSFVRIVVVLSLLRTALGMQQSPPNAVL 77

Query: 88  ISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSL 147
           +SLALF++  VM PT   + + GI+PLM+ Q+    A    +EP   FM    +  DL+L
Sbjct: 78  VSLALFLSAIVMGPTWQDAYDSGIRPLMDQQMELPQAFDAASEPVKTFMLAQVKPDDLAL 137

Query: 148 FMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVM 207
           F  ++       D+     +  R++ P+FMISEL+ +F IGFL+ +PFL+ID++VA+++M
Sbjct: 138 FTRLSRV-EAPADV---QDLPLRVVTPAFMISELKTAFTIGFLLFVPFLVIDLVVASVLM 193

Query: 208 AMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +MGMMMLPP  +SLPFK+IFFVL+DGW L+  +LV+SF
Sbjct: 194 SMGMMMLPPVVVSLPFKLIFFVLVDGWRLVAGSLVESF 231


>gi|167585022|ref|ZP_02377410.1| flagellar biosynthesis protein FliP [Burkholderia ubonensis Bu]
          Length = 253

 Score =  194 bits (493), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  S PPN V++ LA+F+TF+VM
Sbjct: 51  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQALGTSSTPPNQVLVGLAMFLTFFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+   G +P  +  +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDRAYNDGYKPFSDGSVPMEQAVQRGVAPFKGFMLKQTRETDLALFAKISKAA---- 166

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P+++
Sbjct: 167 PMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPSTV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FV++DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVVVDGWQLLLGSLAQSF 252


>gi|194434965|ref|ZP_03067208.1| flagellar biosynthetic protein FliP [Shigella dysenteriae 1012]
 gi|194416800|gb|EDX32926.1| flagellar biosynthetic protein FliP [Shigella dysenteriae 1012]
 gi|320182735|gb|EFW57619.1| Flagellar biosynthesis protein FliP [Shigella boydii ATCC 9905]
 gi|332095503|gb|EGJ00519.1| flagellar biosynthetic protein FliP [Shigella dysenteriae 155-74]
          Length = 245

 Score =  194 bits (493), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 157/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+L+TP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLITP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|331657994|ref|ZP_08358956.1| flagellar biosynthetic protein FliP [Escherichia coli TA206]
 gi|331056242|gb|EGI28251.1| flagellar biosynthetic protein FliP [Escherichia coli TA206]
          Length = 245

 Score =  194 bits (493), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 157/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+L+TP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLITP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|253573534|ref|ZP_04850877.1| flagellar biosynthetic protein FliP [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251847062|gb|EES75067.1| flagellar biosynthetic protein FliP [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 255

 Score =  194 bits (493), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 141/199 (70%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+LSIAP +L+++T F R ++V   +R+ +G   +PPN V+I LALF+T ++MSPTL   
Sbjct: 59  TVLSIAPAILVLMTSFTRIVVVLGFVRSSLGTQQMPPNQVLIGLALFLTLFIMSPTLSTI 118

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            E+ +QP +  +IT+T A+ + A P   FM ++TR KDL LFM         +     + 
Sbjct: 119 NEVAVQPYIKGEITQTEALDKAAVPMKKFMYSHTRTKDLQLFMGYTKMEKPKS----YED 174

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           I   +++P+F ISEL+ +F++GF+I +PFLIID++V++++MAMGMMMLPP  ISLPFK++
Sbjct: 175 IPLSVMVPAFAISELKTAFQMGFMIFIPFLIIDIVVSSVLMAMGMMMLPPVMISLPFKIL 234

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW L+V++L+ SF
Sbjct: 235 LFVLVDGWYLIVKSLLVSF 253


>gi|168244830|ref|ZP_02669762.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194448965|ref|YP_002046030.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|238912448|ref|ZP_04656285.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|194407269|gb|ACF67488.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|205336386|gb|EDZ23150.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
          Length = 245

 Score =  194 bits (493), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 150/229 (65%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T    T L+  P +L+M+T F R IIVF +LR  +
Sbjct: 19  AAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNAL 78

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A+ + A+P   FM
Sbjct: 79  GTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFM 138

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+LF  +A+S      +   + +  RIL+P+++ SEL+ +F+IGF I +PFL
Sbjct: 139 LRQTREADLALFARLANSG----PLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFL 194

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 195 IIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|296103568|ref|YP_003613714.1| flagellar biosynthesis protein FliP [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058027|gb|ADF62765.1| flagellar biosynthesis protein FliP [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 245

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 152/227 (66%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  +++ P      +W   V+T    T L+  P +L+M+T F R IIVF +LR  +G 
Sbjct: 21  AQLPGLVSTPLAGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRIIIVFGLLRNALGT 80

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ LALF+TF++MSP +D+      QP   ++I+   A+++ A+P   FM  
Sbjct: 81  PSAPPNQVLLGLALFLTFFIMSPVIDKIYTDAYQPFSEDKISMQEALEKGAQPLREFMLR 140

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+LF  ++++     ++   + +  RIL+P+++ SEL+ +F+IGF I +PFLII
Sbjct: 141 QTREADLALFARLSNTG----ELQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLII 196

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 197 DLVIASVLMALGMMMVPPATIALPFKIMLFVLVDGWQLLVSSLAQSF 243


>gi|153941323|ref|YP_001391949.1| flagellar biosynthesis protein FliP [Clostridium botulinum F str.
           Langeland]
 gi|152937219|gb|ABS42717.1| flagellar biosynthetic protein FliP [Clostridium botulinum F str.
           Langeland]
 gi|295319967|gb|ADG00345.1| flagellar biosynthetic protein FliP [Clostridium botulinum F str.
           230613]
          Length = 258

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/199 (48%), Positives = 140/199 (70%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+L++ P  ++M+T F R I+VF  LR  MG    PPN V+I LALF+T ++M P     
Sbjct: 63  TVLTLLPSFIVMMTSFVRTIVVFGFLRNAMGTQQSPPNQVMIGLALFLTLFIMYPVYSEV 122

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
               IQP M N+IT+  A++  A+P   FM   TR+KDL LF+D+A     N  +TK++ 
Sbjct: 123 NTKAIQPYMKNKITQEQAVEIGAKPLRQFMLKQTRQKDLKLFVDLAKP---NFKVTKDNA 179

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
             Y I++P+F+ISEL+ +F+IGFL+ +PFLIID++VA+++M+MGM MLPP  ISLPFK++
Sbjct: 180 PLY-IVVPAFIISELKTAFQIGFLLFIPFLIIDLVVASVLMSMGMFMLPPVMISLPFKLL 238

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FV++DGW LLV++LV SF
Sbjct: 239 LFVMVDGWYLLVKSLVMSF 257


>gi|167834870|ref|ZP_02461753.1| flagellar biosynthesis protein FliP [Burkholderia thailandensis
           MSMB43]
          Length = 253

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 139/206 (67%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  S PPN V++ LALF+T +VM
Sbjct: 51  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQALGTASTPPNQVLVGLALFLTLFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+     +P     +    A+QR A PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDRAYADAYKPFSEGTLQMDQAVQRGAAPFKTFMLKQTRETDLALFAKISKAAP--- 167

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P ++
Sbjct: 168 -MQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|161613452|ref|YP_001587417.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|168259734|ref|ZP_02681707.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|161362816|gb|ABX66584.1| hypothetical protein SPAB_01169 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205351247|gb|EDZ37878.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 245

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 150/229 (65%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T    T L+  P +L+M+T F R IIVF +LR  +
Sbjct: 19  AAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNAL 78

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A+ + A+P   FM
Sbjct: 79  GTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFM 138

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+LF  +A+S      +   + +  RIL+P+++ SEL+ +F+IGF I +PFL
Sbjct: 139 LRQTREADLALFARLANSG----PLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFL 194

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 195 IIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|170698077|ref|ZP_02889158.1| flagellar biosynthetic protein FliP [Burkholderia ambifaria
           IOP40-10]
 gi|170137038|gb|EDT05285.1| flagellar biosynthetic protein FliP [Burkholderia ambifaria
           IOP40-10]
          Length = 253

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/235 (41%), Positives = 152/235 (64%), Gaps = 7/235 (2%)

Query: 14  PELVFAKSSLHDVMNI---PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFS 70
           P L  A+++     N    P   +  +  V+T  + T+LS  P +L+M+T F R IIV S
Sbjct: 22  PALACAQAAGLPAFNTSPGPNGGTTYSLSVQTMLLLTMLSFLPAMLLMMTSFTRIIIVLS 81

Query: 71  ILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAE 130
           +LR  +G  + PPN V++ LA+F+TF+VMSP LDR+   G +P  +  +    A++R   
Sbjct: 82  LLRQALGTATTPPNQVLVGLAMFLTFFVMSPVLDRAYADGYKPFSDGSMPMEQAVRRGVA 141

Query: 131 PFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFL 190
           PF  FM   TRE DL+LF  ++ ++     +   + +   +L+P+F+ SEL+  F+IGF 
Sbjct: 142 PFKTFMLKQTRETDLALFAKISKAA----PMQGPEDVPLSLLVPAFVTSELKTGFQIGFT 197

Query: 191 IILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           I +PFLIIDM+VA+++M+MGMMM+ P+++SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 198 IFIPFLIIDMVVASVLMSMGMMMVSPSTVSLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|292669767|ref|ZP_06603193.1| flagellar biosynthetic protein FliP [Selenomonas noxia ATCC 43541]
 gi|292648564|gb|EFF66536.1| flagellar biosynthetic protein FliP [Selenomonas noxia ATCC 43541]
          Length = 249

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 151/216 (69%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D++ S   ++   + TI+S+AP +L+M T F R ++V   LR  +   +VPPN V+I+
Sbjct: 40  PQDVATS---MQLLAVLTIVSLAPAILVMTTSFVRIVVVIGFLRNALSTQNVPPNQVVIA 96

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF++FY+M+P   ++ E GIQP +  +I++  A++ V +P   FM   TRE DL+LF+
Sbjct: 97  LSLFLSFYIMAPYWGQANENGIQPYLAGEISQEQALENVVDPMREFMFRQTRESDLALFV 156

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           +++ +   +      + +    LIP+F+ISEL+ +F+IGF+I +PF++IDMIVA+ +M+M
Sbjct: 157 NLSDAPRPD----GPEDVSTFTLIPAFIISELKTAFQIGFMIYIPFIVIDMIVASTLMSM 212

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FV++DGW LL+++L+ SF
Sbjct: 213 GMMMLPPVMISLPFKILLFVMVDGWHLLIQSLIMSF 248


>gi|251797428|ref|YP_003012159.1| flagellar biosynthetic protein FliP [Paenibacillus sp. JDR-2]
 gi|247545054|gb|ACT02073.1| flagellar biosynthetic protein FliP [Paenibacillus sp. JDR-2]
          Length = 256

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 140/194 (72%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +L+++T F R +IV   +RT +G   +PPN V+I LA+F+TF++M+PT  +  E+ +
Sbjct: 65  APAILVLMTSFTRIVIVLGFVRTSLGTQQMPPNQVLIGLAMFLTFFIMAPTFSQVNEVAL 124

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QP +  +IT+T A+++ A+P   FM ++TREKDL LF++   +        K   I   +
Sbjct: 125 QPYLKGEITQTVALEKAADPMKKFMISHTREKDLLLFLNYTKTEKPE----KYQDIPITV 180

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P++ ISEL+ +F++GF+I +PFL+IDMIVA+ +MAMGMMMLPP  ISLPFK++ FVL+
Sbjct: 181 LVPAYAISELKTAFQMGFMIFIPFLVIDMIVASTLMAMGMMMLPPVMISLPFKLLLFVLV 240

Query: 232 DGWSLLVENLVKSF 245
           DGW L+V++L+ SF
Sbjct: 241 DGWYLIVKSLLLSF 254


>gi|114764047|ref|ZP_01443286.1| flagellar biosynthetic protein FliP [Pelagibaca bermudensis
           HTCC2601]
 gi|114543405|gb|EAU46420.1| flagellar biosynthetic protein FliP [Roseovarius sp. HTCC2601]
          Length = 241

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 155/245 (63%), Gaps = 5/245 (2%)

Query: 1   MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVT 60
           M R    AL L+   L  A ++    +++    S++   ++   + T+LS+AP + IMVT
Sbjct: 1   MWRAALSALILIA--LSTAATAQELRLDLGGGGSLTATSLQLIALITLLSLAPGIAIMVT 58

Query: 61  CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT 120
           CFP  + V +ILR  +G+   PPN++I+SLALF+T++VM PT   + + G++PL++ +I+
Sbjct: 59  CFPFLVTVLAILRQAVGLQQSPPNMLIVSLALFLTYFVMEPTFTAAWQDGLRPLIDEEIS 118

Query: 121 ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE 180
               ++R   PF  FM   T   D + F  MA      +  T        +LIPSFM+SE
Sbjct: 119 VEEGVERTLVPFRGFMAGRT---DANTFSSMADLRPDASGETLRPEAPLSLLIPSFMLSE 175

Query: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVEN 240
           + R+F++GFLI LPFLIID++VA I+M+MGMMM+PP  +SLPFK+ FFV+ DGWSLL   
Sbjct: 176 IARAFQVGFLIFLPFLIIDLVVAAILMSMGMMMVPPAIVSLPFKLAFFVIADGWSLLAGA 235

Query: 241 LVKSF 245
           LV+S+
Sbjct: 236 LVRSY 240


>gi|221214540|ref|ZP_03587510.1| flagellar biosynthetic protein FliP [Burkholderia multivorans CGD1]
 gi|221165430|gb|EED97906.1| flagellar biosynthetic protein FliP [Burkholderia multivorans CGD1]
          Length = 253

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +++M+T F R IIV S+LR  +G  + PPN V++ LALF+TF+VM
Sbjct: 51  VQTMLLLTMLSFLPAMVLMMTSFTRIIIVLSLLRQALGTATTPPNQVLVGLALFLTFFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+   G +P  +  +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDRAYTDGYKPFSDGTLPMEQAVQRGVAPFKGFMLKQTRETDLALFAKISKAA---- 166

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P+++
Sbjct: 167 PMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPSTV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|312172107|emb|CBX80364.1| Flagellar biosynthetic protein FliP precursor [Erwinia amylovora
           ATCC BAA-2158]
          Length = 245

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 157/240 (65%), Gaps = 9/240 (3%)

Query: 8   ALFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRF 65
           ALF++ P  V+A+  L  +++ P      +W   V+T    T L+  P +L+M+T F R 
Sbjct: 11  ALFMLAPN-VYAQ--LPGLISQPTANGGQSWSLPVQTLVFITSLTFLPAILLMMTSFTRI 67

Query: 66  IIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAI 125
           IIVF +LR  +G  S PPN V++ L+LF+TF++M P  D+      QP   ++I+   AI
Sbjct: 68  IIVFGLLRNALGTPSAPPNQVLLGLSLFLTFFIMGPVFDKIYTDAYQPFSEDKISMQEAI 127

Query: 126 QRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSF 185
            + A+P   FM   TRE DL+LF  +A++      I   + +  RIL+P+++ SEL+ +F
Sbjct: 128 DKGAQPLREFMLRQTREADLALFARLANTP----PIAGPEAVPMRILLPAYVTSELKTAF 183

Query: 186 EIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +IGF + +PFLIID++VA+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 184 QIGFTVFIPFLIIDLVVASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVSSLAQSF 243


>gi|221201779|ref|ZP_03574816.1| flagellar biosynthetic protein FliP [Burkholderia multivorans
           CGD2M]
 gi|221207716|ref|ZP_03580724.1| flagellar biosynthetic protein FliP [Burkholderia multivorans CGD2]
 gi|221172562|gb|EEE05001.1| flagellar biosynthetic protein FliP [Burkholderia multivorans CGD2]
 gi|221178199|gb|EEE10609.1| flagellar biosynthetic protein FliP [Burkholderia multivorans
           CGD2M]
          Length = 253

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +++M+T F R IIV S+LR  +G  + PPN V++ LALF+TF+VM
Sbjct: 51  VQTMLLLTMLSFLPAMVLMMTSFTRIIIVLSLLRQALGTATTPPNQVLVGLALFLTFFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+   G +P  +  +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDRAYTDGYKPFSDGTLPMEQAVQRGVAPFKGFMLKQTRETDLALFAKISKAA---- 166

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P+++
Sbjct: 167 PMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPSTV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|148266209|ref|YP_001232915.1| flagellar biosynthesis protein FliP [Geobacter uraniireducens Rf4]
 gi|146399709|gb|ABQ28342.1| flagellar biosynthetic protein FliP [Geobacter uraniireducens Rf4]
          Length = 251

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/216 (43%), Positives = 144/216 (66%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           PAD+++   +++ F + T+LS+AP LL+M T F R ++V S LR  +G    P N +II 
Sbjct: 42  PADVAV---VLQIFFLMTVLSLAPGLLMMTTSFTRIVVVLSFLRNAIGTQQAPSNQIIIG 98

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TF++M+P   +     +QP     I++  A +R   P   FM +  REKDL+LF+
Sbjct: 99  LSLFLTFFIMAPVWQQINTQALQPYKAQTISQEEAFKRAVAPVRKFMLSQVREKDLALFL 158

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            ++            D I    LIP++M+SEL+ +F+IGFL+ +PFL++DM+VA+++M+M
Sbjct: 159 SLSKLPRPK----NADDIPTLTLIPAYMVSELKTAFQIGFLVFIPFLVLDMVVASVLMSM 214

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FVL+DGW L++ +LVKSF
Sbjct: 215 GMMMLPPVMISLPFKILLFVLVDGWGLVIGSLVKSF 250


>gi|215487148|ref|YP_002329579.1| flagellar biosynthesis protein FliP [Escherichia coli O127:H6 str.
           E2348/69]
 gi|215265220|emb|CAS09610.1| flagellar biosynthesis protein FliP [Escherichia coli O127:H6 str.
           E2348/69]
          Length = 245

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 157/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+LVTP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLVTP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL +F  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGVFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|312173310|emb|CBX81565.1| Flagellar biosynthetic protein FliP precursor [Erwinia amylovora
           ATCC BAA-2158]
          Length = 247

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + + L+  P +L+M+T F R IIV  ++R  +G  + PPN V++ LALF+TFYVM
Sbjct: 44  VQTLVLLSSLTFLPAILLMMTGFTRIIIVLGLMRNALGTPTAPPNQVLVGLALFLTFYVM 103

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP  ++  E   QPL  ++IT   A+++  +P   FM + TRE DL++F  MA +     
Sbjct: 104 SPVFNQIYEQAWQPLQEDKITMEVALEQGVKPLRAFMLDQTRENDLAMFAQMAKAG---- 159

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           +    + +   IL+P+F+ SEL+ +F+IGF I +PFLIID++VA+I+MA+GMMM+PP +I
Sbjct: 160 EFKGPEEVPLGILVPAFVTSELKTAFQIGFTIFIPFLIIDLVVASILMALGMMMVPPATI 219

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL+DGW LL+ +L +SF
Sbjct: 220 ALPFKLMLFVLVDGWQLLMGSLAQSF 245


>gi|170769417|ref|ZP_02903870.1| flagellar biosynthetic protein FliP [Escherichia albertii TW07627]
 gi|170121741|gb|EDS90672.1| flagellar biosynthetic protein FliP [Escherichia albertii TW07627]
          Length = 245

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 157/238 (65%), Gaps = 9/238 (3%)

Query: 10  FLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFII 67
           +LVTP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R II
Sbjct: 13  WLVTP-LTFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRIII 69

Query: 68  VFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQR 127
           VF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A+++
Sbjct: 70  VFGLLRNALGTLSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALEK 129

Query: 128 VAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEI 187
            A+P   FM   TRE DL+LF  +A+S      +   + +  RIL+P+++ SEL+ +F+I
Sbjct: 130 GAQPLREFMLRQTREADLALFARLANSG----PLQGPEAVPMRILLPAYVTSELKTAFQI 185

Query: 188 GFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 186 GFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|154686052|ref|YP_001421213.1| flagellar biosynthesis protein FliP [Bacillus amyloliquefaciens
           FZB42]
 gi|154351903|gb|ABS73982.1| FliP [Bacillus amyloliquefaciens FZB42]
          Length = 221

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 95/218 (43%), Positives = 150/218 (68%), Gaps = 7/218 (3%)

Query: 28  NIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVI 87
           N P ++S +   V+   + T+ S+AP +LI++TCF R +IV S +RT +   ++PPN V+
Sbjct: 11  NSPTEVSST---VKLLLLLTVFSVAPGILILMTCFTRIVIVLSFVRTSLATQNMPPNQVL 67

Query: 88  ISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSL 147
           I LALF+TF++M+PT     +  + PLM+N+I+   A  +  +P   +M  +TR+KDL+L
Sbjct: 68  IGLALFLTFFIMAPTFSEINKEALTPLMDNKISLDEAYTKAEKPIKEYMSKHTRQKDLAL 127

Query: 148 FMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVM 207
           FM+ A      +       I    ++P++ ISEL+ +F++GF+I +PFLIIDM+VA+++M
Sbjct: 128 FMNYAKMKKPESI----QDIPLTTMVPAYAISELKTAFQMGFMIFIPFLIIDMVVASVLM 183

Query: 208 AMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +MGMMMLPP  ISLPFK++ FVL+DGW L+V++L+ SF
Sbjct: 184 SMGMMMLPPVMISLPFKILLFVLVDGWYLIVKSLLDSF 221


>gi|206889470|ref|YP_002249866.1| flagellar biosynthetic protein FliP [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741408|gb|ACI20465.1| flagellar biosynthetic protein FliP [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 335

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 155/242 (64%), Gaps = 12/242 (4%)

Query: 6   FFALFLVTPELVFA--KSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFP 63
           F  L +++P L FA  +S+   +    + + I  +I       T+LS  P +LIM+T F 
Sbjct: 103 FSCLLILSPTLCFAAPQSAQGGLFGFSSAIDILVFI-------TLLSFLPAVLIMMTSFT 155

Query: 64  RFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETT 123
           R +IV S+LR  +G  SVPPN VII LALF+T ++MSPT+DR       PL   +I    
Sbjct: 156 RIVIVLSLLRQALGTPSVPPNQVIIGLALFLTLFIMSPTVDRVYNEAYLPLSKKEINMEE 215

Query: 124 AIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRR 183
           AI + + PF  FM   TREKDL+LF  ++ +  +    T  D +  +I++P+F + EL+R
Sbjct: 216 AISKASVPFKEFMLKQTREKDLALFFKLSKTEVKPA--TPMD-LPMKIVVPAFALGELKR 272

Query: 184 SFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVK 243
           +FEIGFLI LPFL+ID++VA+I+++MGM M+PP  IS+PFK++ FVL+DGW L++ +L  
Sbjct: 273 AFEIGFLIFLPFLVIDIVVASILLSMGMFMVPPVMISMPFKLLLFVLVDGWQLIIGSLAG 332

Query: 244 SF 245
            F
Sbjct: 333 GF 334


>gi|254466138|ref|ZP_05079549.1| flagellar biosynthetic protein FliP [Rhodobacterales bacterium Y4I]
 gi|206687046|gb|EDZ47528.1| flagellar biosynthetic protein FliP [Rhodobacterales bacterium Y4I]
          Length = 247

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 137/212 (64%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S+S   ++   + T+LS+AP LLIM+TCFP  + V SILR G+G+   PPN+++ISLALF
Sbjct: 37  SVSARSIQLILLITVLSLAPGLLIMITCFPFLVTVLSILRQGIGLQQAPPNMLMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T++VM P    +   GI PL+  Q+    AI R  EPF  FM N     D   F  +A 
Sbjct: 97  LTYFVMEPVFTEAWNSGISPLLEEQLEPGEAISRSLEPFRAFMANRL---DPDTFYAIAD 153

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                  +          L+PSF++SE+ R+F+IGFL+ LPFL+ID++VA ++M+MGMMM
Sbjct: 154 LRPETQGMDPVPQAPLSALVPSFLLSEIARAFQIGFLVFLPFLVIDLVVAAVLMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +PP  +SLPFK+ FFV+ DGWSL+   LV+S+
Sbjct: 214 VPPAIVSLPFKLAFFVVADGWSLIATALVRSY 245


>gi|324114209|gb|EGC08182.1| flagellar biosynthetic protein FliP [Escherichia fergusonii B253]
          Length = 245

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 156/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+LVTP    A + L  ++  P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLVTP---CALAQLPGLVTQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL+LF  +A++      I   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLALFARLANTG----PIQGPEVVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|293410304|ref|ZP_06653880.1| flagellar biosynthetic protein FliP [Escherichia coli B354]
 gi|291470772|gb|EFF13256.1| flagellar biosynthetic protein FliP [Escherichia coli B354]
          Length = 245

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 157/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+L+TP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLITP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLLGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|161523220|ref|YP_001578232.1| flagellar biosynthesis protein FliP [Burkholderia multivorans ATCC
           17616]
 gi|189348923|ref|YP_001944551.1| flagellar biosynthesis protein FliP [Burkholderia multivorans ATCC
           17616]
 gi|160340649|gb|ABX13735.1| flagellar biosynthetic protein FliP [Burkholderia multivorans ATCC
           17616]
 gi|189332945|dbj|BAG42015.1| flagellar biosynthetic protein [Burkholderia multivorans ATCC
           17616]
          Length = 253

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +++M+T F R IIV S+LR  +G  + PPN V++ LALF+TF+VM
Sbjct: 51  VQTMLLLTMLSFLPAMVLMMTSFTRIIIVLSLLRQALGTATTPPNQVLVGLALFLTFFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+   G +P  +  +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDRAYTDGYKPFSDGTLPMEQAVQRGVAPFKGFMLKQTRETDLALFAKISKAA---- 166

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P+++
Sbjct: 167 PMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPSTV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|205352327|ref|YP_002226128.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205272108|emb|CAR36961.1| flagellar biosynthetic protein flip precursor [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|326627377|gb|EGE33720.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 245

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 155/240 (64%), Gaps = 9/240 (3%)

Query: 8   ALFLVTPELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIMVTCFPRF 65
            L+L +P    A + L  +++ P      +W +  +T    T L+  P +L+M+T F R 
Sbjct: 11  GLWLFSPA---AAAQLPGLISQPLAGGGQSWSLSAQTLVFITSLTFLPAILLMMTSFTRI 67

Query: 66  IIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAI 125
           IIVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A+
Sbjct: 68  IIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEAL 127

Query: 126 QRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSF 185
            + A+P   FM   TRE DL+LF  +A+S      +   + +  RIL+P+++ SEL+ +F
Sbjct: 128 DKGAQPLRAFMLRQTREADLALFARLANSG----PLQGPEAVPMRILLPAYVTSELKTAF 183

Query: 186 EIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 184 QIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|126665005|ref|ZP_01735988.1| flagellar biosynthetic protein FliP [Marinobacter sp. ELB17]
 gi|126630375|gb|EBA00990.1| flagellar biosynthetic protein FliP [Marinobacter sp. ELB17]
          Length = 259

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 141/206 (68%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T L+  P +L+M+T F R IIVFSILR  +G+ S P N +++ LALF+T ++M
Sbjct: 57  LQILALMTALTFLPAMLMMMTSFTRIIIVFSILRQALGLQSAPSNQILLGLALFLTIFIM 116

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            P L+ +  +G+QP +  ++T   A++  +EPF  FM   TRE DL LFM MA     + 
Sbjct: 117 KPVLEEANRVGLQPYLQEELTSLEAVEAASEPFKQFMLAQTRESDLGLFMRMA-----DE 171

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                + + + +L+P+F+ SEL+ +F+IGF++ +PFLIIDM+VA+++MAMGMMML P  I
Sbjct: 172 QFASPEDVTFWVLLPAFVTSELKTAFQIGFILFIPFLIIDMVVASVLMAMGMMMLSPIII 231

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++  L  S+
Sbjct: 232 SLPFKIMLFVLVDGWALIMGTLAASY 257


>gi|16765317|ref|NP_460932.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167993554|ref|ZP_02574648.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|1706856|sp|P54700|FLIP_SALTY RecName: Full=Flagellar biosynthetic protein fliP; Flags: Precursor
 gi|1066863|gb|AAB81319.1| fliP [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|16420514|gb|AAL20891.1| flagellar biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|205328373|gb|EDZ15137.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261247145|emb|CBG24968.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993968|gb|ACY88853.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301158493|emb|CBW18003.1| flagellar biosynthetic protein FliP [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912969|dbj|BAJ36943.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321224624|gb|EFX49687.1| Flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|323130258|gb|ADX17688.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332988868|gb|AEF07851.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 245

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 155/240 (64%), Gaps = 9/240 (3%)

Query: 8   ALFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRF 65
            L+L +P    A + L  +++ P      +W   V+T    T L+  P +L+M+T F R 
Sbjct: 11  GLWLFSPA---AAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRI 67

Query: 66  IIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAI 125
           IIVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A+
Sbjct: 68  IIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEAL 127

Query: 126 QRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSF 185
            + A+P   FM   TRE DL+LF  +A+S      +   + +  RIL+P+++ SEL+ +F
Sbjct: 128 DKGAQPLRAFMLRQTREADLALFARLANSG----PLQGPEAVPMRILLPAYVTSELKTAF 183

Query: 186 EIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LL+ +L +SF
Sbjct: 184 QIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSF 243


>gi|331006679|ref|ZP_08329957.1| Flagellar biosynthesis protein fliP [gamma proteobacterium
           IMCC1989]
 gi|330419511|gb|EGG93899.1| Flagellar biosynthesis protein fliP [gamma proteobacterium
           IMCC1989]
          Length = 280

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 137/199 (68%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T L+  P +LIM+T F R IIVF+ILR  +G+   P N ++I + LF+T ++M+P ++  
Sbjct: 84  TTLTFIPAILIMMTSFTRIIIVFAILRQALGLQQSPSNQILIGMTLFLTLFIMTPVINEV 143

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            E  +QP +  QIT   AI +V EPF  FM   TRE DL LFMD+A+    +T     + 
Sbjct: 144 NEQALQPYIAEQITSDQAIDKVIEPFHRFMIGQTRESDLKLFMDIANVPAVDT----REE 199

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           +   +LIPSF+ SEL+ +F+IGF++ +PFL+ID++VA+++MAMGMMML P  ISLPFK++
Sbjct: 200 VPLTVLIPSFITSELKTAFQIGFILFIPFLVIDLVVASVLMAMGMMMLSPLIISLPFKIM 259

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW++L+  L  SF
Sbjct: 260 LFVLVDGWAMLMGTLAASF 278


>gi|237755394|ref|ZP_04584021.1| flagellar biosynthetic protein FliP [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692435|gb|EEP61416.1| flagellar biosynthetic protein FliP [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 338

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 101/196 (51%), Positives = 138/196 (70%), Gaps = 5/196 (2%)

Query: 50  SIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEM 109
           SIAP LLI VT F R +IV S+LR  +G+ + PPN VI+ LALF+T +VM PT ++  E+
Sbjct: 147 SIAPALLISVTAFVRIVIVLSLLRHALGIPTAPPNQVIVGLALFLTIFVMKPTFEKINEV 206

Query: 110 GIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEY 169
            I P +  QI++  AI+   EP   FM  NTR++DL LF+D+A+       ++  D I  
Sbjct: 207 SISPYLKKQISDIQAIENAKEPLKEFMLKNTRKEDLKLFLDLANEK----PLSPKD-ISI 261

Query: 170 RILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFV 229
             LIP+FMISE++ +FEI F+I LPFL+ID IVA+I+M+MGMMM+PP  ISLPFK++ FV
Sbjct: 262 STLIPAFMISEIKTAFEIVFIIYLPFLVIDFIVASILMSMGMMMIPPMFISLPFKLMLFV 321

Query: 230 LIDGWSLLVENLVKSF 245
           L DG+ LLV+ LV S+
Sbjct: 322 LADGFELLVKALVSSY 337


>gi|295097216|emb|CBK86306.1| flagellar biosynthetic protein FliP [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 247

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 136/193 (70%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +L+M+T F R +IV  ++R  +G  + PPN V++ LALF+TF+VMSP L++  E   Q
Sbjct: 57  PAVLLMMTGFTRIVIVLGLMRNALGTPTAPPNQVLVGLALFLTFFVMSPVLNQIYEQAWQ 116

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           PL  N+IT  TA++   +P   FM   TRE DL++F  +A    +   +T  + +   IL
Sbjct: 117 PLQANKITMETALKEGVKPLRAFMLEQTREADLAMFARIA----KTPTLTGPEDVPLSIL 172

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +PSF+ SEL+ +F+IGF I +PFLIID++VA+I+MA+GMMM+PP +I+LPFK++ FVL+D
Sbjct: 173 VPSFVTSELKTAFQIGFTIFIPFLIIDLVVASILMALGMMMVPPATIALPFKLMLFVLVD 232

Query: 233 GWSLLVENLVKSF 245
           GW LLV +L +SF
Sbjct: 233 GWQLLVGSLAQSF 245


>gi|171316887|ref|ZP_02906096.1| flagellar biosynthetic protein FliP [Burkholderia ambifaria MEX-5]
 gi|171097968|gb|EDT42786.1| flagellar biosynthetic protein FliP [Burkholderia ambifaria MEX-5]
          Length = 253

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  + PPN V++ LA+F+TF+VM
Sbjct: 51  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQALGTATTPPNQVLVGLAMFLTFFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+   G +P  +  +    A++R   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDRAYADGYKPFSDGSMPMEQAVRRGVAPFKTFMLKQTRETDLALFAKISKAA---- 166

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P+++
Sbjct: 167 PMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPSTV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|172059104|ref|YP_001806756.1| flagellar biosynthesis protein FliP [Burkholderia ambifaria MC40-6]
 gi|171991621|gb|ACB62540.1| flagellar biosynthetic protein FliP [Burkholderia ambifaria MC40-6]
          Length = 253

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  + PPN V++ LA+F+TF+VM
Sbjct: 51  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQALGTATTPPNQVLVGLAMFLTFFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+   G +P  +  +    A++R   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDRAYADGYKPFSDGSMPMEQAVRRGVAPFKTFMLKQTRETDLALFAKISKAA---- 166

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P+++
Sbjct: 167 PMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPSTV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|254251034|ref|ZP_04944352.1| Flagellar transport protein FliP [Burkholderia dolosa AUO158]
 gi|124893643|gb|EAY67523.1| Flagellar transport protein FliP [Burkholderia dolosa AUO158]
          Length = 253

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  + PPN V++ LA+F+TF+VM
Sbjct: 51  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQALGTATTPPNQVLVGLAMFLTFFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD++   G +P  +  +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDKAYTDGYKPFSDGAMPMEQAVQRGVAPFKSFMLKQTRETDLALFAKISKAA---- 166

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P+++
Sbjct: 167 PMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPSTV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|115350085|ref|YP_771924.1| flagellar biosynthesis protein FliP [Burkholderia ambifaria AMMD]
 gi|115280073|gb|ABI85590.1| flagellar biosynthetic protein FliP [Burkholderia ambifaria AMMD]
          Length = 253

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  + PPN V++ LA+F+TF+VM
Sbjct: 51  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQALGTATTPPNQVLVGLAMFLTFFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+   G +P  +  +    A++R   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDRAYADGYKPFSDGSMPMEQAVRRGVAPFKTFMLKQTRETDLALFAKISKAA---- 166

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P+++
Sbjct: 167 PMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPSTV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|222053616|ref|YP_002535978.1| flagellar biosynthetic protein FliP [Geobacter sp. FRC-32]
 gi|221562905|gb|ACM18877.1| flagellar biosynthetic protein FliP [Geobacter sp. FRC-32]
          Length = 251

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 147/217 (67%), Gaps = 9/217 (4%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D+++   +++ F + T+LS+AP LL+M T F R ++V S LR  +G    P N +II 
Sbjct: 42  PGDVAV---VLQIFFLMTVLSLAPGLLMMTTSFTRIVVVLSFLRNALGTQQAPSNQIIIG 98

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TF++M+P   +     +QP     IT+  A++R   P   FM +  REKDL+LF+
Sbjct: 99  LSLFLTFFIMAPVWQQINVQALQPYRAQTITQDEALKRAVAPVRKFMLSQVREKDLALFI 158

Query: 150 DMAHSSHRNTDITKN-DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMA 208
           +++          KN D I    +IP++MISEL+ +F+IGFL+ +PFL++DM+VA+++M+
Sbjct: 159 NLSKLPR-----PKNADDIPTMTIIPAYMISELKTAFQIGFLVYIPFLVLDMVVASVLMS 213

Query: 209 MGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MGMMMLPP  ISLPFK++ FVL+DGW L++ +LVKSF
Sbjct: 214 MGMMMLPPVMISLPFKILLFVLVDGWGLIIGSLVKSF 250


>gi|292489152|ref|YP_003532039.1| flagellar biosynthetic protein FliP [Erwinia amylovora CFBP1430]
 gi|292900270|ref|YP_003539639.1| flagellar biosynthetic protein [Erwinia amylovora ATCC 49946]
 gi|291200118|emb|CBJ47244.1| flagellar biosynthetic protein [Erwinia amylovora ATCC 49946]
 gi|291554586|emb|CBA22219.1| Flagellar biosynthetic protein FliP precursor [Erwinia amylovora
           CFBP1430]
          Length = 247

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + + L+  P +L+M+T F R IIV  ++R  +G  + PPN V++ LALF+TFYVM
Sbjct: 44  VQTLVLLSSLTFLPAILLMMTGFTRIIIVLGLMRNALGTPTSPPNQVLVGLALFLTFYVM 103

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP  ++  E   QPL  ++IT   A+++  +P   FM + TRE DL++F  MA +     
Sbjct: 104 SPVFNQIYEQAWQPLQEDKITMEVALEQGVKPLRAFMLDQTRENDLAMFAQMAKAG---- 159

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           +    + +   IL+P+F+ SEL+ +F+IGF I +PFLIID++VA+I+MA+GMMM+PP +I
Sbjct: 160 EFKGPEEVPLGILVPAFVTSELKTAFQIGFTIFIPFLIIDLVVASILMALGMMMVPPATI 219

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL+DGW LL+ +L +SF
Sbjct: 220 ALPFKLMLFVLVDGWQLLMGSLAQSF 245


>gi|149188095|ref|ZP_01866390.1| flagellar biosynthesis protein P [Vibrio shilonii AK1]
 gi|148838083|gb|EDL55025.1| flagellar biosynthesis protein P [Vibrio shilonii AK1]
          Length = 287

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 144/214 (67%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 80  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 136

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           +F+TF++MSP L++  +  IQP +N QIT   A Q+   P   FM   TR KDL  F++M
Sbjct: 137 IFLTFFIMSPVLNQVNDQAIQPYLNEQITAKEAFQQAQGPMKSFMLKQTRVKDLETFVEM 196

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + S+ +N +      +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+I+MAMGM
Sbjct: 197 SGSTAQNPE-----DVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASILMAMGM 251

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 252 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 285


>gi|260429128|ref|ZP_05783105.1| flagellar biosynthetic protein FliP [Citreicella sp. SE45]
 gi|260419751|gb|EEX13004.1| flagellar biosynthetic protein FliP [Citreicella sp. SE45]
          Length = 242

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 143/219 (65%), Gaps = 3/219 (1%)

Query: 27  MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLV 86
           +N+    S++   ++   + T+LS+AP + IMVTCFP  + V SILR  +G+   PPN++
Sbjct: 26  LNLGEGGSVTAASLQLIALITLLSLAPGIAIMVTCFPFLVTVLSILRQAIGLQQSPPNML 85

Query: 87  IISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLS 146
           I+SLALF+T++VM P    +   G+ PL++ QI    A +R  EPF  FM         +
Sbjct: 86  IVSLALFLTYFVMEPVFTEAWTNGVAPLLDEQIEAREAFERTLEPFRGFMATRIDPDTFA 145

Query: 147 LFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIV 206
              D+     R T++     +   +L+PSFM+SE+ R+F++GFLI LPFLIID++VA ++
Sbjct: 146 NIADL-RPDARGTELDPGAPLS--LLVPSFMLSEIARAFQVGFLIFLPFLIIDLVVAAVL 202

Query: 207 MAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           M+MGMMM+PP  +SLPFK+ FFV+ DGWSLL  +LV+S+
Sbjct: 203 MSMGMMMVPPAIVSLPFKLAFFVIADGWSLLAGSLVRSY 241


>gi|148380606|ref|YP_001255147.1| flagellar biosynthetic protein FliP [Clostridium botulinum A str.
           ATCC 3502]
 gi|153933100|ref|YP_001384893.1| flagellar biosynthesis protein FliP [Clostridium botulinum A str.
           ATCC 19397]
 gi|153936309|ref|YP_001388362.1| flagellar biosynthesis protein FliP [Clostridium botulinum A str.
           Hall]
 gi|168180927|ref|ZP_02615591.1| flagellar biosynthetic protein FliP [Clostridium botulinum NCTC
           2916]
 gi|168182731|ref|ZP_02617395.1| flagellar biosynthetic protein FliP [Clostridium botulinum Bf]
 gi|226950061|ref|YP_002805152.1| flagellar biosynthetic protein FliP [Clostridium botulinum A2 str.
           Kyoto]
 gi|237796088|ref|YP_002863640.1| flagellar biosynthetic protein FliP [Clostridium botulinum Ba4 str.
           657]
 gi|148290090|emb|CAL84209.1| putative flagellar biosynthetic protein [Clostridium botulinum A
           str. ATCC 3502]
 gi|152929144|gb|ABS34644.1| flagellar biosynthetic protein FliP [Clostridium botulinum A str.
           ATCC 19397]
 gi|152932223|gb|ABS37722.1| flagellar biosynthetic protein FliP [Clostridium botulinum A str.
           Hall]
 gi|182668360|gb|EDT80339.1| flagellar biosynthetic protein FliP [Clostridium botulinum NCTC
           2916]
 gi|182674137|gb|EDT86098.1| flagellar biosynthetic protein FliP [Clostridium botulinum Bf]
 gi|226841463|gb|ACO84129.1| flagellar biosynthetic protein FliP [Clostridium botulinum A2 str.
           Kyoto]
 gi|229260888|gb|ACQ51921.1| flagellar biosynthetic protein FliP [Clostridium botulinum Ba4 str.
           657]
          Length = 258

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 140/199 (70%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+L++ P  ++M+T F R I+VF  LR  MG    PPN V+I LALF+T ++M P     
Sbjct: 63  TVLTLLPSFIVMMTSFVRTIVVFGFLRNAMGTQQSPPNQVMIGLALFLTLFIMQPVYSEI 122

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
               IQP M N+IT+  A++  A+P   FM   TR+KDL LF+++A     N  +TK++ 
Sbjct: 123 NTKAIQPYMKNKITQEQAVEIGAKPLRQFMLKQTRQKDLKLFVELAKP---NFKVTKDNA 179

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
             Y I++P+F+ISEL+ +F+IGFL+ +PFLIID++VA+++M+MGM MLPP  ISLPFK++
Sbjct: 180 PLY-IVVPAFIISELKTAFQIGFLLFIPFLIIDLVVASVLMSMGMFMLPPVMISLPFKLL 238

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FV++DGW LLV++LV SF
Sbjct: 239 LFVMVDGWYLLVKSLVMSF 257


>gi|134294170|ref|YP_001117905.1| flagellar biosynthesis protein FliP [Burkholderia vietnamiensis G4]
 gi|134137327|gb|ABO53070.1| flagellar biosynthetic protein FliP [Burkholderia vietnamiensis G4]
          Length = 253

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/235 (40%), Positives = 152/235 (64%), Gaps = 7/235 (2%)

Query: 14  PELVFAKSSLHDVMNI---PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFS 70
           P L  A+++     N    P   +  +  V+T  + T+LS  P +L+M+T F R IIV S
Sbjct: 22  PALACAQAAGLPAFNTSPGPNGGTTYSLSVQTMLLLTMLSFLPAMLLMMTSFTRIIIVLS 81

Query: 71  ILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAE 130
           +LR  +G  + PPN V++ LA+F+TF+VMSP LD++   G +P  +  +    A+QR   
Sbjct: 82  LLRQALGTATTPPNQVLLGLAMFLTFFVMSPVLDKAYNDGYKPFSDGSLPMEQAVQRGVA 141

Query: 131 PFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFL 190
           PF  FM   TRE DL+LF  ++ ++     +   + +   +L+P+F+ SEL+  F+IGF 
Sbjct: 142 PFKGFMLKQTRETDLALFAKISKAA----PMQGPEDVPLSLLVPAFVTSELKTGFQIGFT 197

Query: 191 IILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           I +PFLIID++VA+++M+MGMMM+ P+++SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 198 IFIPFLIIDLVVASVLMSMGMMMVSPSTVSLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|170755849|ref|YP_001782265.1| flagellar biosynthesis protein FliP [Clostridium botulinum B1 str.
           Okra]
 gi|169121061|gb|ACA44897.1| flagellar biosynthetic protein FliP [Clostridium botulinum B1 str.
           Okra]
          Length = 258

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 139/199 (69%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+L++ P  ++M+T F R I+VF  LR  MG    PPN V+I LALF+T ++M P     
Sbjct: 63  TVLTLLPSFIVMMTSFVRTIVVFGFLRNAMGTQQSPPNQVMIGLALFLTLFIMQPVYSEI 122

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
               IQP M N+I +  A++  A+P   FM   TR+KDL LF+D+A     N  +TK++ 
Sbjct: 123 NTKAIQPYMKNKINQEQAVEIGAKPLRQFMLKQTRQKDLKLFVDLAKP---NFKVTKDNA 179

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
             Y I++P+F+ISEL+ +F+IGFL+ +PFLIID++VA+++M+MGM MLPP  ISLPFK++
Sbjct: 180 PLY-IVVPAFIISELKTAFQIGFLLFIPFLIIDLVVASVLMSMGMFMLPPVMISLPFKLL 238

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FV++DGW LLV++LV SF
Sbjct: 239 LFVMVDGWYLLVKSLVMSF 257


>gi|15615005|ref|NP_243308.1| flagellar biosynthesis protein FliP [Bacillus halodurans C-125]
 gi|10175062|dbj|BAB06161.1| flagellar protein required for flagellar formation [Bacillus
           halodurans C-125]
          Length = 233

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 139/194 (71%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LI++TCF R +IV S +RTG+   ++PPN VII +ALF+TF++M+P      +  +
Sbjct: 43  APSILILMTCFTRVVIVLSFVRTGLATQTMPPNQVIIGIALFITFFIMAPVFAEVNDQAL 102

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
            P ++ +I +  A+ R A P   FM  +TREKDL+LFM   ++ H   +  ++  I    
Sbjct: 103 TPFLDGEIDQQEAMDRAAIPMKEFMAKHTREKDLALFM--GYAGHDRPESIED--IPLTA 158

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F ISEL+ +F+IGFLI +PFL+IDMIVA+++M+MGMMMLPP  ISLPFK++ FVL+
Sbjct: 159 LVPAFAISELKTAFQIGFLIFIPFLVIDMIVASVLMSMGMMMLPPIMISLPFKILLFVLV 218

Query: 232 DGWSLLVENLVKSF 245
           DGW L+V++L+ SF
Sbjct: 219 DGWYLVVQSLLLSF 232


>gi|307131599|ref|YP_003883615.1| flagellar biosynthesis protein fliP [Dickeya dadantii 3937]
 gi|306529128|gb|ADM99058.1| Flagellar biosynthesis protein fliP [Dickeya dadantii 3937]
          Length = 258

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 161/248 (64%), Gaps = 10/248 (4%)

Query: 1   MIRYCFFA-LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLI 57
           ++RY   + L L+ P    A + L  +++ P      +W   ++T    T LS  P +L+
Sbjct: 16  LLRYPAASILLLIAPH---ALAQLPGIISQPLANGGQSWSLPIQTLVFITSLSFIPAVLL 72

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           M+TCF R IIV S+LR  +G  + PPN V++ L+LF+TF+VMSP L+R  +   +P   +
Sbjct: 73  MMTCFTRIIIVLSLLRNALGTPTAPPNQVLLGLSLFLTFFVMSPVLNRIYDEAYRPFSED 132

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           +I+   AI++ ++P   FM   TRE DL+LF  +A        +   + +  R+L+P+++
Sbjct: 133 KISMEVAIEKGSQPLREFMLRQTREADLALFTRLAQIP----SLQGPEAVPMRVLVPAYV 188

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
            SEL+ +F+IGF I +PFL+ID++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL
Sbjct: 189 TSELKTAFQIGFTIFIPFLLIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLL 248

Query: 238 VENLVKSF 245
           + +L +SF
Sbjct: 249 LGSLAQSF 256


>gi|213612735|ref|ZP_03370561.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
          Length = 206

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 141/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L+  P +L+M+T F R IIVF +LR  +G  S PPN V++ LALF+TF++M
Sbjct: 3   VQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIM 62

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP +D+      QP    +I+   A+ + A+P   FM   TRE DL+LF  +A+S     
Sbjct: 63  SPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSG---- 118

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +  RIL+P+++ SEL+ +F+IGF I +PFLIID+++A+++MA+GMMM+PP +I
Sbjct: 119 PLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATI 178

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL+DGW LLV +L +SF
Sbjct: 179 ALPFKLMLFVLVDGWQLLVGSLAQSF 204


>gi|138894755|ref|YP_001125208.1| flagellar biosynthesis protein FliP [Geobacillus
           thermodenitrificans NG80-2]
 gi|196247623|ref|ZP_03146325.1| flagellar biosynthetic protein FliP [Geobacillus sp. G11MC16]
 gi|134266268|gb|ABO66463.1| Flagellar protein [Geobacillus thermodenitrificans NG80-2]
 gi|196212407|gb|EDY07164.1| flagellar biosynthetic protein FliP [Geobacillus sp. G11MC16]
          Length = 222

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 139/195 (71%), Gaps = 4/195 (2%)

Query: 51  IAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMG 110
           IAP +LIM+TCF R +IV S +RT +G   +PPN V+I LALF+TF++M+PT     +  
Sbjct: 31  IAPGILIMMTCFTRIVIVLSFVRTSLGTQQMPPNQVLIGLALFLTFFIMAPTWKDINDQA 90

Query: 111 IQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYR 170
           +QPL   +I    A +R A P   FM  +TR++DL+LF+  + +    T    ND I   
Sbjct: 91  LQPLFAEKIDLDEAYERAAIPLKQFMSKHTRQQDLALFLSYSGAEQPKT---VND-IPLT 146

Query: 171 ILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVL 230
            L+P+F ISEL+ +F++GF+I +PFL+IDMIVA+++M+MGMMMLPP  ISLPFK++ FVL
Sbjct: 147 ALVPAFAISELKTAFQMGFMIFIPFLVIDMIVASVLMSMGMMMLPPVMISLPFKILLFVL 206

Query: 231 IDGWSLLVENLVKSF 245
           +DGW L+V++L++SF
Sbjct: 207 VDGWYLVVKSLLQSF 221


>gi|157145258|ref|YP_001452577.1| flagellar biosynthesis protein FliP [Citrobacter koseri ATCC
           BAA-895]
 gi|78100273|gb|ABB20928.1| flagellar biosynthesis/transport protein [Citrobacter koseri]
 gi|157082463|gb|ABV12141.1| hypothetical protein CKO_00995 [Citrobacter koseri ATCC BAA-895]
          Length = 245

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 158/247 (63%), Gaps = 9/247 (3%)

Query: 1   MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIM 58
           ++     AL+ ++P    A + L  +++ P      +W   V+T    T L+  P +L+M
Sbjct: 4   LLSLTLMALWFISPA---AFAQLPGLVSQPLPGGGQSWSLPVQTLVFITSLTFLPAILLM 60

Query: 59  VTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQ 118
           +T F R IIVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +
Sbjct: 61  MTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAWQPFSEEK 120

Query: 119 ITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMI 178
           I+   A+++ A+P   FM   TRE DL LF  +A+S      +   + +  RIL+P+++ 
Sbjct: 121 ISMQEALEKGAQPLREFMLRQTREADLGLFARLANSG----PLQGPEAVPMRILLPAYVT 176

Query: 179 SELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLV 238
           SEL+ +F+IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV
Sbjct: 177 SELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLV 236

Query: 239 ENLVKSF 245
            +L +SF
Sbjct: 237 GSLAQSF 243


>gi|292487982|ref|YP_003530859.1| flagellar biosynthetic protein FliP [Erwinia amylovora CFBP1430]
 gi|292899202|ref|YP_003538571.1| flagellar biosynthetic protein [Erwinia amylovora ATCC 49946]
 gi|291199050|emb|CBJ46161.1| flagellar biosynthetic protein [Erwinia amylovora ATCC 49946]
 gi|291553406|emb|CBA20451.1| Flagellar biosynthetic protein FliP precursor [Erwinia amylovora
           CFBP1430]
          Length = 245

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 100/240 (41%), Positives = 157/240 (65%), Gaps = 9/240 (3%)

Query: 8   ALFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRF 65
           ALF++ P  V+A+  L  +++ P      +W   V+T    T L+  P +L+++T F R 
Sbjct: 11  ALFMLAPN-VYAQ--LPGLISQPTANGGQSWSLPVQTLVFITSLTFLPAILLLMTSFTRI 67

Query: 66  IIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAI 125
           IIVF +LR  +G  S PPN V++ L+LF+TF++M P  D+      QP   ++I+   AI
Sbjct: 68  IIVFGLLRNALGTPSAPPNQVLLGLSLFLTFFIMGPVFDKIYTDAYQPFSEDKISMQEAI 127

Query: 126 QRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSF 185
            + A+P   FM   TRE DL+LF  +A++      I   + +  RIL+P+++ SEL+ +F
Sbjct: 128 DKGAQPLREFMLRQTREADLALFARLANTP----PIAGPEAVPMRILLPAYVTSELKTAF 183

Query: 186 EIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +IGF + +PFLIID++VA+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 184 QIGFTVFIPFLIIDLVVASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVSSLAQSF 243


>gi|170722844|ref|YP_001750532.1| flagellar biosynthesis protein FliP [Pseudomonas putida W619]
 gi|169760847|gb|ACA74163.1| flagellar biosynthetic protein FliP [Pseudomonas putida W619]
          Length = 255

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 134/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  +I++T F R IIVFSILR  +G+   P N V+  +ALF+T ++M+P  D
Sbjct: 56  IMTALSFIPAFVILMTSFTRIIIVFSILRQALGLQQTPSNQVLTGMALFLTMFIMAPVFD 115

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  Q+T   AI +   P   FM   TR+ DL LFM ++    + TDI   
Sbjct: 116 RVNQDALQPYLKEQMTAQQAIDKAQGPLKDFMLAQTRQSDLDLFMRLS----KRTDIAGP 171

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   IL+P+F+ SEL+ +F+IGF+I +PFLIIDM+VA+++MAMGMMML P  ISLPFK
Sbjct: 172 DQVPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDMVVASVLMAMGMMMLSPLIISLPFK 231

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 232 IMLFVLVDGWALIMGTLAGSF 252


>gi|91211166|ref|YP_541152.1| flagellar biosynthesis protein FliP [Escherichia coli UTI89]
 gi|117624088|ref|YP_853001.1| flagellar biosynthesis protein FliP [Escherichia coli APEC O1]
 gi|218558805|ref|YP_002391718.1| flagellar biosynthesis protein FliP [Escherichia coli S88]
 gi|91072740|gb|ABE07621.1| flagellar assembly protein FliP [Escherichia coli UTI89]
 gi|115513212|gb|ABJ01287.1| flagellar assembly protein FliP [Escherichia coli APEC O1]
 gi|218365574|emb|CAR03301.1| flagellar biosynthesis protein [Escherichia coli S88]
 gi|294490075|gb|ADE88831.1| flagellar biosynthetic protein FliP [Escherichia coli IHE3034]
 gi|307626576|gb|ADN70880.1| flagellar biosynthesis protein FliP [Escherichia coli UM146]
 gi|323952441|gb|EGB48314.1| flagellar biosynthetic protein FliP [Escherichia coli H252]
          Length = 245

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 156/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+LVTP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLVTP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFNEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           +  +P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGEQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|283832657|ref|ZP_06352398.1| flagellar biosynthetic protein FliP [Citrobacter youngae ATCC
           29220]
 gi|291072331|gb|EFE10440.1| flagellar biosynthetic protein FliP [Citrobacter youngae ATCC
           29220]
          Length = 245

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 151/229 (65%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T    T L+  P +L+M+T F R IIVF +LR  +
Sbjct: 19  ALAQLPGLVSQPLPGGGQSWSLPVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNAL 78

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A+++ A+P   FM
Sbjct: 79  GTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEAMEKGAQPLREFM 138

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+LF  +A+S      +   + +  RIL+P+++ SEL+ +F+IGF I +PFL
Sbjct: 139 LRQTREADLALFARLANSG----PLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFL 194

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 195 IIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|332756104|gb|EGJ86457.1| flagellar biosynthetic protein FliP [Shigella flexneri 4343-70]
 gi|333003359|gb|EGK22905.1| flagellar biosynthetic protein FliP [Shigella flexneri K-218]
          Length = 245

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 157/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+L+TP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLITP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +++      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVINKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|162210056|ref|YP_331659.2| flagellar biosynthesis protein FliP [Burkholderia pseudomallei
           1710b]
          Length = 253

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 138/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  S PPN V++ LALF+T +VM
Sbjct: 51  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQAIGTASTPPNQVLVGLALFLTLFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+     +P     +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDRAYNDAYKPFSEGTLQMDQAVQRGTAPFKAFMLKQTRETDLALFAKISKAAP--- 167

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P ++
Sbjct: 168 -MQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|292493587|ref|YP_003529026.1| flagellar biosynthetic protein FliP [Nitrosococcus halophilus Nc4]
 gi|291582182|gb|ADE16639.1| flagellar biosynthetic protein FliP [Nitrosococcus halophilus Nc4]
          Length = 269

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 141/209 (67%), Gaps = 4/209 (1%)

Query: 37  TWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTF 96
           T  ++  G+ T L++ P  ++M+T F R I+V SILR  +G+   P + ++I L LF+TF
Sbjct: 61  TVTLQILGLMTALTLLPAAVMMMTSFTRIIVVLSILRQALGLAQTPSSQILIGLTLFLTF 120

Query: 97  YVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSH 156
           ++M P LD++ + G++P +  +I+ T A+ R  EPF  FM   TRE DL LF ++A    
Sbjct: 121 FIMGPVLDKAYQEGVRPYLQEEISVTEALVRTREPFRHFMMAQTRETDLQLFAEIAGQKA 180

Query: 157 RNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPP 216
             +       + + +L+P+F+ SEL+ +F+IGFL+ +PFLIID++VA+++MAMGMMML P
Sbjct: 181 FESP----AQVPFSLLVPAFITSELKTAFQIGFLLFIPFLIIDLVVASVLMAMGMMMLSP 236

Query: 217 TSISLPFKVIFFVLIDGWSLLVENLVKSF 245
             +SLPFK++ FVLIDGWSLL+  L  SF
Sbjct: 237 MLVSLPFKLLLFVLIDGWSLLMGTLASSF 265


>gi|304398865|ref|ZP_07380735.1| flagellar biosynthetic protein FliP [Pantoea sp. aB]
 gi|308187300|ref|YP_003931431.1| Flagellar biosynthetic protein fliP [Pantoea vagans C9-1]
 gi|304353569|gb|EFM17946.1| flagellar biosynthetic protein FliP [Pantoea sp. aB]
 gi|308057810|gb|ADO09982.1| Flagellar biosynthetic protein fliP [Pantoea vagans C9-1]
          Length = 244

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 143/206 (69%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L+  P +L+M+T F R IIVF +LR  +G  S PPN V++ L+LF+TF++M
Sbjct: 41  VQTLVFITALTFIPAVLLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLSLFLTFFIM 100

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT D+  +    P   ++I+   AI + A+P   FM   TRE DL+LF  +A+++    
Sbjct: 101 APTFDKIYQDAYLPFSQDKISMDVAIDKGAQPLREFMLRQTREADLALFARLANTA---- 156

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            I   + +  RIL+P+++ SEL+ +F+IGF + +PFLIID++VA+++MA+GMMM+PP SI
Sbjct: 157 PIAGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFLIIDLVVASVLMALGMMMVPPASI 216

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL+DGW LLV +L +SF
Sbjct: 217 ALPFKLMLFVLVDGWQLLVGSLAQSF 242


>gi|212709502|ref|ZP_03317630.1| hypothetical protein PROVALCAL_00544 [Providencia alcalifaciens DSM
           30120]
 gi|212687840|gb|EEB47368.1| hypothetical protein PROVALCAL_00544 [Providencia alcalifaciens DSM
           30120]
          Length = 247

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 134/193 (69%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +L+M+T F R IIV  +LR  +G  S PPN V++ LALF+TF+VMSP  D+      Q
Sbjct: 57  PAMLLMMTSFTRIIIVLGLLRNALGTPSAPPNQVLLGLALFLTFFVMSPVADQVYREAYQ 116

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P   ++I+  TA+++   P   FM   TRE DL+LF  +A    +  DI +   +  RIL
Sbjct: 117 PFSEDKISLETALEKGTAPLRTFMLGQTRESDLALFARIA----KVGDIQEAKDVPMRIL 172

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           IP+F+ SEL+ +F+IGF I +PFLIID++VA+++MA+GMMM+PP ++SLPFK++ FVL+D
Sbjct: 173 IPAFITSELKTAFQIGFTIFIPFLIIDLVVASVLMALGMMMVPPATVSLPFKLMLFVLVD 232

Query: 233 GWSLLVENLVKSF 245
           GW LL+ +L +SF
Sbjct: 233 GWQLLLGSLSQSF 245


>gi|331683500|ref|ZP_08384101.1| flagellar biosynthetic protein FliP [Escherichia coli H299]
 gi|331079715|gb|EGI50912.1| flagellar biosynthetic protein FliP [Escherichia coli H299]
          Length = 245

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 156/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+L+TP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLITP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           +  +P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGVQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|212639551|ref|YP_002316071.1| flagellar biosynthesis protein FliP [Anoxybacillus flavithermus
           WK1]
 gi|212561031|gb|ACJ34086.1| Flagellar biosynthesis pathway, component FliP [Anoxybacillus
           flavithermus WK1]
          Length = 221

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 136/195 (69%), Gaps = 4/195 (2%)

Query: 51  IAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMG 110
           IAP +LIMVT F R +IV S +RT +G   +PPN V+I L+LF+TF++M+PT  +     
Sbjct: 31  IAPGILIMVTSFTRIVIVLSFVRTALGTQQMPPNQVMIGLSLFLTFFIMAPTFQQINRDA 90

Query: 111 IQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYR 170
           +QPL + +I    A +R   P   FM  +TR+KDL+LF+  A +    T       I   
Sbjct: 91  LQPLFDEKINLEQAYERAEAPLKEFMSKHTRQKDLALFLSYAGAEQPKT----VQDIPMS 146

Query: 171 ILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVL 230
            L+P+F ISEL+ +F+IGF++ +PFL+IDMIVA+++M+MGMMMLPP  ISLPFK++ FVL
Sbjct: 147 ALVPAFAISELKTAFQIGFMLFIPFLVIDMIVASVLMSMGMMMLPPVMISLPFKILLFVL 206

Query: 231 IDGWSLLVENLVKSF 245
           +DGW L+V++L++SF
Sbjct: 207 VDGWYLVVKSLLESF 221


>gi|308173598|ref|YP_003920303.1| flagellar export protein [Bacillus amyloliquefaciens DSM 7]
 gi|307606462|emb|CBI42833.1| component of the flagellar export machinery [Bacillus
           amyloliquefaciens DSM 7]
 gi|328553470|gb|AEB23962.1| flagellar biosynthesis protein FliP [Bacillus amyloliquefaciens
           TA208]
 gi|328911739|gb|AEB63335.1| component of the flagellar export machinery [Bacillus
           amyloliquefaciens LL3]
          Length = 221

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 144/206 (69%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+   + T+ S+AP +LI++TCF R +IV S +RT +   ++PPN V+I LALF+TF++M
Sbjct: 20  VKLLLLLTVFSVAPGILILMTCFTRIVIVLSFVRTSLATQNMPPNQVLIGLALFLTFFIM 79

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT     +  + PLM+N+I+   A  +  +P   +M  +TR+KDL+LFM+ A      +
Sbjct: 80  APTFSEINKDALTPLMDNKISLDEAYTKAEKPIKEYMSKHTRQKDLALFMNYAKMKKPES 139

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                  I    ++P++ ISEL+ +F++GF+I +PFLIIDM+VA+++M+MGMMMLPP  I
Sbjct: 140 I----QDIPLTTMVPAYAISELKTAFQMGFMIFIPFLIIDMVVASVLMSMGMMMLPPVMI 195

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW L+V++L+ SF
Sbjct: 196 SLPFKILLFVLVDGWYLIVKSLLDSF 221


>gi|167813515|ref|ZP_02445195.1| flagellar biosynthesis protein FliP [Burkholderia pseudomallei 91]
 gi|167822057|ref|ZP_02453528.1| flagellar biosynthesis protein FliP [Burkholderia pseudomallei 9]
 gi|167843670|ref|ZP_02469178.1| flagellar biosynthesis protein FliP [Burkholderia pseudomallei
           B7210]
 gi|167892141|ref|ZP_02479543.1| flagellar biosynthesis protein FliP [Burkholderia pseudomallei
           7894]
 gi|167900653|ref|ZP_02487858.1| flagellar biosynthesis protein FliP [Burkholderia pseudomallei NCTC
           13177]
 gi|167908873|ref|ZP_02495964.1| flagellar biosynthesis protein FliP [Burkholderia pseudomallei 112]
 gi|167916912|ref|ZP_02504003.1| flagellar biosynthesis protein FliP [Burkholderia pseudomallei
           BCC215]
          Length = 253

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 138/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  S PPN V++ LALF+T +VM
Sbjct: 51  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQAIGTASTPPNQVLVGLALFLTLFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+     +P     +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDRAYNDAYKPFSEGTLQMDQAVQRGTAPFKAFMLKQTRETDLALFAKISKAAP--- 167

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P ++
Sbjct: 168 -MQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|295678047|ref|YP_003606571.1| flagellar biosynthetic protein FliP [Burkholderia sp. CCGE1002]
 gi|295437890|gb|ADG17060.1| flagellar biosynthetic protein FliP [Burkholderia sp. CCGE1002]
          Length = 269

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 93/207 (44%), Positives = 140/207 (67%), Gaps = 4/207 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +++M+T F R +IV S+LR  +G  + PPN V++ LALF+TF+VM
Sbjct: 67  VQTMLLLTMLSFLPAMVLMMTSFTRIVIVLSLLRQALGTTTTPPNQVLVGLALFLTFFVM 126

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD++   G +P     +    A+ R   PF  FM   TRE DL+LF  ++H++    
Sbjct: 127 SPVLDKAYNEGYKPFSEGTLPMDQAVSRGVAPFKTFMLRQTRESDLALFARISHAA---- 182

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+PSF+ SEL+  F IGF I +PFLIIDM+VA+++M+MGMMM+ P +I
Sbjct: 183 PMQGPEDVPLSLLVPSFVTSELKTGFTIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATI 242

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSFI 246
           SLPFK++ FVL+DGW LL+ +L +SF+
Sbjct: 243 SLPFKLMLFVLVDGWQLLLGSLAQSFV 269


>gi|168186132|ref|ZP_02620767.1| flagellar biosynthetic protein FliP [Clostridium botulinum C str.
           Eklund]
 gi|169295707|gb|EDS77840.1| flagellar biosynthetic protein FliP [Clostridium botulinum C str.
           Eklund]
          Length = 257

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 151/221 (68%), Gaps = 6/221 (2%)

Query: 25  DVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPN 84
           D  N P D   +   ++   + T++S+ P  L+M+T F R I+V   +R+ +G    PPN
Sbjct: 41  DQANSPKDYVDN---IKLLVMLTVISLLPSFLVMMTSFTRIIVVLGFMRSALGTQQAPPN 97

Query: 85  LVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKD 144
            +++ +ALF+T ++M+PT     +  I+P + N+IT+T A+   ++P   FM   TR+KD
Sbjct: 98  QILVGIALFLTIFIMAPTYKTINKEAIKPFLENKITQTEALNNASKPMREFMLKQTRDKD 157

Query: 145 LSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVAT 204
           L LF+D++ +    T ITK +++   ++IPSF+ISEL+ +F+IGFL+ +PFLIID++VA+
Sbjct: 158 LELFLDISKTDK--TKITK-ENVPMYVVIPSFIISELKTAFKIGFLLFIPFLIIDIVVAS 214

Query: 205 IVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           ++M+MGM MLPP  ISLPFK++ FV++DGW LLV++LV  +
Sbjct: 215 VLMSMGMFMLPPVMISLPFKLLLFVMVDGWYLLVKSLVMGY 255


>gi|85060034|ref|YP_455736.1| flagellar biosynthesis protein FliP [Sodalis glossinidius str.
           'morsitans']
 gi|84780554|dbj|BAE75331.1| flagellar biosynthesis protein FliP [Sodalis glossinidius str.
           'morsitans']
          Length = 253

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 103/240 (42%), Positives = 153/240 (63%), Gaps = 8/240 (3%)

Query: 8   ALFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRF 65
           AL L+     FA+  L  +++ P       W   V+T    T L+  P  L+M+T F R 
Sbjct: 18  ALMLLFAPACFAQ--LPSIISQPLPGGSQNWSLPVQTLVFLTSLTFIPAALLMMTSFTRI 75

Query: 66  IIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAI 125
           IIV  +LR+ +G  S PPN V++ LALF+TF+VMSP LD        PL  N+I+  TA+
Sbjct: 76  IIVLGLLRSAIGTPSAPPNQVLLGLALFLTFFVMSPVLDSIYTEAYLPLSENKISMQTAL 135

Query: 126 QRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSF 185
           +R ++P   FM   TRE DL LF  +A+       +   + +  RIL+P+++ SEL+ +F
Sbjct: 136 ERGSQPLRAFMLRQTREADLGLFARLANVP----PLEGPEAVPMRILLPAYVTSELKTAF 191

Query: 186 EIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +IGF + +PFLIID++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 192 QIGFTLFIPFLIIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLSSLAQSF 251


>gi|167717397|ref|ZP_02400633.1| flagellar biosynthesis protein FliP [Burkholderia pseudomallei
           DM98]
          Length = 244

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 138/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  S PPN V++ LALF+T +VM
Sbjct: 42  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQAIGTASTPPNQVLVGLALFLTLFVM 101

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+     +P     +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 102 SPVLDRAYNDAYKPFSEGTLQMDQAVQRGTAPFKAFMLKQTRETDLALFAKISKAAP--- 158

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P ++
Sbjct: 159 -MQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATV 217

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 218 SLPFKLMLFVLVDGWQLLIGSLAQSF 243


>gi|237731996|ref|ZP_04562477.1| flagellar biosynthesis protein FliP [Citrobacter sp. 30_2]
 gi|226907535|gb|EEH93453.1| flagellar biosynthesis protein FliP [Citrobacter sp. 30_2]
          Length = 245

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 150/229 (65%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P       W   V+T    T L+  P +L+M+T F R IIVF +LR  +
Sbjct: 19  ALAQLPGLVSQPLPGGGQNWTLPVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNAL 78

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A+++ A+P   FM
Sbjct: 79  GTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEAMEKGAQPLREFM 138

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+LF  +A+S      +   + +  RIL+P+++ SEL+ +F+IGF I +PFL
Sbjct: 139 LRQTREADLALFARLANSG----PLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFL 194

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 195 IIDLVIASVLMALGMMMVPPATIALPFKMMLFVLVDGWQLLVGSLAQSF 243


>gi|37525861|ref|NP_929205.1| flagellar biosynthesis protein FliP [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36785290|emb|CAE14231.1| flagellar biosynthetic protein FliP [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 244

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 98/229 (42%), Positives = 147/229 (64%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T    T L+  P  L+M+T F R IIV  +LR  +
Sbjct: 18  AAAQLPGIISQPLANGGQSWSLPVQTLVFITALTFIPAALLMMTSFTRIIIVLGLLRNAL 77

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ LALFMTF++MSP  D+  +    P   ++I+  TA++  A+P   FM
Sbjct: 78  GTPSAPPNQVLLGLALFMTFFIMSPVFDKVYQDAYLPFSEDKISLETALENGAKPLRQFM 137

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+LF  +A      T     D +  R+L+P+F+ SEL+ +F+IGF + +PFL
Sbjct: 138 LRQTRENDLALFARLADQPPFET----ADSVPMRVLMPAFITSELKTAFQIGFTLFIPFL 193

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 194 IIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSF 242


>gi|187778762|ref|ZP_02995235.1| hypothetical protein CLOSPO_02357 [Clostridium sporogenes ATCC
           15579]
 gi|187772387|gb|EDU36189.1| hypothetical protein CLOSPO_02357 [Clostridium sporogenes ATCC
           15579]
          Length = 258

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 137/199 (68%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+L++ P  ++M+T F R I+VF  LR  MG    PPN V+I LALF+T ++M P     
Sbjct: 63  TVLTLLPSFIVMMTSFVRTIVVFGFLRNAMGTQQSPPNQVMIGLALFLTLFIMRPVYTEI 122

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
               IQP M N+IT+  A++  A+P   FM   TR+KDL LF+D+   + + T     D+
Sbjct: 123 NTKAIQPYMKNKITQEQAVEIGAKPLRQFMLKQTRQKDLKLFVDLGKPNFKVTK----DN 178

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
               I++P+F+ISEL+ +F+IGFL+ +PFLIID++VA+++M+MGM MLPP  ISLPFK++
Sbjct: 179 APLDIVVPAFIISELKTAFQIGFLLFIPFLIIDLVVASVLMSMGMFMLPPVMISLPFKLL 238

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FV++DGW LLV++LV SF
Sbjct: 239 LFVMVDGWYLLVKSLVMSF 257


>gi|254258156|ref|ZP_04949210.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           1710a]
 gi|254298637|ref|ZP_04966088.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           406e]
 gi|76580117|gb|ABA49592.1| flagellar biosynthetic protein [Burkholderia pseudomallei 1710b]
 gi|157808588|gb|EDO85758.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           406e]
 gi|254216845|gb|EET06229.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           1710a]
          Length = 276

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 138/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  S PPN V++ LALF+T +VM
Sbjct: 74  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQAIGTASTPPNQVLVGLALFLTLFVM 133

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+     +P     +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 134 SPVLDRAYNDAYKPFSEGTLQMDQAVQRGTAPFKAFMLKQTRETDLALFAKISKAAP--- 190

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P ++
Sbjct: 191 -MQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATV 249

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 250 SLPFKLMLFVLVDGWQLLIGSLAQSF 275


>gi|332524236|ref|ZP_08400462.1| flagellar biosynthesis protein FliP [Rubrivivax benzoatilyticus
           JA2]
 gi|332107571|gb|EGJ08795.1| flagellar biosynthesis protein FliP [Rubrivivax benzoatilyticus
           JA2]
          Length = 252

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 139/207 (67%), Gaps = 4/207 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P LL+++T F R +IV S+LR  +G  + PPN VII ++LF+TF+VM
Sbjct: 49  IQTLLFFTALSFIPALLLLMTGFTRIVIVLSLLRQALGTQAAPPNQVIIGMSLFLTFFVM 108

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SPT DR  +   +P   NQI    A++R   P   FM   TR+ D+ LF  +A       
Sbjct: 109 SPTFDRVYDQAYKPFAENQIAFDEALKRGEVPMREFMLKQTRQSDVQLFAKLAKLPAE-- 166

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
              K++ +  R+L+P+F+ SEL+ +F+IGF+I +PFLIIDMIVA+++M++GMMML P  +
Sbjct: 167 --VKSEDVPLRVLVPAFVTSELKSAFQIGFMIFIPFLIIDMIVASVLMSLGMMMLSPVLV 224

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSFI 246
           +LPFK++ FVL DGW+LL+ +L  SF+
Sbjct: 225 ALPFKLMLFVLADGWNLLLGSLAASFV 251


>gi|157164339|ref|YP_001466589.1| flagellar biosynthesis protein FliP [Campylobacter concisus 13826]
 gi|112800704|gb|EAT98048.1| flagellar biosynthetic protein FliP [Campylobacter concisus 13826]
          Length = 243

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 134/194 (69%), Gaps = 6/194 (3%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P L+ M+T F R +IVFS LR  MG   VPP+ V+ISLA+ +TF++M P   RS + GI+
Sbjct: 54  PSLIFMMTSFLRLVIVFSFLRQAMGTQQVPPSTVLISLAMVLTFFIMEPVGQRSYDEGIK 113

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN-DHIEYRI 171
           P +  QI     + +  +PF  FM  NTREKDL+LF  +     RN     N + I   I
Sbjct: 114 PYIAEQIGYEEMLDKSLKPFKEFMVKNTREKDLALFFRI-----RNLQNPANIEDIPLSI 168

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
            + +FMISEL+ SFEI FL+ LPFL+IDM+V++++MAMGMMMLPP  ISLPFK++ FVL+
Sbjct: 169 AMSAFMISELKTSFEIAFLLYLPFLVIDMVVSSVLMAMGMMMLPPVMISLPFKLLIFVLV 228

Query: 232 DGWSLLVENLVKSF 245
           DGW+LL+ NLVKSF
Sbjct: 229 DGWNLLIGNLVKSF 242


>gi|305674368|ref|YP_003866040.1| flagellar export machinery protein [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|305412612|gb|ADM37731.1| component of the flagellar export machinery [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 221

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+   + T+ S+AP +LI++TCF R +IV S +RT +   S+PPN V+I LALF+TF++M
Sbjct: 20  VKLLLLLTVFSVAPGILILMTCFTRIVIVLSFVRTSLATQSMPPNQVLIGLALFLTFFIM 79

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT     +  + PLM+N+I+   A  +  EP   FM  +TR+KDL+LFM+ A      +
Sbjct: 80  APTFSEINKEALTPLMDNKISLDEAYSKAEEPIKEFMSKHTRQKDLALFMNYAKMDKPES 139

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                  I    ++P+F    L+ +F+IGF+I +PFLIIDM+VA+++M+MGMMMLPP  I
Sbjct: 140 ----LKDIPLTTMVPAFATPILKTAFQIGFMIFIPFLIIDMVVASVLMSMGMMMLPPVMI 195

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW L+V++L++SF
Sbjct: 196 SLPFKILLFVLVDGWYLIVKSLLQSF 221


>gi|300717241|ref|YP_003742044.1| flagellar biosynthesis protein [Erwinia billingiae Eb661]
 gi|299063077|emb|CAX60197.1| Flagellar biosynthesis protein [Erwinia billingiae Eb661]
          Length = 244

 Score =  191 bits (486), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 97/227 (42%), Positives = 149/227 (65%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  +M+ P      +W   V+T    T L+  P +L+M+T F R IIVF +LR  +G 
Sbjct: 20  AQLPGLMSHPTANGGQSWSLPVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGT 79

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ LALF+TF++M P  D+  +    P   ++I+   AI + A+P   FM  
Sbjct: 80  PSAPPNQVLLGLALFLTFFIMGPVFDKIYQDAYLPFSQDKISMQDAIDKGAQPLREFMLR 139

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+LF  +++S      +   + +  RIL+P+++ SEL+ +F+IGF + +PFLII
Sbjct: 140 QTREADLALFARLSNSP----PLQGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFLII 195

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGWSLLV +L +SF
Sbjct: 196 DLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWSLLVSSLAQSF 242


>gi|310764878|gb|ADP09828.1| Flagellar biosynthetic protein FliP [Erwinia sp. Ejp617]
          Length = 247

 Score =  191 bits (486), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + + L+  P +L+M+T F R IIV  ++R  +G  + PPN V++ LALF+TFYVM
Sbjct: 44  VQTLVLLSSLTFLPAVLLMMTGFTRIIIVLGLMRNALGTPTAPPNQVLVGLALFLTFYVM 103

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP  ++  E   QPL  ++IT   A+++  +P   FM + TRE DL++F  +A +     
Sbjct: 104 SPVFNQIYEQAWQPLQEDKITMEVALEQGVKPLRAFMLDQTRENDLAMFAQIAKAG---- 159

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           +    + +   IL+P+F+ SEL+ +F+IGF I +PFLIID++VA+I+MA+GMMM+PP +I
Sbjct: 160 EFKGPEEVPLGILVPAFVTSELKTAFQIGFTIFIPFLIIDLVVASILMALGMMMVPPATI 219

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL+DGW LL+ +L +SF
Sbjct: 220 ALPFKLMLFVLVDGWQLLMGSLAQSF 245


>gi|253996309|ref|YP_003048373.1| flagellar biosynthetic protein FliP [Methylotenera mobilis JLW8]
 gi|253982988|gb|ACT47846.1| flagellar biosynthetic protein FliP [Methylotenera mobilis JLW8]
          Length = 251

 Score =  191 bits (486), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 96/209 (45%), Positives = 142/209 (67%), Gaps = 4/209 (1%)

Query: 37  TWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTF 96
           T  ++T  + T L+  P +++M+T F R IIV S+LR  +G  SVPPN V+I LALF+TF
Sbjct: 46  TLSLQTLILLTSLTFLPAIVLMMTGFTRIIIVLSLLRQALGTQSVPPNQVMIGLALFLTF 105

Query: 97  YVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSH 156
           +VMSP +D+      +PL  NQI+   A+ +   P   FM   TRE DL+LF+ MA    
Sbjct: 106 FVMSPVIDKIYVDAYKPLSENQISMQEAMDKGVAPLKEFMLKQTREGDLALFVKMAEVEK 165

Query: 157 RNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPP 216
               I   D +  ++L+P+F+ SEL+ +F+IGF I +PFLIIDM+VA+++M+MGMMM+ P
Sbjct: 166 ----IESPDQVPLKVLVPAFVTSELKTAFQIGFAIFIPFLIIDMVVASVLMSMGMMMVSP 221

Query: 217 TSISLPFKVIFFVLIDGWSLLVENLVKSF 245
             ++LPFK++ FVL+DGW L++ +LV+SF
Sbjct: 222 AIVALPFKLMLFVLVDGWQLILGSLVESF 250


>gi|167034912|ref|YP_001670143.1| flagellar biosynthesis protein FliP [Pseudomonas putida GB-1]
 gi|166861400|gb|ABY99807.1| flagellar biosynthetic protein FliP [Pseudomonas putida GB-1]
          Length = 251

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 94/201 (46%), Positives = 134/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  +I++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 52  IMTALSFIPAFVILMTSFTRIIIVFSILRQALGLQQTPSNQLLTGMALFLTMFIMAPVFD 111

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  Q+T   AI +   P   FM   TR+ DL LFM ++    + TDI   
Sbjct: 112 RVNQDALQPYLKEQMTAQQAIDKAQGPLKDFMLAQTRQSDLDLFMRLS----KRTDIAGP 167

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   IL+P+F+ SEL+ +F+IGF+I +PFLIIDM+VA+++MAMGMMML P  ISLPFK
Sbjct: 168 DQVPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDMVVASVLMAMGMMMLSPLIISLPFK 227

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 228 IMLFVLVDGWALIMGTLASSF 248


>gi|33592492|ref|NP_880136.1| flagellar biosynthesis protein FliP [Bordetella pertussis Tohama I]
 gi|33572138|emb|CAE41681.1| flagellar biosynthetic protein FliP [Bordetella pertussis Tohama I]
 gi|332381910|gb|AEE66757.1| flagellar biosynthesis protein FliP [Bordetella pertussis CS]
          Length = 244

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 146/234 (62%), Gaps = 6/234 (2%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIMVTCFPRFIIVFSI 71
           P    A+++L  +   P      T+ +  +T  + T LS  P  L+M+T F R IIV  +
Sbjct: 13  PSGALAQATLPALTATPGPNGSETYSLSMQTLLLMTSLSFLPAALLMMTGFTRIIIVLGL 72

Query: 72  LRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEP 131
           LR+ MG    PPN V+I LALF+TFY MSP  D+      QPL    I   TA++R   P
Sbjct: 73  LRSAMGTAMSPPNHVLIGLALFLTFYTMSPVFDKIYTDAYQPLAAGSIPFETAVERAGAP 132

Query: 132 FWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLI 191
              FM + TRE DL+LF ++A+       +     +  RILIP+F+ SEL+ +F+IGF I
Sbjct: 133 LHNFMLHQTRENDLTLFANLANLP----AMEDPSQVPMRILIPAFITSELKTAFQIGFTI 188

Query: 192 ILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
            +PFLIID++VA+++MA+GMMM+PP +++LPFK++ FVL DGW LL+ +L +SF
Sbjct: 189 FIPFLIIDLVVASVLMALGMMMVPPVTVALPFKLMLFVLADGWHLLLGSLAQSF 242


>gi|332343674|gb|AEE57008.1| flagellar biosynthetic protein FliP [Escherichia coli UMNK88]
          Length = 245

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 156/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+L+TP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLITP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM    RE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQIREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|126442020|ref|YP_001057087.1| flagellar biosynthesis protein FliP [Burkholderia pseudomallei 668]
 gi|126453057|ref|YP_001064317.1| flagellar biosynthesis protein FliP [Burkholderia pseudomallei
           1106a]
 gi|134281410|ref|ZP_01768118.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei 305]
 gi|217423958|ref|ZP_03455458.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei 576]
 gi|226193182|ref|ZP_03788792.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           Pakistan 9]
 gi|237814425|ref|YP_002898876.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           MSHR346]
 gi|242316101|ref|ZP_04815117.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           1106b]
 gi|254184095|ref|ZP_04890686.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           1655]
 gi|254186561|ref|ZP_04893078.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254194632|ref|ZP_04901063.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei S13]
 gi|42766712|gb|AAS45439.1| putative flagellar biosynthesis protein [Burkholderia pseudomallei]
 gi|126221513|gb|ABN85019.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei 668]
 gi|126226699|gb|ABN90239.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           1106a]
 gi|134247077|gb|EBA47163.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei 305]
 gi|157934246|gb|EDO89916.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           Pasteur 52237]
 gi|169651382|gb|EDS84075.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei S13]
 gi|184214627|gb|EDU11670.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           1655]
 gi|217393021|gb|EEC33043.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei 576]
 gi|225934782|gb|EEH30759.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           Pakistan 9]
 gi|237505052|gb|ACQ97370.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           MSHR346]
 gi|242139340|gb|EES25742.1| flagellar biosynthetic protein FliP [Burkholderia pseudomallei
           1106b]
          Length = 276

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 138/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  S PPN V++ LALF+T +VM
Sbjct: 74  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQAIGTASTPPNQVLVGLALFLTLFVM 133

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+     +P     +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 134 SPVLDRAYNDAYKPFSEGTLQMDQAVQRGTAPFKAFMLKQTRETDLALFAKISKAAP--- 190

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P ++
Sbjct: 191 -MQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATV 249

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 250 SLPFKLMLFVLVDGWQLLIGSLAQSF 275


>gi|253990104|ref|YP_003041460.1| flagellar biosynthesis protein FliP [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253781554|emb|CAQ84717.1| flagellar biosynthetic protein flip precursor [Photorhabdus
           asymbiotica]
          Length = 251

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 98/229 (42%), Positives = 146/229 (63%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T    T L   P  L+M+T F R IIV  +LR  +
Sbjct: 25  AAAQLPGIISQPLANGGQSWSLPVQTLVFITALGFIPAALLMMTSFTRIIIVLGLLRNAL 84

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ LALFMTF++MSP  D+  +    P   ++I+  TA++  A+P   FM
Sbjct: 85  GTPSAPPNQVLLGLALFMTFFIMSPVFDKVYQDAYLPFSEDKISLETALENGAKPLRQFM 144

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+LF  +A      T     D +  R+L+P+F+ SEL+ +F+IGF + +PFL
Sbjct: 145 LRQTRENDLALFARLADQPPFET----ADSVPMRVLMPAFITSELKTAFQIGFTLFIPFL 200

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 201 IIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSF 249


>gi|333003044|gb|EGK22598.1| flagellar biosynthetic protein FliP [Shigella flexneri VA-6]
          Length = 245

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 156/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+L+ P L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLIMP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|313682238|ref|YP_004059976.1| flagellar biosynthetic protein flip [Sulfuricurvum kujiense DSM
           16994]
 gi|313155098|gb|ADR33776.1| flagellar biosynthetic protein FliP [Sulfuricurvum kujiense DSM
           16994]
          Length = 244

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 135/193 (69%), Gaps = 4/193 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP L++++T F RF+IVF  LR  +G   VPP  +++ LAL +T +VM P   ++ + GI
Sbjct: 54  APSLVLVMTTFTRFVIVFGFLRQALGTQQVPPTQLLVMLALILTVFVMEPVATKAYDEGI 113

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           +P    +IT   A ++  EPF  FM  NTREKDL+LF+ + H  +  +       +   I
Sbjct: 114 KPYSEEKITYDEAFEKTTEPFKNFMVRNTREKDLALFLRIRHMQNPQSI----KEVPLTI 169

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           +IP+FMISEL+ +FEIGFL+ LPFL+IDM+VA+I+M+MGMMMLPP  IS+PFK++ FV++
Sbjct: 170 VIPAFMISELKTAFEIGFLLFLPFLVIDMVVASILMSMGMMMLPPVMISMPFKILVFVMV 229

Query: 232 DGWSLLVENLVKS 244
           DGW+LL+ NL+ S
Sbjct: 230 DGWNLLIGNLIAS 242


>gi|271500076|ref|YP_003333101.1| flagellar biosynthetic protein FliP [Dickeya dadantii Ech586]
 gi|270343631|gb|ACZ76396.1| flagellar biosynthetic protein FliP [Dickeya dadantii Ech586]
          Length = 258

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 101/248 (40%), Positives = 160/248 (64%), Gaps = 10/248 (4%)

Query: 1   MIRYCFFA-LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLI 57
           ++RY   + L L+ P    A + L  +++ P      +W   V+T    T LS  P +L+
Sbjct: 16  LLRYPAASMLLLIAPH---ALAQLPSIISHPLPNGGQSWSLPVQTLIFITALSFIPAVLL 72

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           M+TCF R IIV S+LR  +G  + PPN V++ L+LF+TF+VMSP L+R  +   +P   +
Sbjct: 73  MMTCFTRIIIVLSLLRNALGTPTAPPNQVLLGLSLFLTFFVMSPVLNRIYDEAYRPFSED 132

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           +I+   AI + ++P   FM   TRE DL+LF  +A        +   + +  R+L+P+++
Sbjct: 133 KISMEVAIDKGSKPLREFMLRQTREADLALFTRLAQIP----SLQGPEAVPMRVLVPAYV 188

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
            SEL+ +F+IGF I +PFL+ID++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL
Sbjct: 189 TSELKTAFQIGFTIFIPFLLIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLL 248

Query: 238 VENLVKSF 245
           + +L +SF
Sbjct: 249 LGSLAQSF 256


>gi|147678411|ref|YP_001212626.1| flagellar biosynthesis protein FliP [Pelotomaculum
           thermopropionicum SI]
 gi|146274508|dbj|BAF60257.1| flagellar biosynthesis pathway, component FliP [Pelotomaculum
           thermopropionicum SI]
          Length = 257

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 135/194 (69%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP  L+M+T F R IIV S+LRT +G+   P N ++I LALF+T ++M+P      +  I
Sbjct: 67  APAFLVMMTSFTRIIIVLSLLRTALGVHQAPANQIVIGLALFLTVFIMAPVYREINDNSI 126

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QP + NQI++  A +R  +P   FM   TREKDL LF+ +A          K + +   +
Sbjct: 127 QPYLQNQISQEEAQERGVKPLRDFMLRQTREKDLGLFISLAKMEKPE----KPEDVPLHV 182

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           +IPSF+ISEL+ +FEIGFL+ +PFL+IDM+VA+I+M+MGM MLPP  ISLPFK++ FV++
Sbjct: 183 VIPSFIISELKTAFEIGFLLFVPFLVIDMVVASILMSMGMFMLPPVMISLPFKILLFVMV 242

Query: 232 DGWSLLVENLVKSF 245
           DGW L+V++LV+SF
Sbjct: 243 DGWYLVVKSLVESF 256


>gi|317048609|ref|YP_004116257.1| flagellar biosynthetic protein FliP [Pantoea sp. At-9b]
 gi|316950226|gb|ADU69701.1| flagellar biosynthetic protein FliP [Pantoea sp. At-9b]
          Length = 244

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 98/229 (42%), Positives = 150/229 (65%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T    T L+  P +L+M+T F R IIVF +LR  +
Sbjct: 18  AHAQLPGLVSHPLANGGQSWSLPVQTLVFITSLTFIPAVLLMMTSFTRIIIVFGLLRNAL 77

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ LALF+TF++M+PT D+       P   ++I+   AI + A+P   FM
Sbjct: 78  GTPSAPPNQVLVGLALFLTFFIMAPTFDKIYSDAYLPFSQDKISMDVAIDKGAQPLREFM 137

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+LF  +A++      I   + +  RIL+P+++ SEL+ +F+IGF + +PFL
Sbjct: 138 LRQTREADLALFARLANTP----PIEGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFL 193

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LLV +L +SF
Sbjct: 194 IIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLVGSLAQSF 242


>gi|74312488|ref|YP_310907.1| flagellar biosynthesis protein FliP [Shigella sonnei Ss046]
 gi|73855965|gb|AAZ88672.1| flagellar biosynthesis [Shigella sonnei Ss046]
 gi|323168931|gb|EFZ54611.1| flagellar biosynthetic protein FliP [Shigella sonnei 53G]
          Length = 245

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 156/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+LVTP L FA+  L  + + P      +W   V+T    T L+  P +L+M+T F R I
Sbjct: 12  LWLVTP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MS  +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSSVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|325273552|ref|ZP_08139782.1| flagellar biosynthesis protein FliP [Pseudomonas sp. TJI-51]
 gi|324101312|gb|EGB98928.1| flagellar biosynthesis protein FliP [Pseudomonas sp. TJI-51]
          Length = 255

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 94/201 (46%), Positives = 134/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  +I++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 56  IMTALSFIPAFVILMTSFTRIIIVFSILRQALGLQQTPSNQLLTGMALFLTMFIMAPVFD 115

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  Q+T   AI +   P   FM   TR+ DL LFM ++    + TDI   
Sbjct: 116 RVNQDALQPYLKEQMTAQQAIDKAQGPLKDFMLAQTRQSDLDLFMRLS----KRTDIAGP 171

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   IL+P+F+ SEL+ +F+IGF+I +PFLIIDM+VA+++MAMGMMML P  ISLPFK
Sbjct: 172 DQVPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDMVVASVLMAMGMMMLSPLIISLPFK 231

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 232 IMLFVLVDGWALIMGTLASSF 252


>gi|124516299|gb|EAY57807.1| Flagellar biosynthesis protein FliP [Leptospirillum rubarum]
          Length = 265

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 134/193 (69%), Gaps = 3/193 (1%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +L+M+T F R ++V S LR  MG   VPPN V++ L+LF+TF+VM+P      E  I 
Sbjct: 75  PAILVMMTSFTRIVVVLSFLRQAMGTAQVPPNQVLVGLSLFLTFFVMAPVWKTMDETAIT 134

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P ++ +I    A+ R  +P   FM    R+KD++LF+ +AH     +     D I   +L
Sbjct: 135 PYLDKKIAPDVAVDRAMKPVRAFMFRQVRQKDIALFVRIAHLPRTPS---SPDDIPTYVL 191

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           IP+F++SEL  +FE+GFLI LPFLI+DM+V++++M+MGMMMLPPT +SLPFK++ FVL+D
Sbjct: 192 IPAFVVSELSTAFEMGFLIYLPFLILDMVVSSVLMSMGMMMLPPTVVSLPFKILLFVLVD 251

Query: 233 GWSLLVENLVKSF 245
           GWSL+V +LV+SF
Sbjct: 252 GWSLVVGSLVRSF 264


>gi|26991044|ref|NP_746469.1| flagellar biosynthesis protein FliP [Pseudomonas putida KT2440]
 gi|24986076|gb|AAN69933.1|AE016632_4 flagellar biosynthetic protein FliP [Pseudomonas putida KT2440]
 gi|5921665|gb|AAD01927.2| FliP [Pseudomonas putida]
 gi|313497809|gb|ADR59175.1| FliP [Pseudomonas putida BIRD-1]
          Length = 251

 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 94/201 (46%), Positives = 134/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  +I++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 52  IMTALSFIPAFVILMTSFTRIIIVFSILRQALGLQQTPSNQLLTGMALFLTMFIMAPVFD 111

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  Q+T   AI +   P   FM   TR+ DL LFM ++    + TDI   
Sbjct: 112 RVNQDALQPYLKEQMTAQQAIDKAQGPLKDFMLAQTRQSDLDLFMRLS----KRTDIAGP 167

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   IL+P+F+ SEL+ +F+IGF+I +PFLIIDM+VA+++MAMGMMML P  ISLPFK
Sbjct: 168 DQVPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDMVVASVLMAMGMMMLSPLIISLPFK 227

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 228 IMLFVLVDGWALIMGTLASSF 248


>gi|283785718|ref|YP_003365583.1| flagellar biosynthetic protein FliP [Citrobacter rodentium ICC168]
 gi|282949172|emb|CBG88780.1| flagellar biosynthetic protein FliP [Citrobacter rodentium ICC168]
          Length = 245

 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 149/229 (65%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  ++  P      +W   V+T    T L+  P +L+M+T F R IIVF +LR  +
Sbjct: 19  ALAQLPGLVAQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRIIIVFGLLRNAL 78

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A+ + A+P   FM
Sbjct: 79  GTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVEAYQPFSEEKISMQEALDKGAQPLREFM 138

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+LF  +A+S      +   + +  RIL+P+++ SEL+ +F+IGF I +PFL
Sbjct: 139 LRQTREADLALFARLANSG----PLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFL 194

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 195 IIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|149377875|ref|ZP_01895604.1| flagellar biosynthesis protein P [Marinobacter algicola DG893]
 gi|149357817|gb|EDM46310.1| flagellar biosynthesis protein P [Marinobacter algicola DG893]
          Length = 254

 Score =  191 bits (485), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 154/240 (64%), Gaps = 20/240 (8%)

Query: 18  FAKSSLHDVMNIPA------------DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRF 65
           +A ++L D+  IPA            + S+S   ++   + T L+  P +L+M+T F R 
Sbjct: 21  WAPAALADIPGIPAFTVTPGEEEGVQEYSVS---LQILALMTALTFLPAMLMMMTSFTRI 77

Query: 66  IIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAI 125
           I+VF+ILR  +G+ S P N +++ L LF+T ++M P L+   E+ +QP M  +++   A+
Sbjct: 78  IVVFAILRQALGLQSTPSNQILLGLTLFLTIFIMKPVLEEVNEVALQPYMQEELSSLEAV 137

Query: 126 QRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSF 185
           ++ ++PF  FM   TRE DL LFM +A   +   +      + + +L+P+F+ SEL+ +F
Sbjct: 138 EQASQPFRKFMLAQTRESDLGLFMRIADEQYDTAE-----DVSFWVLLPAFVTSELKTAF 192

Query: 186 EIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +IGF++ +PFLIIDM+VA+++MAMGMMML P  ISLPFK++ FVL+DGW+L++  L  S+
Sbjct: 193 QIGFILFIPFLIIDMVVASVLMAMGMMMLSPIIISLPFKIMLFVLVDGWALIMGTLAASY 252


>gi|251789178|ref|YP_003003899.1| flagellar biosynthetic protein FliP [Dickeya zeae Ech1591]
 gi|247537799|gb|ACT06420.1| flagellar biosynthetic protein FliP [Dickeya zeae Ech1591]
          Length = 258

 Score =  191 bits (485), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 97/239 (40%), Positives = 155/239 (64%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L L+ P    A + L  +++ P      +W   ++T    T LS  P +L+M+TCF R I
Sbjct: 25  LLLIAPH---ALAQLPGIISQPLANGGQSWSLPIQTLVFITALSFIPAVLLMMTCFTRII 81

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IV S+LR  +G  + PPN V++ L+LF+TF+VMSP L+R  +   +P   ++I+   AI 
Sbjct: 82  IVLSLLRNALGTPTAPPNQVLLGLSLFLTFFVMSPVLNRIYDEAYRPFSEDKISMEVAID 141

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + ++P   FM   TRE DL+LF  +A        +   + +  R+L+P+++ SEL+ +F+
Sbjct: 142 KGSQPLREFMLRQTREADLALFTRLAQIP----SLQGPEAVPMRVLVPAYVTSELKTAFQ 197

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFL+ID++VA+++MA+GMMM+PP +I+LPFK++ FVL+DGW LL+ +L +SF
Sbjct: 198 IGFTIFIPFLLIDLVVASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLLGSLAQSF 256


>gi|291519582|emb|CBK74803.1| flagellar biosynthetic protein FliP [Butyrivibrio fibrisolvens
           16/4]
          Length = 284

 Score =  191 bits (485), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 92/201 (45%), Positives = 138/201 (68%), Gaps = 5/201 (2%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TIL+++P +LIM+T F R +IV   +R  +G  + PPN V+I LALF+T ++MSP L 
Sbjct: 88  VLTILTLSPSILIMLTSFTRCVIVLHFVRAAIGTNTAPPNQVLIGLALFLTLFIMSPVLT 147

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
                 I P    +IT+  AI     P   FM   T+ KDL+LF D+A  ++      + 
Sbjct: 148 TIKTEAIDPFDAGEITQQEAIDAAIAPVREFMYGQTQTKDLNLFCDIAGITYE-----EY 202

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D + + +++P+F++SELR +F IGFLI +PF++IDM+VA+++M+MGMMMLPPT+ISLPFK
Sbjct: 203 DEVPFTVVVPAFILSELRTAFIIGFLIYVPFIVIDMVVASVLMSMGMMMLPPTTISLPFK 262

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L++  LVK+F
Sbjct: 263 ILLFVLVDGWDLVIGGLVKTF 283


>gi|329298603|ref|ZP_08255939.1| flagellar biosynthesis protein FliP [Plautia stali symbiont]
          Length = 341

 Score =  191 bits (485), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 141/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L+  P +L+M+T F R IIVF +LR  +G  S PPN V++ LALF+ F++M
Sbjct: 138 VQTLVFITSLTFIPAVLLMITSFTRIIIVFGLLRNALGTPSAPPNQVMLGLALFLNFFIM 197

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT D+       P   ++I+   AI + A+P   FM   TRE DL+LF  +A+S+    
Sbjct: 198 APTFDKIYTDAYLPFSQDKISMDVAIDKGAQPLREFMLRQTRETDLALFARLANSA---- 253

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            I   + +  RIL+P+++ SEL+ +F+IGF + +PFLIID++VA+++MA+GMMM+PP +I
Sbjct: 254 PIQGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFLIIDLVVASVLMALGMMMVPPATI 313

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LLV +L +SF
Sbjct: 314 SLPFKLMLFVLVDGWQLLVGSLAQSF 339


>gi|312879603|ref|ZP_07739403.1| flagellar biosynthetic protein FliP [Aminomonas paucivorans DSM
           12260]
 gi|310782894|gb|EFQ23292.1| flagellar biosynthetic protein FliP [Aminomonas paucivorans DSM
           12260]
          Length = 258

 Score =  191 bits (485), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 146/216 (67%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D++++  IV    + T+LS+AP +++M+T F R ++V   +R  MG+  +PPN V+++
Sbjct: 49  PQDVALTLQIV---ALMTVLSMAPAIILMLTSFTRILVVLGFIRNAMGLQQMPPNQVLVT 105

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+TF+ M+P  D+    G+ P MN QI    A  R  +P   FM   TREK+LSL +
Sbjct: 106 LALFLTFFTMTPVWDQIYGKGLVPYMNGQIPAAQAWDRSIKPLRAFMFRQTREKELSLMV 165

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            +A            D I  R+L+P+FM+SEL+ +F++G ++ +PF++IDMIV++++M+M
Sbjct: 166 RLAKMPQPKN----QDGIPTRVLMPAFMLSELKTAFQMGVVLFIPFIVIDMIVSSVLMSM 221

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GM+MLPP  ISLPFKV+ FV+ DGW+L++ +LV SF
Sbjct: 222 GMIMLPPMMISLPFKVLLFVMADGWNLVIASLVTSF 257


>gi|218133679|ref|ZP_03462483.1| hypothetical protein BACPEC_01548 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991054|gb|EEC57060.1| hypothetical protein BACPEC_01548 [Bacteroides pectinophilus ATCC
           43243]
          Length = 278

 Score =  191 bits (485), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 147/215 (68%), Gaps = 2/215 (0%)

Query: 31  ADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISL 90
            D S    +++   + TI+S+AP +L+++T F R +IV    R  +G+ ++PPN V+I L
Sbjct: 65  GDGSDMASVLQMLLVLTIISLAPSILMLLTSFTRIVIVLHFTRAALGVQTIPPNQVLIGL 124

Query: 91  ALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMD 150
           ++F+TF+VMSPT  +  +  I+PL NN+IT   A     +P   FM      KDL  F++
Sbjct: 125 SIFLTFFVMSPTFTQVYDSAIKPLSNNEITTEQAFDAGIKPMRAFMLKQVSTKDLDTFLN 184

Query: 151 MAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMG 210
           +A +   +  I   D I   +LIP+F+ISELR +F IGFLI +PF++IDM+V++++M+MG
Sbjct: 185 IAGTEAGS--IENEDDIPLNVLIPAFIISELRIAFIIGFLIYIPFIVIDMVVSSVLMSMG 242

Query: 211 MMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MMMLPPT+IS+PFK++ FV+ DGW+L++ NL+++F
Sbjct: 243 MMMLPPTTISMPFKILLFVMADGWNLVIGNLMQTF 277


>gi|260438790|ref|ZP_05792606.1| flagellar biosynthetic protein FliP [Butyrivibrio crossotus DSM
           2876]
 gi|292808779|gb|EFF67984.1| flagellar biosynthetic protein FliP [Butyrivibrio crossotus DSM
           2876]
          Length = 272

 Score =  191 bits (485), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 140/201 (69%), Gaps = 2/201 (0%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T++++AP +LIM+T F R IIV    R+ +G  + PPN V++ LALF+TF++M+PT  
Sbjct: 73  VLTVIALAPSILIMLTSFTRIIIVLHFTRSAIGTQTAPPNQVLVGLALFLTFFIMAPTFK 132

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
              +  I+PL  N+IT   A     +P   FM   T  KD+ +F+D+A      + +   
Sbjct: 133 TVYDDAIKPLSKNEITSEEAYDVGIKPIRQFMLEQTNTKDIRMFIDIAKVD--TSTLKDY 190

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D I  ++LIPSF++SELR +F IGFLI +PF+IIDM+V++ +M+MGMMMLPPT+ISLPFK
Sbjct: 191 DDIPIQVLIPSFIVSELRIAFIIGFLIYIPFIIIDMVVSSALMSMGMMMLPPTTISLPFK 250

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ F++ DGW+L++ NLVK+F
Sbjct: 251 ILLFIMADGWNLVIGNLVKTF 271


>gi|206603142|gb|EDZ39622.1| Flagellar biosynthesis protein FliP [Leptospirillum sp. Group II
           '5-way CG']
          Length = 265

 Score =  191 bits (485), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 134/193 (69%), Gaps = 3/193 (1%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +L+M+T F R ++V S LR  MG   VPPN V++ L+LF+TF+VM+P      E  I 
Sbjct: 75  PAILVMMTSFTRIVVVLSFLRQAMGTAQVPPNQVLVGLSLFLTFFVMAPVWKTMDETAIT 134

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P ++ +I    A+ R  +P   FM    R+KD++LF+ +AH     +     D I   +L
Sbjct: 135 PYLDKKIAPDVAVDRAMKPVRAFMFRQVRQKDIALFVRIAHLPRTPS---SPDDIPTYVL 191

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           IP+F++SEL  +FE+GFLI LPFLI+DM+V++++M+MGMMMLPPT +SLPFK++ FVL+D
Sbjct: 192 IPAFVVSELSTAFEMGFLIYLPFLILDMVVSSVLMSMGMMMLPPTVVSLPFKILLFVLVD 251

Query: 233 GWSLLVENLVKSF 245
           GWSL+V +LV+SF
Sbjct: 252 GWSLVVGSLVRSF 264


>gi|56964019|ref|YP_175750.1| flagellar biosynthesis protein FliP [Bacillus clausii KSM-K16]
 gi|56910262|dbj|BAD64789.1| flagellar biosynthetic protein FliP [Bacillus clausii KSM-K16]
          Length = 227

 Score =  191 bits (484), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 96/201 (47%), Positives = 136/201 (67%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+L+IAP +LIM+TCF R IIV + +R G+   S PPN V+I LALF+T ++M+P + 
Sbjct: 30  LLTVLTIAPGILIMMTCFTRIIIVLAFVRQGLATQSTPPNQVLIGLALFITAFIMAPVIQ 89

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
              E    PL + + +   A +    P   FM  +TREKDL+LFM       R   I   
Sbjct: 90  EVYETAYVPLADGEYSSEEAFEAAVVPIKEFMSAHTREKDLALFMGYG-GYDRPASI--- 145

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +    L+P+F ISEL+ +F+IGFLI +PFL+IDMIVA+++M+MGMMMLPP  I+LPFK
Sbjct: 146 DDVPLTALVPAFAISELKTAFQIGFLIFIPFLVIDMIVASVLMSMGMMMLPPVMIALPFK 205

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           V+ FVL+DGW L+V++L+ S+
Sbjct: 206 VLLFVLVDGWYLVVQSLLISY 226


>gi|259908768|ref|YP_002649124.1| flagellar biosynthesis protein FliP [Erwinia pyrifoliae Ep1/96]
 gi|224964390|emb|CAX55899.1| Flagellar biosynthesis protein [Erwinia pyrifoliae Ep1/96]
 gi|283478744|emb|CAY74660.1| Flagellar biosynthetic protein FliP precursor [Erwinia pyrifoliae
           DSM 12163]
 gi|310767334|gb|ADP12284.1| flagellar biosynthesis protein FliP [Erwinia sp. Ejp617]
          Length = 245

 Score =  191 bits (484), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 95/227 (41%), Positives = 148/227 (65%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  +++ P      +W   V+T    T L+  P +L+M+T F R IIVF +LR  +G 
Sbjct: 21  AQLPGLVSQPTANGGQSWSLPVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGT 80

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ L+LF+TF++M P  D+      QP   ++I+   AI + A+P   FM  
Sbjct: 81  PSAPPNQVLLGLSLFLTFFIMGPVFDKMYTDAYQPFSEDKISMQEAIDKGAQPLREFMLR 140

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+LF  +A++      I   + +  RIL+P+++ SEL+ +F+IGF + +PFLII
Sbjct: 141 QTREADLALFARLANTPP----IAGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFLII 196

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D++VA+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 197 DLVVASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVSSLAQSF 243


>gi|332981449|ref|YP_004462890.1| flagellar biosynthetic protein FliP [Mahella australiensis 50-1
           BON]
 gi|332699127|gb|AEE96068.1| flagellar biosynthetic protein FliP [Mahella australiensis 50-1
           BON]
          Length = 257

 Score =  191 bits (484), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 94/196 (47%), Positives = 139/196 (70%), Gaps = 8/196 (4%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIM+T F R I+V S +R+ +G+  +PPN VII LALF+TF+ M+P   +  +  +
Sbjct: 67  APAILIMLTSFTRIIVVLSFVRSALGLQQMPPNQVIIGLALFLTFFTMAPVATQINQTAL 126

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMA--HSSHRNTDITKNDHIEY 169
           QP MN QI +  AI     P   FM   TREKDL+LF++++      + +DI+       
Sbjct: 127 QPYMNGQIEQQQAIDNAMVPLREFMFKETREKDLNLFVNLSGMDKPEQLSDISST----- 181

Query: 170 RILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFV 229
            +LIP+F+ISEL+ +F+IGFLI +PF++IDM+VAT +M+MGMMM+PP  ISLPFKV+ F+
Sbjct: 182 -VLIPAFIISELKTAFQIGFLIYVPFIVIDMVVATTLMSMGMMMIPPVMISLPFKVLLFI 240

Query: 230 LIDGWSLLVENLVKSF 245
           ++DGW+L+V++L+ SF
Sbjct: 241 MVDGWNLVVQSLITSF 256


>gi|317492418|ref|ZP_07950847.1| flagellar biosynthetic protein FliP [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919757|gb|EFV41087.1| flagellar biosynthetic protein FliP [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 248

 Score =  191 bits (484), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 140/206 (67%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L+  P  L+M+T F R IIV  +LR+ +G  S PPN V++ LALF+TF+VM
Sbjct: 45  VQTLVFLTSLTFLPAALLMMTSFTRIIIVLGLLRSALGTPSAPPNQVMLGLALFLTFFVM 104

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP  D+  +   QP   ++IT   A+ R A+P   FM   TRE DL+L+  +A+      
Sbjct: 105 SPVFDKIYQDAYQPFSQDKITMDVAMDRGAQPLREFMLRQTRETDLALYAKLANLPQ--- 161

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +  RIL+P+++ SEL+ +F+IGF I +PFLIID++VA+++MA+GMMM+PP +I
Sbjct: 162 -MAGPEDVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVVASVLMALGMMMVPPATI 220

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 221 SLPFKLMLFVLVDGWQLLLGSLAQSF 246


>gi|152986552|ref|YP_001349235.1| flagellar biosynthesis protein FliP [Pseudomonas aeruginosa PA7]
 gi|150961710|gb|ABR83735.1| flagellar biosynthetic protein FliP [Pseudomonas aeruginosa PA7]
          Length = 255

 Score =  191 bits (484), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 135/201 (67%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+ S P N V++ LALF+T +VM+P  D
Sbjct: 56  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQSTPSNQVLVGLALFLTMFVMAPVFD 115

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R     +QP +N QI    A+QR   P   FM   TR  DL LF+ ++    + TDI+  
Sbjct: 116 RINSQALQPYLNEQIPAQEALQRAEVPLKAFMLAQTRTSDLELFVRLS----KRTDISGP 171

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           +     IL+P+F+ SEL+ +F+IGF+I +PFLIID++V++++MAMGMMML P  ISLPFK
Sbjct: 172 EATPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDLVVSSVLMAMGMMMLSPLIISLPFK 231

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 232 IMLFVLVDGWALIIGTLAGSF 252


>gi|300994267|ref|ZP_07180819.1| flagellar biosynthetic protein FliP [Escherichia coli MS 200-1]
 gi|300304932|gb|EFJ59452.1| flagellar biosynthetic protein FliP [Escherichia coli MS 200-1]
          Length = 245

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 156/239 (65%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L+L+TP L FA+  L  + + P      +W   V+T    T L+    +L+M+T F R I
Sbjct: 12  LWLITP-LAFAQ--LPGITSQPLPGGGQSWSLPVQTLVFITSLTFIQAILLMMTSFTRII 68

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    +I+   A++
Sbjct: 69  IVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALE 128

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + A+P   FM   TRE DL LF  +A++      +   + +  RIL+P+++ SEL+ +F+
Sbjct: 129 KGAQPLREFMLRQTREADLGLFARLANTG----PLQGPEAVPMRILLPAYVTSELKTAFQ 184

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 185 IGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|290475714|ref|YP_003468603.1| flagellar biosynthesis protein [Xenorhabdus bovienii SS-2004]
 gi|289175036|emb|CBJ81839.1| flagellar biosynthesis [Xenorhabdus bovienii SS-2004]
          Length = 269

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/229 (41%), Positives = 146/229 (63%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A ++L  +++ P      +W   V+T    T L   P  L+M+T F R IIV  +LR  +
Sbjct: 43  AAAALPGIISQPMANGGQSWSLPVQTLVFITALGFIPAALLMMTSFTRIIIVLGLLRNAL 102

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN ++I LALFMTF++MSP  D+  +    P   ++I+   A+ + A+P   FM
Sbjct: 103 GTPSAPPNQIMIGLALFMTFFIMSPVFDKVYQDAYLPFSEDKISLEAALDKGAQPLRQFM 162

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TR+ DL+LF  +A      T     D +  R+L+P+F+ SEL+ +F+IGF + +PFL
Sbjct: 163 LRQTRQTDLALFARLADQDAFET----ADSVPIRVLVPAFITSELKTAFQIGFTLFIPFL 218

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 219 IIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSF 267


>gi|296103629|ref|YP_003613775.1| Flagellar biosynthetic protein FliP [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058088|gb|ADF62826.1| Flagellar biosynthetic protein FliP [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 243

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 140/206 (67%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + +  +  P +L+M+T F R IIV  ++R  +G  + PPN V++ L+LF+TF+VM
Sbjct: 40  VQTLLLLSGFTFIPAILLMMTGFTRIIIVLGLMRNALGTPTAPPNQVLVGLSLFLTFFVM 99

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP   +  E   QPL  N+IT   A+    +P   FM + TRE DL++F  +A    +  
Sbjct: 100 SPVFSQIYEKAWQPLQENKITMEVALTEGVKPLRAFMLDQTRESDLAMFARIA----KTP 155

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           DI   + +   IL+P+F+ SEL+ +F+IGF I +PFLIID++VA+I+MA+GMMM+PPT+I
Sbjct: 156 DIASPEEVPLSILVPAFITSELKTAFQIGFTIFIPFLIIDLVVASILMALGMMMVPPTTI 215

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL+DGW LLV +L +SF
Sbjct: 216 ALPFKLMLFVLVDGWQLLVGSLAQSF 241


>gi|89098628|ref|ZP_01171510.1| flagellar biosynthesis protein P [Bacillus sp. NRRL B-14911]
 gi|89086590|gb|EAR65709.1| flagellar biosynthesis protein P [Bacillus sp. NRRL B-14911]
          Length = 221

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 140/194 (72%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LI++TCF R IIV S +RT +    +PPN V++ L+LF+TF++M+PT     E  +
Sbjct: 32  APSILILMTCFTRIIIVLSFVRTALATQQMPPNQVLVGLSLFLTFFIMAPTFQEVNEQAL 91

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
            PL N++I    A ++ + PF  FM  +TR+KDL+LF++  +S     +  ++  I    
Sbjct: 92  TPLFNDEINLEQAYEKASVPFKDFMSAHTRQKDLALFLE--YSGAETPESIQD--IPLTA 147

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F ISE++ +F+IGF+I +PFL+IDMIVA+++M+MGMMMLPP  ISLPFK++ FVL+
Sbjct: 148 LVPAFAISEIKTAFQIGFMIFIPFLVIDMIVASVLMSMGMMMLPPVMISLPFKILLFVLV 207

Query: 232 DGWSLLVENLVKSF 245
           DGW L+V++L++SF
Sbjct: 208 DGWYLVVKSLLQSF 221


>gi|167579277|ref|ZP_02372151.1| flagellar biosynthesis protein FliP [Burkholderia thailandensis
           TXDOH]
 gi|167617383|ref|ZP_02386014.1| flagellar biosynthesis protein FliP [Burkholderia thailandensis
           Bt4]
          Length = 253

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 138/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  S PPN V++ LALF+T +VM
Sbjct: 51  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQAIGTASTPPNQVLVGLALFLTLFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD++     +P     +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDKAYTDAYKPFSEGTLQMDQAVQRGTAPFKTFMLKQTRETDLALFAKISKAAP--- 167

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P ++
Sbjct: 168 -MQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|259907616|ref|YP_002647972.1| Flagellar biosynthetic protein FliP [Erwinia pyrifoliae Ep1/96]
 gi|224963238|emb|CAX54722.1| Flagellar biosynthetic protein FliP [Erwinia pyrifoliae Ep1/96]
 gi|283477458|emb|CAY73374.1| Flagellar biosynthetic protein FliP precursor [Erwinia pyrifoliae
           DSM 12163]
          Length = 247

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + + L+  P +L+M+T F R IIV  ++R  +G  + PPN V++ LALF+TFYVM
Sbjct: 44  VQTLVLLSSLTFLPAVLLMMTGFTRIIIVLGLMRNALGTPTAPPNQVLVGLALFLTFYVM 103

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP  ++  +   QPL  ++IT   A+++  +P   FM + TRE DL++F  +A +     
Sbjct: 104 SPVFNQIYQQAWQPLQEDKITMEVALEQGVKPLRAFMLDQTRENDLAMFAQIAKAG---- 159

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           +    + +   IL+P+F+ SEL+ +F+IGF I +PFLIID++VA+I+MA+GMMM+PP +I
Sbjct: 160 EFKGPEEVPLGILVPAFVTSELKTAFQIGFTIFIPFLIIDLVVASILMALGMMMVPPATI 219

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL+DGW LL+ +L +SF
Sbjct: 220 ALPFKLMLFVLVDGWQLLMGSLAQSF 245


>gi|167560941|ref|ZP_02353857.1| flagellar biosynthesis protein FliP [Burkholderia oklahomensis
           EO147]
 gi|167568200|ref|ZP_02361074.1| flagellar biosynthesis protein FliP [Burkholderia oklahomensis
           C6786]
          Length = 253

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 138/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  S PPN V++ LALF+T +VM
Sbjct: 51  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQALGTASTPPNQVLVGLALFLTLFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD++     +P     +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDKAYADAYKPFSEGTLQMDQAVQRGTAPFKGFMLKQTRETDLALFAKISKAAP--- 167

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P ++
Sbjct: 168 -MQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|104782808|ref|YP_609306.1| flagellar biosynthesis protein FliP [Pseudomonas entomophila L48]
 gi|95111795|emb|CAK16519.1| flagellar biosynthetic protein FliP [Pseudomonas entomophila L48]
          Length = 251

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 134/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  +I++T F R IIVFSILR  +G+   P N V+  +ALF+T ++M+P  +
Sbjct: 52  IMTALSFIPAFVILMTSFTRIIIVFSILRQALGLQQTPSNQVLTGMALFLTMFIMAPVFE 111

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  IQP +  Q+T   AI +   P   FM   TR+ DL LFM ++    + TDI   
Sbjct: 112 RVNKDAIQPYLAEQMTAQQAIDKAQGPLKDFMLAQTRQSDLDLFMRLS----KRTDIAGP 167

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   IL+P+F+ SEL+ +F+IGF+I +PFLIIDM+VA+++MAMGMMML P  ISLPFK
Sbjct: 168 DQVPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDMVVASVLMAMGMMMLSPLIISLPFK 227

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 228 IMLFVLVDGWALIMGTLAGSF 248


>gi|299066546|emb|CBJ37736.1| Flagellar biosynthetic protein FliP [Ralstonia solanacearum CMR15]
          Length = 227

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/200 (46%), Positives = 138/200 (69%), Gaps = 4/200 (2%)

Query: 46  FTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDR 105
            T+L++ P LL+ VT F R IIV S+LR G+GM   PPN  +I LALF+T + MSPTL++
Sbjct: 31  LTVLAVLPALLVSVTSFLRIIIVLSMLRHGLGMQETPPNTALIGLALFLTLFTMSPTLEQ 90

Query: 106 SIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKND 165
                 QP M   I+   A ++ + P   FM   TRE+DL+L ++++ +    +     D
Sbjct: 91  INRQAFQPFMAGTISMEQAYEKGSAPLRDFMVRQTREQDLALMVELSKAKTPQS----MD 146

Query: 166 HIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKV 225
            I    LIP++M+SELR +F+IGF++ LPFL+ID++V++I+MA+GMMM+PP+++SLP KV
Sbjct: 147 DISNVQLIPAYMLSELRTAFQIGFVVFLPFLLIDLVVSSILMALGMMMMPPSTVSLPLKV 206

Query: 226 IFFVLIDGWSLLVENLVKSF 245
           + FVL+DGW LL++ LV SF
Sbjct: 207 LMFVLMDGWGLLLKALVGSF 226


>gi|83594162|ref|YP_427914.1| flagellar biosynthesis protein FliP [Rhodospirillum rubrum ATCC
           11170]
 gi|83577076|gb|ABC23627.1| Flagellar transport protein FliP [Rhodospirillum rubrum ATCC 11170]
          Length = 264

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 155/212 (73%), Gaps = 5/212 (2%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S +  I++  G+ T+LS+AP LLIMVT F R ++V SILR  +   S PPN+V++SLALF
Sbjct: 55  STTARIIQLVGLLTVLSVAPGLLIMVTSFTRIVVVLSILRQALATQSTPPNMVMVSLALF 114

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           MTF++M+PT  ++ + G+ PL+  QI+E  A  R   PF  FM  + R+KDL LFM    
Sbjct: 115 MTFFIMAPTFQQAWDQGLSPLIQEQISEEEAFTRTVAPFRTFMLAHVRDKDLELFM---- 170

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
           S ++ T    +D +  + LIP+FMISELRR+FEIGFLI LPF++IDM++A+++M+MGMMM
Sbjct: 171 SFNKETAAQPSD-VSTQALIPAFMISELRRAFEIGFLIFLPFVVIDMVIASVLMSMGMMM 229

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPP  +++PFK+IFFVL+DGW L++ +L+ S+
Sbjct: 230 LPPMMLAMPFKLIFFVLVDGWYLVIGSLLSSY 261


>gi|260432140|ref|ZP_05786111.1| flagellar biosynthetic protein FliP [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415968|gb|EEX09227.1| flagellar biosynthetic protein FliP [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 243

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/212 (44%), Positives = 140/212 (66%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           SIS   ++   + T+LS+AP L IM+TCFP  + V +ILR G+G+   PPN++I+SLALF
Sbjct: 34  SISARTIQLILLITVLSLAPGLAIMITCFPFLVTVLAILRQGIGLQQSPPNMLIVSLALF 93

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T++VM P   ++ E GI+P++   +    A++R   PF  FM       D   F  MA 
Sbjct: 94  LTYFVMEPVFTQAWETGIRPMVEETMEVEPALERALVPFREFMAARL---DAETFQAMAA 150

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                  +  +      +L+PSFM+SE+ R+F+IGFLI LPFLIID++VA ++M+MGMMM
Sbjct: 151 LRPDGEAMELSPQAPLSVLMPSFMLSEIARAFQIGFLIFLPFLIIDLVVAAVLMSMGMMM 210

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +PP ++SLPFK+ FFV+ DGWSL+   LV+S+
Sbjct: 211 VPPATVSLPFKLAFFVIADGWSLIAGALVRSY 242


>gi|330814980|ref|YP_004358685.1| Flagellar biosynthetic protein FliP [Burkholderia gladioli BSR3]
 gi|327367373|gb|AEA58729.1| Flagellar biosynthetic protein FliP [Burkholderia gladioli BSR3]
          Length = 279

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 139/206 (67%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +++M+T F R IIV S+LR  +G  + PPN V++ LALF+T +VM
Sbjct: 77  VQTMLLLTMLSFLPAIVLMMTSFTRIIIVLSLLRQALGTTTTPPNQVLVGLALFLTLFVM 136

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+   G QP     +    A+QR   PF  FM   TRE DL+LF  ++ +     
Sbjct: 137 SPVLDRAYTDGYQPFSAGTLPMDQAVQRGLAPFKTFMLKQTRESDLALFARISKAP---- 192

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIID++VA+++M+MGMMM+ PT+I
Sbjct: 193 PMQGPEDVPLPLLVPAFLTSELKTGFQIGFTIFIPFLIIDLVVASVLMSMGMMMVSPTTI 252

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 253 SLPFKLMLFVLVDGWQLLIGSLAQSF 278


>gi|163794138|ref|ZP_02188111.1| Flagellar biosynthesis pathway [alpha proteobacterium BAL199]
 gi|159180752|gb|EDP65271.1| Flagellar biosynthesis pathway [alpha proteobacterium BAL199]
          Length = 253

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/194 (53%), Positives = 140/194 (72%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +L+MVT F R +IV  +LRT +G    PPNLV+ISLALF+T ++M+PTL  +   G+
Sbjct: 59  APGILVMVTSFTRIVIVLGLLRTALGTQQSPPNLVMISLALFLTGFIMTPTLKEAWTNGV 118

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QPL+  +I E  A   V +PF  FM    REKDL LF DMA      T +    +   ++
Sbjct: 119 QPLIEERIDEIEAFDAVVQPFRGFMLRTVREKDLRLFEDMAQVGPAETGL----NAPLQV 174

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           LIP+FMISELRR+FEIGFL+ LPF+IIDM++A+++M+MGMMM+PP  ISLPFK+IFFVL+
Sbjct: 175 LIPAFMISELRRAFEIGFLLYLPFVIIDMVIASVLMSMGMMMVPPVMISLPFKLIFFVLV 234

Query: 232 DGWSLLVENLVKSF 245
           DGW ++  +LV+SF
Sbjct: 235 DGWYMIAGSLVRSF 248


>gi|260893864|ref|YP_003239961.1| flagellar biosynthetic protein FliP [Ammonifex degensii KC4]
 gi|260866005|gb|ACX53111.1| flagellar biosynthetic protein FliP [Ammonifex degensii KC4]
          Length = 223

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 135/193 (69%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +LI++T F R +IV S+LR+ +G    PPN V++ LALF+T ++M+P  +R  +  I+
Sbjct: 34  PAILILMTSFTRIVIVLSLLRSALGTHQAPPNQVLVGLALFLTVFIMAPVYERINQEAIR 93

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P + NQIT   A  R   P   FM    REKDL+LF+++AH           + +  R++
Sbjct: 94  PYLANQITRQEAQVRGLRPLKEFMLRQVREKDLALFVNLAHLPQP----VNKEELPLRVI 149

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           IP+F+ISEL+ +F +GFL+ LPFL+IDM+VA+++M+MGM MLPP  ISLPFK++ FVL+D
Sbjct: 150 IPAFLISELKTAFAMGFLLYLPFLVIDMVVASVLMSMGMFMLPPVMISLPFKLLLFVLVD 209

Query: 233 GWSLLVENLVKSF 245
           GW L+V++LV+SF
Sbjct: 210 GWYLVVKSLVESF 222


>gi|262166224|ref|ZP_06033961.1| flagellar biosynthesis protein FliP [Vibrio mimicus VM223]
 gi|262025940|gb|EEY44608.1| flagellar biosynthesis protein FliP [Vibrio mimicus VM223]
          Length = 299

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 141/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 92  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 148

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF++M+P  ++  E  +QP +N QI+   A     EP   FM   TR KDL  F++M
Sbjct: 149 LFLTFFIMAPVFNQINEQAVQPYLNEQISARQAFDLAQEPMKAFMLKQTRVKDLETFVEM 208

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + S      +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 209 SGS-----QVTAPEQVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 263

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 264 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 297


>gi|296133033|ref|YP_003640280.1| flagellar biosynthetic protein FliP [Thermincola sp. JR]
 gi|296031611|gb|ADG82379.1| flagellar biosynthetic protein FliP [Thermincola potens JR]
          Length = 262

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/199 (45%), Positives = 142/199 (71%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           TILS+AP +LIM T F R ++V S +R+ +   + PPN VII LALF+TF++M+PT  + 
Sbjct: 67  TILSLAPAILIMTTAFTRVVVVLSFVRSALSTHTTPPNQVIIGLALFLTFFIMAPTWSQV 126

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            +  +QP ++ ++++  A+++   P   FM   TREKDL+LF+ MA+     T    +  
Sbjct: 127 NKDALQPYLSGKLSQEQALKKAVTPVRDFMFKQTREKDLALFVKMANIKRPRT----HAD 182

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           +   +LIP+F ISEL+ +F+IGF+I +PF++IDM++A+ +M+MGM+MLPP  ISLPFK++
Sbjct: 183 VPTYVLIPAFTISELKTAFQIGFMIYIPFIVIDMVIASSLMSMGMIMLPPMMISLPFKLL 242

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW+L+V +L+ SF
Sbjct: 243 LFVLVDGWNLIVRSLIMSF 261


>gi|33601555|ref|NP_889115.1| flagellar biosynthesis protein FliP [Bordetella bronchiseptica
           RB50]
 gi|33575991|emb|CAE33071.1| flagellar biosynthetic protein FliP [Bordetella bronchiseptica
           RB50]
          Length = 263

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 146/234 (62%), Gaps = 6/234 (2%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIMVTCFPRFIIVFSI 71
           P    A+++L  +   P      T+ +  +T  + T LS  P  L+M+T F R IIV  +
Sbjct: 32  PSGALAQATLPALTATPGPNGSETYSLSMQTLLLMTSLSFLPAALLMMTGFTRIIIVLGL 91

Query: 72  LRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEP 131
           LR+ MG    PPN V+I LALF+TFY MSP  D+      QPL    I   TA++R   P
Sbjct: 92  LRSAMGTAMSPPNHVLIGLALFLTFYTMSPVFDKIYTDAYQPLAAGSIPFETAVERAGSP 151

Query: 132 FWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLI 191
              FM + TRE DL+LF ++A+       +     +  RILIP+F+ SEL+ +F+IGF I
Sbjct: 152 LHNFMLHQTRENDLTLFANLANLP----AMEDPSQVPMRILIPAFITSELKTAFQIGFTI 207

Query: 192 ILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
            +PFLIID++VA+++MA+GMMM+PP +++LPFK++ FVL DGW LL+ +L +SF
Sbjct: 208 FIPFLIIDLVVASVLMALGMMMVPPVTVALPFKLMLFVLADGWHLLLGSLAQSF 261


>gi|188534130|ref|YP_001907927.1| flagellar biosynthesis protein FliP [Erwinia tasmaniensis Et1/99]
 gi|188029172|emb|CAO97044.1| Flagellar biosynthesis protein [Erwinia tasmaniensis Et1/99]
          Length = 245

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 141/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L+  P +L+M+T F R IIVF +LR  +G  S PPN V++ L+LF+TF++M
Sbjct: 42  VQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLSLFLTFFIM 101

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            P  D+      QP   ++I+   AI + A+P   FM   TRE DL+LF  +A+++    
Sbjct: 102 GPVFDKIYTDAYQPFSEDKISMQEAIDKGAQPLREFMLRQTREADLALFARLANTAP--- 158

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            I   + +  RIL+P+++ SEL+ +F+IGF + +PFLIID++VA+++MA+GMMM+PP +I
Sbjct: 159 -IAGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFLIIDLVVASVLMALGMMMVPPATI 217

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL+DGW LLV +L +SF
Sbjct: 218 ALPFKLMLFVLVDGWQLLVGSLAQSF 243


>gi|260767696|ref|ZP_05876631.1| flagellar biosynthesis protein FliP [Vibrio furnissii CIP 102972]
 gi|260617205|gb|EEX42389.1| flagellar biosynthesis protein FliP [Vibrio furnissii CIP 102972]
 gi|315179472|gb|ADT86386.1| flagellar biosynthetic protein FliP [Vibrio furnissii NCTC 11218]
          Length = 299

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 139/206 (67%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T+L   P ++I++T F R ++V SILR  MG+   P N VI+ +A+F+TF++M
Sbjct: 97  LQILALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIVGIAIFLTFFIM 156

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP L++  +  IQP +N QI+   A  R  EP   FM   TR KDL  F+++A +  +N 
Sbjct: 157 SPVLNKINDQAIQPYLNEQISARQAFDRAQEPMKAFMLKQTRVKDLETFVNIAGAEVQNP 216

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           +      +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGMMML P  +
Sbjct: 217 E-----DVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGMMMLSPMIV 271

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 272 SLPFKLMLFVLVDGWNLILSTLAGSF 297


>gi|33596149|ref|NP_883792.1| flagellar biosynthesis protein FliP [Bordetella parapertussis
           12822]
 gi|33573152|emb|CAE36802.1| flagellar biosynthetic protein FliP [Bordetella parapertussis]
          Length = 266

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 146/234 (62%), Gaps = 6/234 (2%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIMVTCFPRFIIVFSI 71
           P    A+++L  +   P      T+ +  +T  + T LS  P  L+M+T F R IIV  +
Sbjct: 35  PSGALAQATLPALTATPGPNGSETYSLSMQTLLLMTSLSFLPAALLMMTGFTRIIIVLGL 94

Query: 72  LRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEP 131
           LR+ MG    PPN V+I LALF+TFY MSP  D+      QPL    I   TA++R   P
Sbjct: 95  LRSAMGTAMSPPNHVLIGLALFLTFYTMSPVFDKIYTDAYQPLAAGSIPFETAVERAGSP 154

Query: 132 FWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLI 191
              FM + TRE DL+LF ++A+       +     +  RILIP+F+ SEL+ +F+IGF I
Sbjct: 155 LHNFMLHQTRENDLTLFANLANLP----AMEDPSQVPMRILIPAFITSELKTAFQIGFTI 210

Query: 192 ILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
            +PFLIID++VA+++MA+GMMM+PP +++LPFK++ FVL DGW LL+ +L +SF
Sbjct: 211 FIPFLIIDLVVASVLMALGMMMVPPVTVALPFKLMLFVLADGWHLLLGSLAQSF 264


>gi|331269328|ref|YP_004395820.1| flagellar biosynthetic protein FliP [Clostridium botulinum
           BKT015925]
 gi|329125878|gb|AEB75823.1| flagellar biosynthetic protein FliP [Clostridium botulinum
           BKT015925]
          Length = 257

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 143/206 (69%), Gaps = 3/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T+LS+ P  L+M+T F R IIV   +R  +G    PPN ++I +ALF+T ++M
Sbjct: 53  IKLLVMLTVLSLLPSFLVMMTSFTRIIIVLGFMRNALGTQQAPPNQILIGIALFLTIFIM 112

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT     +  I+P + N+IT   A+   ++P   FM   TR+KDL LF+D++ +    T
Sbjct: 113 APTYKTINKEAIKPFLENKITGQQAMDNASKPMREFMLKQTRDKDLELFLDVSKTDK--T 170

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            ITK D++   ++IPSF+ISEL+ +F+IGFL+ +PFLIID++VA+++M+MGM MLPP  I
Sbjct: 171 KITK-DNVPMYVVIPSFIISELKTAFKIGFLLYIPFLIIDIVVASVLMSMGMFMLPPVMI 229

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FV++DGW LLV++L+  +
Sbjct: 230 SLPFKILLFVMVDGWYLLVKSLIMGY 255


>gi|301165896|emb|CBW25469.1| flagellar biosynthesis protein [Bacteriovorax marinus SJ]
          Length = 252

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 99/231 (42%), Positives = 152/231 (65%), Gaps = 7/231 (3%)

Query: 18  FAKSSLHDVMNIPADLSISTWIVRTFGI---FTILSIAPILLIMVTCFPRFIIVFSILRT 74
           FA+SS  ++  +  +    T +V T  +   FT+L++AP +LI+ TCF R I+V S +R 
Sbjct: 25  FAQSSGVNLPGMAINFGNGTNLVDTIQVLVLFTVLTMAPAILILCTCFTRIIVVLSFMRQ 84

Query: 75  GMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWV 134
            +G  S+PPN V+I  ALF++ +VM PT ++  +  I P +  +IT T A+ R+      
Sbjct: 85  AIGTQSMPPNQVLIGFALFLSIFVMQPTGEQIYKNAITPYVEKKITTTVALDRIEFSLRG 144

Query: 135 FMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILP 194
           FM    R+ D+ LF D+   + R    T ND +    LIP+F+ISEL+ +F+IGFL+ +P
Sbjct: 145 FMTKQVRKADIGLFYDV---TGRKAPNTIND-VPIHFLIPAFIISELKTAFQIGFLLYIP 200

Query: 195 FLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FLI+DM+VA+++MAMGMMMLPP  +SLPFK++ FVL+DGW L+  ++++SF
Sbjct: 201 FLILDMVVASVLMAMGMMMLPPVVVSLPFKLLLFVLVDGWQLVTGSILRSF 251


>gi|315498438|ref|YP_004087242.1| flagellar biosynthetic protein flip [Asticcacaulis excentricus CB
           48]
 gi|315416450|gb|ADU13091.1| flagellar biosynthetic protein FliP [Asticcacaulis excentricus CB
           48]
          Length = 268

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 145/212 (68%), Gaps = 4/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           +++  +V+  G+ T+LS+AP ++IM T F R ++V S+LRT +G+   PPN V+ISLA+F
Sbjct: 53  TLTARVVQMLGLLTVLSLAPSIVIMTTSFIRIVVVLSLLRTALGLQQSPPNAVLISLAMF 112

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           ++  VM+PT   + + GI+PLM+ ++    A    +EP   FM +     DL+LF+ ++ 
Sbjct: 113 LSAVVMAPTYQAAYDAGIRPLMDQEMEMPQAFDAASEPVKTFMLSQVDAGDLNLFIRLSK 172

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                     N  +   ++ P+FMISEL+ +F IGFL+ +PFL+ID++VA+++M+MGMMM
Sbjct: 173 VEKPK----DNMDLPITVITPAFMISELKTAFLIGFLLFIPFLVIDLVVASVLMSMGMMM 228

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LPP  +SLPFK+IFFVL+DGW L+  +LV+SF
Sbjct: 229 LPPVVVSLPFKLIFFVLVDGWRLVCGSLVESF 260


>gi|323490154|ref|ZP_08095374.1| flagellar biosynthesis protein FliP [Planococcus donghaensis
           MPA1U2]
 gi|323396202|gb|EGA89028.1| flagellar biosynthesis protein FliP [Planococcus donghaensis
           MPA1U2]
          Length = 229

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/197 (48%), Positives = 137/197 (69%), Gaps = 10/197 (5%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIM+T F R IIV S +RTG+G  S+PPN V++ LALF+TF++MSP +    +  +
Sbjct: 40  APGILIMMTSFTRIIIVLSFVRTGLGTQSMPPNQVLVGLALFLTFFIMSPIVVEMNDTAL 99

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEY-- 169
           QP ++ ++ +  A+     P   FM  NTREKDL+LF        +  ++ K D IE   
Sbjct: 100 QPYLDGEMEQQEALDTAVVPLKEFMAKNTREKDLALF-------FKYAELEKPDSIEEIP 152

Query: 170 -RILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFF 228
              L+P+F ISE++ +F+IGF+I +PFLIIDM+VA+ +MAMGMMMLPP  ISLPFK++ F
Sbjct: 153 LTSLVPAFAISEMKTAFQIGFVIFIPFLIIDMVVASTLMAMGMMMLPPVMISLPFKILLF 212

Query: 229 VLIDGWSLLVENLVKSF 245
           VL+DGW L++E+L+ SF
Sbjct: 213 VLVDGWYLIIESLLVSF 229


>gi|319649551|ref|ZP_08003707.1| flagellar biosynthesis protein P [Bacillus sp. 2_A_57_CT2]
 gi|317398713|gb|EFV79395.1| flagellar biosynthesis protein P [Bacillus sp. 2_A_57_CT2]
          Length = 221

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 139/194 (71%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LI++TCF R IIV S +RT +    +PPN V+I L+LF+TF++M+PT+    E  +
Sbjct: 32  APSILILMTCFTRIIIVLSFVRTALATQQMPPNQVLIGLSLFLTFFIMAPTMQEVNEQAL 91

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
            PL N +I    A ++ + PF  FM  +TR+KDL+LF+  + +   ++     + I    
Sbjct: 92  TPLFNEEINLEEAYEKASIPFKEFMSAHTRQKDLALFLQYSGAEAPSSI----EDIPLTS 147

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F ISE++ +F+IGF+I +PFL+IDM+VA+++M+MGMMMLPP  ISLPFK++ FVL+
Sbjct: 148 LVPAFAISEIKTAFQIGFMIFIPFLVIDMVVASVLMSMGMMMLPPVMISLPFKILLFVLV 207

Query: 232 DGWSLLVENLVKSF 245
           DGW L+V++L++SF
Sbjct: 208 DGWYLVVKSLLQSF 221


>gi|284159406|ref|YP_440590.3| flagellar biosynthesis protein FliP [Burkholderia thailandensis
           E264]
 gi|83653869|gb|ABC37932.1| flagellar biosynthetic protein [Burkholderia thailandensis E264]
          Length = 276

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 138/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  S PPN V++ LALF+T +VM
Sbjct: 74  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQAIGTASTPPNQVLVGLALFLTLFVM 133

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD++     +P     +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 134 SPVLDKAYTDAYKPFSEGTLQMDQAVQRGTAPFKTFMLKQTRETDLALFAKISKAA---- 189

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P ++
Sbjct: 190 PMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATV 249

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 250 SLPFKLMLFVLVDGWQLLIGSLAQSF 275


>gi|300854220|ref|YP_003779204.1| flagellar biosynthesis protein FliP [Clostridium ljungdahlii DSM
           13528]
 gi|300434335|gb|ADK14102.1| flagellar biosynthesis protein FliP [Clostridium ljungdahlii DSM
           13528]
          Length = 266

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 139/199 (69%), Gaps = 2/199 (1%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T++++ P  ++M+T F R I+VF  LR+ MG    PPN ++I LALFMT ++M P   + 
Sbjct: 69  TVITLLPSFVMMMTSFVRIIVVFGFLRSAMGTQQSPPNSILIGLALFMTVFIMYPVYSKM 128

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
               I+P M N+IT+  AI   A+P   FM   T +KDL LF+D A  +++ T   +N  
Sbjct: 129 NTNAIEPYMQNKITQQQAIDEGAKPIRSFMLKQTYKKDLQLFIDQAKLNYKVTADGQNAP 188

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           +   +++P++MISEL+ +FEIGFLI +PF++IDM+V++++MAMGM MLPPT ISL FK++
Sbjct: 189 L--YVVVPAYMISELKTAFEIGFLIYIPFMVIDMVVSSVLMAMGMFMLPPTMISLAFKLL 246

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FV++DGW LLV++L+ SF
Sbjct: 247 LFVMVDGWYLLVKSLIVSF 265


>gi|148359333|ref|YP_001250540.1| flagellar biosynthetic protein FliP [Legionella pneumophila str.
           Corby]
 gi|148281106|gb|ABQ55194.1| flagellar biosynthetic protein FliP [Legionella pneumophila str.
           Corby]
          Length = 249

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/199 (47%), Positives = 138/199 (69%), Gaps = 5/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+L++ P LL+ +T F R IIV SILR  +GM   P N ++I +ALFMT++VMSP  ++ 
Sbjct: 53  TLLTVLPGLLMAMTSFTRIIIVLSILRQAIGMAQTPTNQILIGIALFMTYFVMSPVFNKI 112

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            E  IQP MN +I  + A+    +P   FM N TR+ DLSLF   AH+  ++ D      
Sbjct: 113 NETAIQPYMNERIDFSLALSNAQKPLRQFMLNQTRKNDLSLFEKFAHNVPKSLD-----E 167

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           I   +LIP+F+ SEL+ +F+IGF++ LPFLIID++V++++MAMGMMML P  ISLPFK++
Sbjct: 168 IPMSVLIPAFITSELKTAFQIGFILFLPFLIIDLVVSSVLMAMGMMMLSPLIISLPFKIM 227

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FV++DGW+L++ +L  SF
Sbjct: 228 LFVMVDGWTLVLGSLASSF 246


>gi|52842016|ref|YP_095815.1| flagellar biosynthesis protein FliP [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|296107380|ref|YP_003619080.1| flagellar biosynthetic protein FliP [Legionella pneumophila 2300/99
           Alcoy]
 gi|52629127|gb|AAU27868.1| flagellar biosynthetic protein FliP [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|295649281|gb|ADG25128.1| flagellar biosynthetic protein FliP [Legionella pneumophila 2300/99
           Alcoy]
 gi|307610489|emb|CBX00061.1| flagellar biosynthetic protein FliP [Legionella pneumophila 130b]
          Length = 249

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/199 (47%), Positives = 138/199 (69%), Gaps = 5/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+L++ P LL+ +T F R IIV SILR  +GM   P N ++I +ALFMT++VMSP  ++ 
Sbjct: 53  TLLTVLPGLLMAMTSFTRIIIVLSILRQAIGMAQTPTNQILIGIALFMTYFVMSPVFNKI 112

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            E  IQP MN +I  + A+    +P   FM N TR+ DLSLF   AH+  ++ D      
Sbjct: 113 NETAIQPYMNERIDFSLALSNAQKPLRQFMLNQTRKNDLSLFEKFAHNVPKSLD-----E 167

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           I   +LIP+F+ SEL+ +F+IGF++ LPFLIID++V++++MAMGMMML P  ISLPFK++
Sbjct: 168 IPMSVLIPAFITSELKTAFQIGFILFLPFLIIDLVVSSVLMAMGMMMLSPLIISLPFKIM 227

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FV++DGW+L++ +L  SF
Sbjct: 228 LFVMVDGWTLVLGSLASSF 246


>gi|53717669|ref|YP_106655.1| flagellar biosynthesis protein FliP [Burkholderia pseudomallei
           K96243]
 gi|52208083|emb|CAH34013.1| flagellar biosynthetic protein [Burkholderia pseudomallei K96243]
          Length = 253

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 138/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +L+M+T F R IIV S+LR  +G  S PP+ V++ LALF+T +VM
Sbjct: 51  VQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQAIGTASTPPSQVLVGLALFLTLFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR+     +P     +    A+QR   PF  FM   TRE DL+LF  ++ ++    
Sbjct: 111 SPVLDRAYNDAYKPFSEGTLQMDQAVQRGTAPFKAFMLKQTRETDLALFAKISKAAP--- 167

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIIDM+VA+++M+MGMMM+ P ++
Sbjct: 168 -MQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 227 SLPFKLMLFVLVDGWQLLIGSLAQSF 252


>gi|296186695|ref|ZP_06855097.1| flagellar biosynthetic protein FliP [Clostridium carboxidivorans
           P7]
 gi|296048732|gb|EFG88164.1| flagellar biosynthetic protein FliP [Clostridium carboxidivorans
           P7]
          Length = 258

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 138/199 (69%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           TIL+I P  ++M+T F R I+VF  LR  MG    PPN ++I LALF+T ++M P   + 
Sbjct: 63  TILTILPSFIMMMTSFVRIIVVFGFLRGAMGTQQSPPNTILIGLALFLTVFIMQPVYSKV 122

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
               IQP M N+IT+  AI   A+P   FM   T +KD  LF+D A  +++   ITK++ 
Sbjct: 123 NTNAIQPYMQNKITQEQAIDEGAKPLRQFMLKYTYKKDFQLFIDTAKVNYK---ITKDNA 179

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
             Y +++P+FMISEL+ +F IGF++ +PF+IID++VA+++M+MGM MLPP  +SLPFK++
Sbjct: 180 PLY-VVVPAFMISELKTAFMIGFMLYIPFMIIDLVVASVLMSMGMFMLPPAMVSLPFKLL 238

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FV++DGW LLV++LV SF
Sbjct: 239 LFVMVDGWYLLVKSLVSSF 257


>gi|258621114|ref|ZP_05716148.1| Flagellar biosynthetic protein fliP [Vibrio mimicus VM573]
 gi|258626187|ref|ZP_05721035.1| Flagellar biosynthetic protein fliP [Vibrio mimicus VM603]
 gi|262170890|ref|ZP_06038568.1| flagellar biosynthesis protein FliP [Vibrio mimicus MB-451]
 gi|258581542|gb|EEW06443.1| Flagellar biosynthetic protein fliP [Vibrio mimicus VM603]
 gi|258586502|gb|EEW11217.1| Flagellar biosynthetic protein fliP [Vibrio mimicus VM573]
 gi|261891966|gb|EEY37952.1| flagellar biosynthesis protein FliP [Vibrio mimicus MB-451]
          Length = 299

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 141/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 92  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 148

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF++M+P  ++  E  +QP +N QI+   A     EP   FM   TR KDL  F++M
Sbjct: 149 LFLTFFIMAPVFNQINEQAVQPYLNEQISARQAFDLAQEPMKAFMLKQTRIKDLETFVEM 208

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + S      +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 209 SGS-----QVTAPEQVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 263

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 264 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 297


>gi|209522296|ref|ZP_03270923.1| flagellar biosynthetic protein FliP [Burkholderia sp. H160]
 gi|209497272|gb|EDZ97500.1| flagellar biosynthetic protein FliP [Burkholderia sp. H160]
          Length = 273

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 139/207 (67%), Gaps = 4/207 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +++M+T F R +IV S+LR  +G  + PPN V++ LALF+T +VM
Sbjct: 71  VQTMLLLTMLSFLPAMVLMMTSFTRIVIVLSLLRQALGTTTTPPNQVLVGLALFLTLFVM 130

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD++   G +P     +    A+ R   PF  FM   TRE DL+LF  ++H++    
Sbjct: 131 SPVLDKAYNEGYKPFSEGTMPMDQAVSRGVAPFKTFMLRQTRESDLALFARISHAA---- 186

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+PSF+ SEL+  F IGF I +PFLIIDM+VA+++M+MGMMM+ P +I
Sbjct: 187 PMQGPEDVPLSLLVPSFVTSELKTGFTIGFTIFIPFLIIDMVVASVLMSMGMMMVSPATI 246

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSFI 246
           SLPFK++ FVL+DGW LL+ +L +SF+
Sbjct: 247 SLPFKLMLFVLVDGWQLLLGSLAQSFV 273


>gi|242310594|ref|ZP_04809749.1| flagellar biosynthesis protein FliP [Helicobacter pullorum MIT
           98-5489]
 gi|239522992|gb|EEQ62858.1| flagellar biosynthesis protein FliP [Helicobacter pullorum MIT
           98-5489]
          Length = 251

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/219 (44%), Positives = 146/219 (66%), Gaps = 9/219 (4%)

Query: 28  NIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVI 87
           N P DL     I+    + T+L +AP L++M T F R +IVFS LRT MG    PP  ++
Sbjct: 40  NEPGDL---VAILNIVIVLTLLVLAPSLVLMATSFARILIVFSFLRTAMGTQQSPPTQLL 96

Query: 88  ISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSL 147
           +S AL +T ++M P +    E G++P +  +I+   A  R ++PF  FM  NTR KDL+L
Sbjct: 97  VSFALILTMFIMEPVVKEGYEKGVKPYVAKEISYQEAFVRASQPFKDFMIRNTRPKDLAL 156

Query: 148 FMDMAHSSHRNTDITKN-DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIV 206
           F  +     R  +  +N   + + I +P+F+ISE++ +F+IGFL+ LPFL+IDM++++I+
Sbjct: 157 FYRI-----RGMENPQNAQEVPFTIALPAFIISEMKTAFQIGFLLYLPFLVIDMVISSIL 211

Query: 207 MAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MAMGMMMLPPT ISLPFK++ F+L+DG++LL  NLV+SF
Sbjct: 212 MAMGMMMLPPTMISLPFKILIFILVDGFNLLTMNLVESF 250


>gi|330445376|ref|ZP_08309028.1| flagellar biosynthetic protein FliP [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489567|dbj|GAA03525.1| flagellar biosynthetic protein FliP [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 282

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 143/214 (66%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 75  DYSVTLQIL---ALMTALGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 131

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VMSP +D+     +QP +N QIT   A+++  +P   FM   TR KDL  F++M
Sbjct: 132 LFLTFFVMSPVIDKINTEAVQPYINEQITAKQALEKAEDPMRQFMLKQTRVKDLETFVNM 191

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + S+  +       ++   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+I+MAMGM
Sbjct: 192 SGSTADDPQ-----NVPLTVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASILMAMGM 246

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 247 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 280


>gi|159045807|ref|YP_001534601.1| flagellar biosynthesis protein FliP [Dinoroseobacter shibae DFL 12]
 gi|157913567|gb|ABV95000.1| flagellar biosynthesis protein FliP [Dinoroseobacter shibae DFL 12]
          Length = 242

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/221 (43%), Positives = 145/221 (65%), Gaps = 1/221 (0%)

Query: 26  VMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNL 85
            +N+  + S+S    +   + T+LSIAP L IM+TCFP  + V SILR G+G+   PPN+
Sbjct: 23  AINLGDETSLSARTFQIIALITVLSIAPGLAIMITCFPFMVTVLSILRQGIGLQQSPPNM 82

Query: 86  VIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDL 145
           +IISLALF+T++VM P    +   GIQP+++  +      +   EPF  FM+  T  + L
Sbjct: 83  LIISLALFLTYFVMDPVFREAWSRGIQPMVDGAVDMEEGFRAALEPFIRFMQARTDPETL 142

Query: 146 SLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATI 205
           +   ++   +       + D     +LIPSF++SE+ ++F+IGFLI LPFLIID+IVA I
Sbjct: 143 ARLGNLRMETAGVAPF-ELDAPPISVLIPSFLLSEIEKAFQIGFLIFLPFLIIDLIVAAI 201

Query: 206 VMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           +M+MGMMM+PP  +SLPFK+ FFV+ DGW+LL E L++S++
Sbjct: 202 LMSMGMMMVPPAIVSLPFKLAFFVVADGWTLLSEALLRSYM 242


>gi|295399824|ref|ZP_06809805.1| flagellar biosynthetic protein FliP [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312111664|ref|YP_003989980.1| flagellar biosynthetic protein FliP [Geobacillus sp. Y4.1MC1]
 gi|294978227|gb|EFG53824.1| flagellar biosynthetic protein FliP [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311216765|gb|ADP75369.1| flagellar biosynthetic protein FliP [Geobacillus sp. Y4.1MC1]
          Length = 222

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 137/195 (70%), Gaps = 4/195 (2%)

Query: 51  IAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMG 110
           IAP +LIM+TCF R IIV S +RT +G   +PPN V+I LA+F+TF++M+PT     +  
Sbjct: 31  IAPGILIMMTCFTRIIIVLSFVRTSLGTQQMPPNQVLIGLAMFLTFFIMAPTFKEINDQA 90

Query: 111 IQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYR 170
           +QPL + +I    A +R + P   FM  +TR+KDL+LF+  + +    T       I   
Sbjct: 91  LQPLFSEKINLEQAYERASVPIKEFMSKHTRQKDLALFLSYSGAEKPKT----VQDIPLS 146

Query: 171 ILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVL 230
            L+P+F ISE++ +F++G +I +PFL+IDMIVA+++M+MGMMMLPP  ISLPFK++ FVL
Sbjct: 147 TLVPAFAISEIKTAFQMGVMIFIPFLVIDMIVASVLMSMGMMMLPPVMISLPFKILLFVL 206

Query: 231 IDGWSLLVENLVKSF 245
           +DGW L+V++L++SF
Sbjct: 207 VDGWYLVVKSLLESF 221


>gi|323703181|ref|ZP_08114834.1| flagellar biosynthetic protein FliP [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531840|gb|EGB21726.1| flagellar biosynthetic protein FliP [Desulfotomaculum nigrificans
           DSM 574]
          Length = 270

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/200 (45%), Positives = 137/200 (68%), Gaps = 6/200 (3%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           ++L++ P  LIM+T F R ++V S LR+ +G    PPN V++ LALF+T ++MSP     
Sbjct: 75  SLLAMVPAFLIMLTSFTRIVVVLSFLRSALGTQQTPPNQVLVGLALFLTIFIMSPVYKDM 134

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN-D 165
            +  IQP + NQ+T   A  +  +P   FM   TREKDL LF+ +A       D  KN +
Sbjct: 135 NKNAIQPYLANQLTYEQAADKAIQPLKAFMARQTREKDLGLFISVAK-----MDKPKNIN 189

Query: 166 HIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKV 225
            +   +L+P+F+ISEL+ +F+IGF+I +PFL+IDM+VA+ +M+MGM MLPP  +SLPFK+
Sbjct: 190 EVPMSVLVPAFVISELKTAFQIGFIIFVPFLVIDMVVASTLMSMGMFMLPPVMVSLPFKL 249

Query: 226 IFFVLIDGWSLLVENLVKSF 245
           + FV++DGW L+V++LV+SF
Sbjct: 250 LLFVMVDGWYLVVKSLVESF 269


>gi|23099026|ref|NP_692492.1| flagellar biosynthesis protein FliP [Oceanobacillus iheyensis
           HTE831]
 gi|22777254|dbj|BAC13527.1| flagellar protein required for flagellar formation [Oceanobacillus
           iheyensis HTE831]
          Length = 221

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 99/216 (45%), Positives = 143/216 (66%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P ++S S   V+   + TI S+AP +LI++T F R IIV S +RT +    +PPN V+I 
Sbjct: 13  PTNISTS---VKLLLLLTIFSLAPGILILMTSFTRIIIVLSFVRTSLATQQMPPNQVLIG 69

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           +ALFM+F++M+PT     E G+ PL N +IT   A +  + P   FM  +TR+KDL LF+
Sbjct: 70  IALFMSFFIMAPTFTEVYEEGLGPLFNEEITLDEAYENASIPLKEFMAQHTRQKDLELFL 129

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           +   +    T     + I    L+P+F ISEL+ +F++GFLI +PFLIIDM VA+I+M+M
Sbjct: 130 NYTQADPPET----IEDIPLTTLVPAFAISELKTAFQMGFLIFIPFLIIDMAVASILMSM 185

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FVL+DGW L+ ++L+  F
Sbjct: 186 GMMMLPPVMISLPFKILLFVLVDGWYLITQSLLGGF 221


>gi|291326353|ref|ZP_06124191.2| flagellar biosynthetic protein FliP [Providencia rettgeri DSM 1131]
 gi|291314687|gb|EFE55140.1| flagellar biosynthetic protein FliP [Providencia rettgeri DSM 1131]
          Length = 215

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 134/193 (69%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P LL+M+T F R IIV  +LR  +G  S PPN V++ LALF+TF+VMSP  D+      Q
Sbjct: 25  PALLLMMTSFTRIIIVLGLLRNALGTPSAPPNQVLLGLALFLTFFVMSPVADQVYREAYQ 84

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P   ++I+  TA+++   P   FM   TRE DL+LF  +A    +  +I +   +  RIL
Sbjct: 85  PFSEDKISLETALEKGTAPLRTFMLGQTRESDLALFARIA----KVGEIQEAKDVPLRIL 140

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+F+ SEL+ +F+IGF I +PFLIID++VA+++MA+GMMM+PP ++SLPFK++ FVL+D
Sbjct: 141 VPAFITSELKTAFQIGFTIFIPFLIIDLVVASVLMALGMMMVPPATVSLPFKLMLFVLVD 200

Query: 233 GWSLLVENLVKSF 245
           GW LL+ +L +SF
Sbjct: 201 GWQLLLGSLSQSF 213


>gi|300722650|ref|YP_003711940.1| flagellar biosynthesis protein [Xenorhabdus nematophila ATCC 19061]
 gi|297629157|emb|CBJ89753.1| flagellar biosynthesis [Xenorhabdus nematophila ATCC 19061]
          Length = 272

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/229 (41%), Positives = 145/229 (63%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T    T L   P  L+M+T F R IIV  +LR  +
Sbjct: 46  AAAELPGIISQPLPNGGQSWSLPVQTLIFITALGFIPAALLMMTSFTRIIIVLGLLRNAL 105

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ LALFMTF++M+P  D+  +    P   ++IT   A+ + ++P   FM
Sbjct: 106 GTPSAPPNQVMLGLALFMTFFIMAPVFDKVYQDAYLPYNEDKITLEAALDKGSKPLRQFM 165

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+LF  +A      T     D +  R+L+P+F+ SEL+ +F+IGF + +PFL
Sbjct: 166 LRQTRENDLALFARLADQEAFET----ADSVPLRVLVPAFITSELKTAFQIGFTLFIPFL 221

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 222 IIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSF 270


>gi|15642122|ref|NP_231754.1| flagellar biosynthesis protein FliP [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121727223|ref|ZP_01680390.1| flagellar biosynthetic protein FliP [Vibrio cholerae V52]
 gi|147674933|ref|YP_001217644.1| flagellar biosynthesis protein FliP [Vibrio cholerae O395]
 gi|153818972|ref|ZP_01971639.1| flagellar biosynthetic protein FliP [Vibrio cholerae NCTC 8457]
 gi|153822891|ref|ZP_01975558.1| flagellar biosynthetic protein FliP [Vibrio cholerae B33]
 gi|227082248|ref|YP_002810799.1| flagellar biosynthetic protein FliP [Vibrio cholerae M66-2]
 gi|229507792|ref|ZP_04397297.1| flagellar biosynthesis protein FliP [Vibrio cholerae BX 330286]
 gi|229511971|ref|ZP_04401450.1| flagellar biosynthesis protein FliP [Vibrio cholerae B33]
 gi|229513774|ref|ZP_04403236.1| flagellar biosynthesis protein FliP [Vibrio cholerae TMA 21]
 gi|229519107|ref|ZP_04408550.1| flagellar biosynthesis protein FliP [Vibrio cholerae RC9]
 gi|229522076|ref|ZP_04411493.1| flagellar biosynthesis protein FliP [Vibrio cholerae TM 11079-80]
 gi|229524125|ref|ZP_04413530.1| flagellar biosynthesis protein FliP [Vibrio cholerae bv. albensis
           VL426]
 gi|229607337|ref|YP_002877985.1| flagellar biosynthesis protein FliP [Vibrio cholerae MJ-1236]
 gi|254226359|ref|ZP_04919948.1| flagellar biosynthetic protein FliP [Vibrio cholerae V51]
 gi|254291359|ref|ZP_04962152.1| flagellar biosynthetic protein FliP [Vibrio cholerae AM-19226]
 gi|254849208|ref|ZP_05238558.1| flagellar biosynthesis protein FliP [Vibrio cholerae MO10]
 gi|255745138|ref|ZP_05419087.1| flagellar biosynthesis protein FliP [Vibrio cholera CIRS 101]
 gi|262153472|ref|ZP_06028602.1| flagellar biosynthesis protein FliP [Vibrio cholerae INDRE 91/1]
 gi|262167482|ref|ZP_06035188.1| flagellar biosynthesis protein FliP [Vibrio cholerae RC27]
 gi|262191372|ref|ZP_06049562.1| flagellar biosynthesis protein FliP [Vibrio cholerae CT 5369-93]
 gi|297582021|ref|ZP_06943940.1| flagellar biosynthetic protein FliP [Vibrio cholerae RC385]
 gi|298497855|ref|ZP_07007662.1| flagellar biosynthetic protein FliP [Vibrio cholerae MAK 757]
 gi|9656673|gb|AAF95268.1| flagellar biosynthetic protein FliP [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121630468|gb|EAX62861.1| flagellar biosynthetic protein FliP [Vibrio cholerae V52]
 gi|125621109|gb|EAZ49454.1| flagellar biosynthetic protein FliP [Vibrio cholerae V51]
 gi|126510467|gb|EAZ73061.1| flagellar biosynthetic protein FliP [Vibrio cholerae NCTC 8457]
 gi|126519587|gb|EAZ76810.1| flagellar biosynthetic protein FliP [Vibrio cholerae B33]
 gi|146316816|gb|ABQ21355.1| flagellar biosynthetic protein FliP [Vibrio cholerae O395]
 gi|150422689|gb|EDN14643.1| flagellar biosynthetic protein FliP [Vibrio cholerae AM-19226]
 gi|227010136|gb|ACP06348.1| flagellar biosynthetic protein FliP [Vibrio cholerae M66-2]
 gi|227014019|gb|ACP10229.1| flagellar biosynthetic protein FliP [Vibrio cholerae O395]
 gi|229337706|gb|EEO02723.1| flagellar biosynthesis protein FliP [Vibrio cholerae bv. albensis
           VL426]
 gi|229341001|gb|EEO06006.1| flagellar biosynthesis protein FliP [Vibrio cholerae TM 11079-80]
 gi|229343796|gb|EEO08771.1| flagellar biosynthesis protein FliP [Vibrio cholerae RC9]
 gi|229348955|gb|EEO13912.1| flagellar biosynthesis protein FliP [Vibrio cholerae TMA 21]
 gi|229351936|gb|EEO16877.1| flagellar biosynthesis protein FliP [Vibrio cholerae B33]
 gi|229355297|gb|EEO20218.1| flagellar biosynthesis protein FliP [Vibrio cholerae BX 330286]
 gi|229369992|gb|ACQ60415.1| flagellar biosynthesis protein FliP [Vibrio cholerae MJ-1236]
 gi|254844913|gb|EET23327.1| flagellar biosynthesis protein FliP [Vibrio cholerae MO10]
 gi|255736968|gb|EET92364.1| flagellar biosynthesis protein FliP [Vibrio cholera CIRS 101]
 gi|262024054|gb|EEY42749.1| flagellar biosynthesis protein FliP [Vibrio cholerae RC27]
 gi|262030709|gb|EEY49343.1| flagellar biosynthesis protein FliP [Vibrio cholerae INDRE 91/1]
 gi|262032747|gb|EEY51295.1| flagellar biosynthesis protein FliP [Vibrio cholerae CT 5369-93]
 gi|297533716|gb|EFH72558.1| flagellar biosynthetic protein FliP [Vibrio cholerae RC385]
 gi|297542188|gb|EFH78238.1| flagellar biosynthetic protein FliP [Vibrio cholerae MAK 757]
          Length = 299

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 140/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 92  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 148

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF++M+P  ++  E  +QP +N QIT   A     EP   FM   TR  DL  F++M
Sbjct: 149 LFLTFFIMAPVFNQINEQAVQPYLNEQITARQAFDLAQEPLKAFMLKQTRVNDLETFVEM 208

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + +      +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 209 SGA-----QVTAPEQVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 263

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 264 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 297


>gi|261344130|ref|ZP_05971774.1| flagellar biosynthetic protein FliP [Providencia rustigianii DSM
           4541]
 gi|282567722|gb|EFB73257.1| flagellar biosynthetic protein FliP [Providencia rustigianii DSM
           4541]
          Length = 247

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 134/193 (69%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +L+M+T F R IIV  +LR  +G  S PPN V++ LALF+TF+VMSP  D+      Q
Sbjct: 57  PAMLLMMTSFTRIIIVLGLLRNALGTPSAPPNQVLLGLALFLTFFVMSPVADQVYREAYQ 116

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P   ++I+  TA+++   P   FM   TRE DL+LF  +A    +  +I +   +  RIL
Sbjct: 117 PFSEDKISLETALEKGTAPLRTFMLGQTRESDLALFARIA----KVGEIQEAKDVPMRIL 172

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+F+ SEL+ +F+IGF I +PFLIID++VA+++MA+GMMM+PP ++SLPFK++ FVL+D
Sbjct: 173 VPAFITSELKTAFQIGFTIFIPFLIIDLVVASVLMALGMMMVPPATVSLPFKLMLFVLVD 232

Query: 233 GWSLLVENLVKSF 245
           GW LL+ +L +SF
Sbjct: 233 GWQLLLGSLSQSF 245


>gi|153825580|ref|ZP_01978247.1| flagellar biosynthetic protein FliP [Vibrio cholerae MZO-2]
 gi|149740731|gb|EDM54830.1| flagellar biosynthetic protein FliP [Vibrio cholerae MZO-2]
          Length = 299

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 140/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 92  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 148

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF++M+P  ++  E  +QP +N QIT   A     EP   FM   TR  DL  F++M
Sbjct: 149 LFLTFFIMAPVFNQINEQAVQPYLNEQITARQAFDLAQEPLKAFMLKQTRVNDLETFVEM 208

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + +      +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 209 SGA-----QVTAPEQVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 263

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 264 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 297


>gi|261209859|ref|ZP_05924160.1| flagellar biosynthesis protein FliP [Vibrio sp. RC341]
 gi|260841045|gb|EEX67570.1| flagellar biosynthesis protein FliP [Vibrio sp. RC341]
          Length = 299

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 141/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 92  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 148

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF++M+P  ++  E  +QP +N QI+   A     EP   FM   TR KDL  F++M
Sbjct: 149 LFLTFFIMAPVFNQINEQAVQPYLNEQISARQAFDLAQEPMKAFMLKQTRVKDLETFVEM 208

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + +      +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 209 SGA-----QVTAPEQVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 263

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 264 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 297


>gi|317129193|ref|YP_004095475.1| flagellar biosynthetic protein FliP [Bacillus cellulosilyticus DSM
           2522]
 gi|315474141|gb|ADU30744.1| flagellar biosynthetic protein FliP [Bacillus cellulosilyticus DSM
           2522]
          Length = 222

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 134/195 (68%), Gaps = 4/195 (2%)

Query: 51  IAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMG 110
           IAP +LI++TCF R ++V S +R+G+    +PPN V++ LALF+TF++M+P      E  
Sbjct: 32  IAPSILILMTCFTRIVVVLSFVRSGLATQQMPPNQVLVGLALFITFFIMAPVFSEVNEQA 91

Query: 111 IQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYR 170
           +QP+   ++T+  A    A P   FM  +TREKDL+LFM  A      T     D I   
Sbjct: 92  LQPMFAGEMTQEEAFDAAALPMKEFMAQHTREKDLALFMGYAGLPRPET----LDDIPLT 147

Query: 171 ILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVL 230
            L+P+F ISEL+ +F+IGF+I +PFL+IDM+VA+++M+MGMMMLPP  I+LPFK++ FV+
Sbjct: 148 ALVPAFAISELKTAFQIGFMIFIPFLVIDMVVASVLMSMGMMMLPPVMIALPFKILLFVM 207

Query: 231 IDGWSLLVENLVKSF 245
           +DGW L+V +L+ SF
Sbjct: 208 VDGWHLVVRSLLLSF 222


>gi|253682024|ref|ZP_04862821.1| flagellar biosynthetic protein FliP [Clostridium botulinum D str.
           1873]
 gi|253561736|gb|EES91188.1| flagellar biosynthetic protein FliP [Clostridium botulinum D str.
           1873]
          Length = 257

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 142/206 (68%), Gaps = 3/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T+LS+ P  L+M+T F R IIV   +R  +G    PPN ++I +ALF+T ++M
Sbjct: 53  IKLLVMLTVLSLLPSFLVMMTSFTRIIIVLGFMRNALGTQQAPPNQILIGIALFLTIFIM 112

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT     +  I+P + N+IT   AI   ++P   FM   TR+KDL LF+D++ +     
Sbjct: 113 APTYKTINKEAIKPFIENKITGQQAIDNASKPMREFMLKQTRDKDLELFLDISKTDK--A 170

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            ITK D++   ++IPSF+ISEL+ +F+IGFL+ +PFLIID++VA+++M+MGM MLPP  I
Sbjct: 171 KITK-DNVPMYVVIPSFIISELKTAFKIGFLLYIPFLIIDIVVASVLMSMGMFMLPPVMI 229

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FV++DGW LLV++L+  +
Sbjct: 230 SLPFKILLFVMVDGWYLLVKSLIMGY 255


>gi|262404469|ref|ZP_06081024.1| flagellar biosynthesis protein FliP [Vibrio sp. RC586]
 gi|262349501|gb|EEY98639.1| flagellar biosynthesis protein FliP [Vibrio sp. RC586]
          Length = 299

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 141/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 92  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 148

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF++M+P  ++  E  +QP +N QI+   A     EP   FM   TR KDL  F++M
Sbjct: 149 LFLTFFIMAPVFNQINEQAVQPYLNEQISARQAFDLAQEPMKAFMLKQTRVKDLETFVEM 208

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + +      +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 209 SGA-----QVTAPEQVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 263

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 264 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 297


>gi|89056669|ref|YP_512120.1| flagellar biosynthesis protein FliP [Jannaschia sp. CCS1]
 gi|88866218|gb|ABD57095.1| flagellar biosynthetic protein FliP [Jannaschia sp. CCS1]
          Length = 243

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 97/213 (45%), Positives = 141/213 (66%), Gaps = 10/213 (4%)

Query: 36  STWIVRTF---GIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLAL 92
           S+   R+F    + ++LS+AP L +MVTCFP  + V SILR  +G+   PPN++I+SLAL
Sbjct: 37  SSLTARSFQLIALISVLSLAPGLAVMVTCFPFVVTVLSILRQAIGLQQSPPNMLIVSLAL 96

Query: 93  FMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMA 152
           F+T++VM+P  + +   GI PL+  ++T   AI  + EPF  FM N     D S  + +A
Sbjct: 97  FLTYFVMAPVFEEAYRAGIAPLIAGELTPDAAIPLIYEPFRGFMLNRV---DTSTLVSLA 153

Query: 153 HSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMM 212
                  D    D     +LIPSFM+SE+ R+F+IGFL+ LPFL+ID++VA I+M+MGMM
Sbjct: 154 EL-RPGADAANPDP---SVLIPSFMLSEVERAFQIGFLVFLPFLVIDLVVAAILMSMGMM 209

Query: 213 MLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           M+PP  +SLPFK+ FFV+ DGW+L+   LV+S+
Sbjct: 210 MVPPAIVSLPFKLAFFVVADGWALITGALVRSY 242


>gi|254462066|ref|ZP_05075482.1| flagellar biosynthetic protein FliP [Rhodobacterales bacterium
           HTCC2083]
 gi|206678655|gb|EDZ43142.1| flagellar biosynthetic protein FliP [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 256

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 89/207 (42%), Positives = 141/207 (68%), Gaps = 4/207 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T L+I P  L+ +T F R IIV SILR  MG    PPN V+IS+ALF+TFY+M
Sbjct: 53  LQILALMTALTILPSFLLGITAFTRVIIVLSILRQAMGTQQTPPNQVLISIALFLTFYIM 112

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT ++  E  I P +N Q+    AI+  A     F+  NTRE +L++F +MA  +   +
Sbjct: 113 APTFEQIYEKAISPYLNGQMQPVAAIETGAAILSEFLILNTRESELAMFAEMAGDAPYES 172

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
               N+ + Y +L+P+F+ SEL+ +F+IGFL+ LPFL+ID+++A+I+MA+GMMML P  +
Sbjct: 173 ----NEDVPYTVLMPAFITSELKTAFQIGFLLFLPFLVIDLVIASILMALGMMMLSPMLV 228

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSFI 246
           SLPFK++ FVL+DGW++ + ++  +++
Sbjct: 229 SLPFKLLLFVLVDGWAMTIGSIASTYV 255


>gi|171057713|ref|YP_001790062.1| flagellar biosynthesis protein FliP [Leptothrix cholodnii SP-6]
 gi|170775158|gb|ACB33297.1| flagellar biosynthetic protein FliP [Leptothrix cholodnii SP-6]
          Length = 262

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 137/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+M+T F R +IV  +LR  +G  + PPN VI+ L+LF+TF+VM
Sbjct: 59  IQTLLFFTALSFLPAVLLMMTGFTRIVIVLGLLRQALGTQAAPPNQVIVGLSLFLTFFVM 118

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PTLDR      +P   NQI    AI R   P   FM   TR+ DL+LF  +A    +  
Sbjct: 119 APTLDRVYADAYKPYAANQIGFEEAIARGEVPMRQFMLKQTRQSDLALFARLA----KLD 174

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
              K++    R+L+P+F+ SEL+ +F+IGFLI +PFL+IDM+VA+++M++GMMML P  +
Sbjct: 175 PAVKSEQAPLRVLVPAFVTSELKSAFQIGFLIFIPFLVIDMVVASVLMSLGMMMLSPVLV 234

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL DGW+LL+ +L  SF
Sbjct: 235 ALPFKLMLFVLADGWNLLLGSLAASF 260


>gi|254491717|ref|ZP_05104896.1| flagellar biosynthetic protein FliP [Methylophaga thiooxidans
           DMS010]
 gi|224463195|gb|EEF79465.1| flagellar biosynthetic protein FliP [Methylophaga thiooxydans
           DMS010]
          Length = 244

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 153/246 (62%), Gaps = 6/246 (2%)

Query: 2   IRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIMV 59
           +R     L L  P L  A+  +  V     +    ++ V  +   + T+L++ P  L+M+
Sbjct: 1   MRVLLACLLLFAPLLAVAEPGIPAVTVTGNEDGGQSYTVTLQILALMTVLTLLPAALMMM 60

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R IIV +ILR  MG+ S P N ++I LALF+T ++M P  ++S +  + P M+ +I
Sbjct: 61  TSFTRIIIVLAILRQAMGVQSTPSNQILIGLALFLTIFIMHPVFNQSYQNAVVPYMDGEI 120

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
             TTA ++ ++PF  FM   TRE D+ LF  +        ++   + I + +L+PSF+ S
Sbjct: 121 EFTTAFEQASQPFKEFMIAQTRETDIELFASIGGYE----ELQSAEDIPFSLLLPSFVTS 176

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F+IGFLI +PFLIID++VA+++MAMGMMML P  ISLPFK++ FVLIDGW+LL+ 
Sbjct: 177 ELKTAFQIGFLIFIPFLIIDLVVASVLMAMGMMMLSPMLISLPFKLMLFVLIDGWALLMG 236

Query: 240 NLVKSF 245
            L  SF
Sbjct: 237 TLASSF 242


>gi|238025697|ref|YP_002909928.1| flagellar biosynthesis protein FliP [Burkholderia glumae BGR1]
 gi|237874891|gb|ACR27224.1| Flagellar biosynthetic protein FliP [Burkholderia glumae BGR1]
          Length = 266

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 139/206 (67%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+LS  P +++M+T F R IIV S++R  +G  + PPN V++ LALF+T +VM
Sbjct: 64  VQTMLLLTMLSFLPAIVLMMTSFTRIIIVLSLMRQALGTATTPPNQVLVGLALFLTLFVM 123

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP +DR+   G +P     +    A+QR   PF  FM   TRE DL+LF  +A +     
Sbjct: 124 SPVIDRAYNDGYKPFSAGTLPMDQAVQRGLAPFKTFMLKQTREGDLALFAKIAKAPA--- 180

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +   +L+P+F+ SEL+  F+IGF I +PFLIID++VA+++M+MGMMM+ PT+I
Sbjct: 181 -MQGPEDVPLPLLVPAFVTSELKTGFQIGFTIFIPFLIIDLVVASVLMSMGMMMVSPTTI 239

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 240 SLPFKLMLFVLVDGWQLLIGSLAQSF 265


>gi|229528865|ref|ZP_04418255.1| flagellar biosynthesis protein FliP [Vibrio cholerae 12129(1)]
 gi|229332639|gb|EEN98125.1| flagellar biosynthesis protein FliP [Vibrio cholerae 12129(1)]
 gi|327484651|gb|AEA79058.1| Flagellar biosynthesis protein FliP [Vibrio cholerae LMA3894-4]
          Length = 299

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 140/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 92  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 148

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF++M+P  ++  E  +QP +N QIT   A     EP   FM   TR  DL  F++M
Sbjct: 149 LFLTFFIMAPVFNQINEQAVQPYLNEQITARQAFDLAQEPLKAFMLKQTRVNDLETFVEM 208

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + +      +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 209 SGA-----QVTAPEQVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 263

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 264 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 297


>gi|153213266|ref|ZP_01948678.1| flagellar biosynthetic protein FliP [Vibrio cholerae 1587]
 gi|124116066|gb|EAY34886.1| flagellar biosynthetic protein FliP [Vibrio cholerae 1587]
          Length = 287

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 140/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 80  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 136

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF++M+P  ++  E  +QP +N QIT   A     EP   FM   TR  DL  F++M
Sbjct: 137 LFLTFFIMAPVFNQINEQAVQPYLNEQITARQAFDLAQEPLKAFMLKQTRVNDLETFVEM 196

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + +      +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 197 SGA-----QVTAPEQVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 251

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 252 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 285


>gi|153828653|ref|ZP_01981320.1| flagellar biosynthetic protein FliP [Vibrio cholerae 623-39]
 gi|148875924|gb|EDL74059.1| flagellar biosynthetic protein FliP [Vibrio cholerae 623-39]
          Length = 299

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 140/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 92  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 148

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF++M+P  ++  E  +QP +N QIT   A     EP   FM   TR  DL  F++M
Sbjct: 149 LFLTFFIMAPVFNQINEQAVQPYLNEQITALQAFDLAQEPLKAFMLKQTRVNDLETFVEM 208

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + +      +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 209 SGA-----QVTAPEQVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 263

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 264 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 297


>gi|302392379|ref|YP_003828199.1| flagellar biosynthetic protein FliP [Acetohalobium arabaticum DSM
           5501]
 gi|302204456|gb|ADL13134.1| flagellar biosynthetic protein FliP [Acetohalobium arabaticum DSM
           5501]
          Length = 257

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 141/201 (70%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+LS+AP +LIM+T F R  +V S++R  +    +PPN VII LA+F+T +VM+P   
Sbjct: 60  LLTVLSLAPAILIMLTSFVRIAVVLSLIRRALATRRMPPNQVIIGLAIFLTIFVMAPVWG 119

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  +  +QP ++++I +  A ++  +P   FM   TREKD++LF+D+         +   
Sbjct: 120 QIYDTAVQPYLDDEINQMQAYEQGIKPLRKFMFKQTREKDIALFVDLGEIERPQNQM--- 176

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
             I   +LIP+F+ISELR +F+IGF+I LPF++IDMIVA+ +M+MGMMMLPP  ISLPFK
Sbjct: 177 -EIPTYVLIPAFIISELRIAFQIGFIIYLPFIVIDMIVASTLMSMGMMMLPPVMISLPFK 235

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L++++L+K+F
Sbjct: 236 ILLFVLVDGWYLVIKSLIKTF 256


>gi|226327730|ref|ZP_03803248.1| hypothetical protein PROPEN_01603 [Proteus penneri ATCC 35198]
 gi|225203434|gb|EEG85788.1| hypothetical protein PROPEN_01603 [Proteus penneri ATCC 35198]
          Length = 256

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 155/248 (62%), Gaps = 11/248 (4%)

Query: 3   RYCFFA---LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLI 57
           R+  FA   + L+ P   FA+     ++  P      +W   V+T    T L   P +L+
Sbjct: 13  RWRLFASVLVLLLLPTSAFAQ--FPGIITQPLPGGGQSWSLPVQTLIFITALGFIPAVLL 70

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           M+T F R IIV  +LR  +G  S PPN V++ LALFMTF++M+P  D+  +    P   +
Sbjct: 71  MMTSFTRIIIVLGLLRNALGTPSAPPNQVVLGLALFMTFFIMAPVFDKIYQDAYMPFTED 130

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           QIT   A++  ++P   FM   TRE DL+LF  +A +    T     + +  RIL+P+++
Sbjct: 131 QITFEQALENGSKPLRQFMMQQTRETDLALFARLADAPAFET----RESVPMRILVPAYI 186

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
            SEL+ +F+IGF+I +PFLIID++VA+++MA+GMMM+PP ++SLPFK++ FVL+DGW L+
Sbjct: 187 TSELKTAFQIGFMIFIPFLIIDLVVASVLMALGMMMVPPATVSLPFKLMLFVLVDGWQLI 246

Query: 238 VENLVKSF 245
           + +L +SF
Sbjct: 247 LGSLAQSF 254


>gi|224373184|ref|YP_002607556.1| flagellar biosynthesis protein FliP [Nautilia profundicola AmH]
 gi|223589473|gb|ACM93209.1| flagellar biosynthetic protein FliP [Nautilia profundicola AmH]
          Length = 242

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 133/194 (68%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +++++T F R ++VF  LR  +G    PP  +++SLAL +TF++M P   ++   GI
Sbjct: 52  APSIILVMTSFVRLLVVFGFLRQALGTPQSPPTTLLVSLALVLTFFIMEPYAKQAYNTGI 111

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           +P M  +I    A     +PF  FM  NTREKDL+LF  + H  +  T     D +   I
Sbjct: 112 KPYMEEKIGYDQAFNNAVKPFKKFMIKNTREKDLALFFRIRHLPNPKTI----DDVPLTI 167

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+FM+SEL+ +FEIGFLI LPFLIIDM+V++I+M++GMMMLPP  ISLPFK++ FVL+
Sbjct: 168 LVPAFMLSELKTAFEIGFLIFLPFLIIDMVVSSILMSLGMMMLPPVMISLPFKILVFVLV 227

Query: 232 DGWSLLVENLVKSF 245
           DGW+L+V  LV+SF
Sbjct: 228 DGWNLIVMGLVQSF 241


>gi|298530624|ref|ZP_07018026.1| flagellar biosynthetic protein FliP [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509998|gb|EFI33902.1| flagellar biosynthetic protein FliP [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 236

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 92/202 (45%), Positives = 139/202 (68%), Gaps = 4/202 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TILS+AP +++ +TCF R IIVFS +R  +G   +PPN V+ +LA+F+T  +M+P   
Sbjct: 39  LLTILSVAPAIVLTITCFTRIIIVFSFIRHAIGTQQMPPNQVLAALAIFLTVAIMAPIGS 98

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
              +  +QP +N +I    A+ R   P   FM  +TRE+DLS+F  +       +     
Sbjct: 99  EINQTALQPYLNEEIGHEEALSRAEGPMREFMFKHTRERDLSVFYSITGMERPES----R 154

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           + +   +LIP+FMISEL+ +F+IGFLI +PFLI+DM+VA+I+++MGMMMLPP  IS+PFK
Sbjct: 155 EDVPTMLLIPAFMISELKTAFQIGFLIYIPFLILDMVVASILLSMGMMMLPPVMISMPFK 214

Query: 225 VIFFVLIDGWSLLVENLVKSFI 246
           V+ F+++DGW+LLV +LV SF+
Sbjct: 215 VLLFIMVDGWNLLVGSLVNSFV 236


>gi|153803026|ref|ZP_01957612.1| flagellar biosynthetic protein FliP [Vibrio cholerae MZO-3]
 gi|124121424|gb|EAY40167.1| flagellar biosynthetic protein FliP [Vibrio cholerae MZO-3]
          Length = 299

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 140/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 92  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 148

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF++M+P  ++  E  +QP +N QIT   A     EP   FM   TR  DL  F++M
Sbjct: 149 LFLTFFIMAPVFNQINEQAVQPYLNEQITARQAFDLAQEPLKAFMLKQTRVNDLETFVEM 208

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + +      +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 209 SGA-----QVTAPEQVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 263

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 264 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 297


>gi|124265768|ref|YP_001019772.1| flagellar biosynthesis protein FliP [Methylibium petroleiphilum
           PM1]
 gi|124258543|gb|ABM93537.1| flagellar biosynthesis protein [Methylibium petroleiphilum PM1]
          Length = 254

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 136/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+M+T F R +IV S+LR  +G  SVPPN V+I L+LF+T +VM
Sbjct: 51  IQTLLFFTALSFLPAVLLMMTGFTRIVIVLSLLRQALGTQSVPPNQVLIGLSLFLTLFVM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PT+D+      +P   NQI    A+ R   P   FM   TR+ DL LF  +A    +  
Sbjct: 111 GPTIDKVYSEAYKPFAANQIAFDEALARGEAPMRSFMLKQTRQSDLMLFARLA----KLD 166

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
              K +   +R+L+P+F+ SEL+ +F+IGFLI +PFLIIDMIVA+++M++GMMML P  +
Sbjct: 167 PAVKGEDAPFRVLVPAFVTSELKSAFQIGFLIFIPFLIIDMIVASVLMSLGMMMLSPVLV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL DGW+LL+ +L  SF
Sbjct: 227 ALPFKLMLFVLADGWNLLLGSLAASF 252


>gi|24052334|gb|AAN43540.1| flagellar biosynthesis [Shigella flexneri 2a str. 301]
 gi|313650170|gb|EFS14583.1| flagellar biosynthetic protein FliP [Shigella flexneri 2a str.
           2457T]
 gi|332757282|gb|EGJ87619.1| flagellar biosynthetic protein FliP [Shigella flexneri 2747-71]
 gi|332757514|gb|EGJ87849.1| flagellar biosynthetic protein FliP [Shigella flexneri K-671]
 gi|332766686|gb|EGJ96890.1| flagellar biosynthetic protein FliP [Shigella flexneri 2930-71]
 gi|333017554|gb|EGK36866.1| flagellar biosynthetic protein FliP [Shigella flexneri K-304]
          Length = 204

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 140/205 (68%), Gaps = 4/205 (1%)

Query: 41  RTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMS 100
           +T    T L+  P +L+M+T F R IIVF +LR  +G  S PPN V++ LALF+TF++MS
Sbjct: 2   QTLVFITSLTFIPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMS 61

Query: 101 PTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTD 160
           P +D+      QP    +I+   A+++ A+P   FM   TRE DL LF  +A++      
Sbjct: 62  PVIDKIYVDAYQPFSEEKISMQEALEKGAQPLREFMLRQTREADLGLFARLANTG----P 117

Query: 161 ITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSIS 220
           +   + +  RIL+P+++ SEL+ +F+IGF I +PFLIID+++A+++MA+GMMM+PP +I+
Sbjct: 118 LQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIA 177

Query: 221 LPFKVIFFVLIDGWSLLVENLVKSF 245
           LPFK++ FVL+DGW LLV +L +SF
Sbjct: 178 LPFKLMLFVLVDGWQLLVGSLAQSF 202


>gi|270262391|ref|ZP_06190662.1| flagellar biosynthetic protein FliP [Serratia odorifera 4Rx13]
 gi|270043075|gb|EFA16168.1| flagellar biosynthetic protein FliP [Serratia odorifera 4Rx13]
          Length = 241

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 97/239 (40%), Positives = 154/239 (64%), Gaps = 9/239 (3%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFI 66
           L LV+P    A + L  +++ P      +W   V+T  + T LS  P +L+M+T F R I
Sbjct: 8   LLLVSPA---ALAQLPGLISQPLADGGQSWSLPVQTLVLLTSLSFLPAMLLMMTSFTRII 64

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IV  +LR  +G  S PPN V++ LALF+TF++MSP  D+  +    P   ++I+   A+ 
Sbjct: 65  IVLGLLRNALGTPSAPPNQVMLGLALFLTFFIMSPVFDKVYQDAYLPFSQDKISLDAALD 124

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           + ++P   FM   TRE DL+L+  +A+       +   + +  RIL+P+++ SEL+ +F+
Sbjct: 125 KGSQPLREFMLRQTRETDLALYARLAN----QPPLAGPEAVPMRILLPAYVTSELKTAFQ 180

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGF + +PFLIID++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 181 IGFTVFIPFLIIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSF 239


>gi|121586791|ref|ZP_01676573.1| flagellar biosynthetic protein FliP [Vibrio cholerae 2740-80]
 gi|121548958|gb|EAX58997.1| flagellar biosynthetic protein FliP [Vibrio cholerae 2740-80]
          Length = 299

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 140/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 92  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 148

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF++M+P  ++  E  +QP +N QIT   A     EP   FM   TR  DL  F++M
Sbjct: 149 LFLTFFIMAPVFNQINEQAVQPYLNEQITARQAFDLAQEPLKAFMLKQTRVNDLETFVEM 208

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + +      +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 209 SGA-----QVTAPEQVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 263

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 264 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 297


>gi|220932509|ref|YP_002509417.1| flagellar biosynthetic protein FliP [Halothermothrix orenii H 168]
 gi|219993819|gb|ACL70422.1| flagellar biosynthetic protein FliP [Halothermothrix orenii H 168]
          Length = 254

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/194 (48%), Positives = 133/194 (68%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP LL+MVT F R I+V  ++R  +    +PPN V+I LALF+T ++M+P      E  +
Sbjct: 64  APALLVMVTSFTRVIVVLGLIRQALATRRMPPNQVLIGLALFLTVFIMAPVWQDINEQAL 123

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QP +NN+IT   A  R  +P   FM   TREKDL+LF++M               I   +
Sbjct: 124 QPYLNNEITTQQAYDRGIKPIRDFMFKQTREKDLALFVNMTGIERPEN----RADIPTYV 179

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           LIP+F+ISEL+ +F+IGFLI LPFL+IDM+VA+I+M+MGM+MLPP  ISLPFK++ F+L+
Sbjct: 180 LIPAFVISELKTAFQIGFLIYLPFLMIDMVVASILMSMGMLMLPPIIISLPFKLLLFILV 239

Query: 232 DGWSLLVENLVKSF 245
           DGW L++E+LVK+F
Sbjct: 240 DGWYLVIESLVKTF 253


>gi|148546750|ref|YP_001266852.1| flagellar biosynthesis protein FliP [Pseudomonas putida F1]
 gi|148510808|gb|ABQ77668.1| flagellar biosynthetic protein FliP [Pseudomonas putida F1]
          Length = 251

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 134/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  +I++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  +
Sbjct: 52  IMTALSFIPAFVILMTSFTRIIIVFSILRQALGLQQTPSNQLLNGMALFLTMFIMAPVFE 111

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  Q+T   AI +   P   FM   TR+ DL LFM ++    + TDI   
Sbjct: 112 RVNQDALQPYLKEQMTAQQAIDKAQGPLKDFMLAQTRQSDLDLFMRLS----KRTDIAGP 167

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   IL+P+F+ SEL+ +F+IGF+I +PFLIIDM+VA+++MAMGMMML P  ISLPFK
Sbjct: 168 DQVPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDMVVASVLMAMGMMMLSPLIISLPFK 227

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 228 IMLFVLVDGWALIMGTLASSF 248


>gi|253998478|ref|YP_003050541.1| flagellar biosynthesis protein FliP [Methylovorus sp. SIP3-4]
 gi|253985157|gb|ACT50014.1| flagellar biosynthetic protein FliP [Methylovorus sp. SIP3-4]
          Length = 258

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 135/193 (69%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +L+M+T F R IIV S+LR  +G  + PPN V++ LALF+TF+VMSP +D+      Q
Sbjct: 69  PAVLLMMTGFTRIIIVLSLLRQALGTPTSPPNQVLVGLALFLTFFVMSPVMDKIYVEAYQ 128

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           PL  N+IT   A+++ A P   FM   TRE D++LFM ++    R+  +   +    R+L
Sbjct: 129 PLSENKITLQEALEKGAAPLKTFMLKQTREADIALFMRIS----RSDAVDGPEQTPLRVL 184

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+FM SEL+ +F+IGF I +PFLIIDM+VA+++M+MGMMM+ P  ++LPFK++ FVL+D
Sbjct: 185 VPAFMTSELKTAFQIGFAIFIPFLIIDMVVASVLMSMGMMMVSPAIVALPFKLMLFVLVD 244

Query: 233 GWSLLVENLVKSF 245
           GW L++ +L +SF
Sbjct: 245 GWQLVLGSLAESF 257


>gi|311086976|gb|ADP67056.1| putative bifunctional flagellar biosynthesis protein FliO/FliP
           [Buchnera aphidicola str. JF99 (Acyrthosiphon pisum)]
          Length = 379

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 143/217 (65%), Gaps = 8/217 (3%)

Query: 32  DLSISTWIV--RTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           D    TW V  +T    T L+  P  L+M+T F R +IVF +LR  +G    PPN +++ 
Sbjct: 166 DDGSQTWSVPVQTLVFLTSLTFLPAFLLMMTSFTRIVIVFGLLRNALGTPYAPPNQILLG 225

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+TF++MSPT ++  +    P    ++    AI + + P   FM N  R  DL LF 
Sbjct: 226 LALFLTFFIMSPTFEKIYKDAYVPFSQEKMNMEDAILKGSMPLKKFMLNQIRTPDLELFS 285

Query: 150 DMAH-SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMA 208
            +AH SS++N    KND I  RIL+PSF+ SEL+ +F+IGF I +PFLIID++VA+++MA
Sbjct: 286 KLAHISSYKN----KND-IPMRILLPSFITSELKTAFQIGFTIFIPFLIIDLVVASVLMA 340

Query: 209 MGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +GMMM+PP++ISLPFK++ FVL+DGW LL+ +L  SF
Sbjct: 341 LGMMMVPPSTISLPFKLMLFVLVDGWQLLITSLAHSF 377


>gi|219681460|ref|YP_002467845.1| flagellar biosynthetic protein FliP [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|257471135|ref|ZP_05635134.1| type III secretion system protein [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|219624303|gb|ACL30458.1| flagellar biosynthetic protein FliP [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
          Length = 379

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 143/217 (65%), Gaps = 8/217 (3%)

Query: 32  DLSISTWIV--RTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           D    TW V  +T    T L+  P  L+M+T F R +IVF +LR  +G    PPN +++ 
Sbjct: 166 DDGSQTWSVPVQTLVFLTSLTFLPAFLLMMTSFTRIVIVFGLLRNALGTPYAPPNQILLG 225

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+TF++MSPT ++  +    P    ++    AI + + P   FM N  R  DL LF 
Sbjct: 226 LALFLTFFIMSPTFEKIYKDAYVPFSQEKMNMEDAILKGSMPLKKFMLNQIRTPDLELFS 285

Query: 150 DMAH-SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMA 208
            +AH SS++N    KND I  RIL+PSF+ SEL+ +F+IGF I +PFLIID++VA+++MA
Sbjct: 286 KLAHISSYKN----KND-IPMRILLPSFITSELKTAFQIGFTIFIPFLIIDLVVASVLMA 340

Query: 209 MGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +GMMM+PP++ISLPFK++ FVL+DGW LL+ +L  SF
Sbjct: 341 LGMMMVPPSTISLPFKLMLFVLVDGWQLLITSLAHSF 377


>gi|219682016|ref|YP_002468400.1| flagellar biosynthetic protein FliP [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219621749|gb|ACL29905.1| flagellar biosynthetic protein FliP [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|311085824|gb|ADP65906.1| putative bifunctional flagellar biosynthesis protein FliO/FliP
           [Buchnera aphidicola str. LL01 (Acyrthosiphon pisum)]
 gi|311086397|gb|ADP66478.1| putative bifunctional flagellar biosynthesis protein FliO/FliP
           [Buchnera aphidicola str. TLW03 (Acyrthosiphon pisum)]
 gi|311087553|gb|ADP67632.1| putative bifunctional flagellar biosynthesis protein FliO/FliP
           [Buchnera aphidicola str. JF98 (Acyrthosiphon pisum)]
          Length = 379

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 143/217 (65%), Gaps = 8/217 (3%)

Query: 32  DLSISTWIV--RTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           D    TW V  +T    T L+  P  L+M+T F R +IVF +LR  +G    PPN +++ 
Sbjct: 166 DDGSQTWSVPVQTLVFLTSLTFLPAFLLMMTSFTRIVIVFGLLRNALGTPYAPPNQILLG 225

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+TF++MSPT ++  +    P    ++    AI + + P   FM N  R  DL LF 
Sbjct: 226 LALFLTFFIMSPTFEKIYKDAYVPFSQEKMNMEDAILKGSMPLKKFMLNQIRTPDLELFS 285

Query: 150 DMAH-SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMA 208
            +AH SS++N    KND I  RIL+PSF+ SEL+ +F+IGF I +PFLIID++VA+++MA
Sbjct: 286 KLAHISSYKN----KND-IPMRILLPSFITSELKTAFQIGFTIFIPFLIIDLVVASVLMA 340

Query: 209 MGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +GMMM+PP++ISLPFK++ FVL+DGW LL+ +L  SF
Sbjct: 341 LGMMMVPPSTISLPFKLMLFVLVDGWQLLITSLAHSF 377


>gi|74317628|ref|YP_315368.1| flagellar biosynthesis protein FliP [Thiobacillus denitrificans
           ATCC 25259]
 gi|74057123|gb|AAZ97563.1| flagellar transport protein FliP [Thiobacillus denitrificans ATCC
           25259]
          Length = 253

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 130/193 (67%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P  L+M+T F R IIV S+LR  +G  S PPN V+I LALF+T +VM PT D+      Q
Sbjct: 64  PAALLMMTSFTRIIIVLSLLRHALGTQSSPPNQVLIGLALFLTLFVMGPTFDKIYVEAYQ 123

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           PL  N+I    A+ + A P   FM   TRE DL+LF+ M+ S    T       I  R+L
Sbjct: 124 PLAENRIQMQEALDKGAVPLRAFMLKQTRESDLALFVKMSRSPAPKT----AADIPMRVL 179

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           IP+++ SEL+ +F+IGF + +PFLIIDM+VA+I+MAMGMMM+ P  ++LPFK+I FVL+D
Sbjct: 180 IPAYITSELKTAFQIGFAVFIPFLIIDMVVASILMAMGMMMVSPAIVALPFKIILFVLVD 239

Query: 233 GWSLLVENLVKSF 245
           GW+LL+ +L +SF
Sbjct: 240 GWNLLLGSLAQSF 252


>gi|237752332|ref|ZP_04582812.1| flagellar biosynthesis protein FliP [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375821|gb|EEO25912.1| flagellar biosynthesis protein FliP [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 249

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 99/216 (45%), Positives = 142/216 (65%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P DL  +  IV    I T+L +AP L++M T F R +IVFS LRT MG    PP  +++S
Sbjct: 40  PGDLVTTLNIVV---ILTLLVLAPSLILMATSFARILIVFSFLRTAMGTQQSPPTQLLVS 96

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
            AL +T ++M P      E GI+P +  +I    A  R ++PF  FM  NTR KDL+LF 
Sbjct: 97  FALILTMFIMEPVAKEGYEKGIKPYIAKEIPYDEAFLRASQPFKDFMIRNTRPKDLALFY 156

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            + +  +  T       +   I +P+F+ISE++ +F+IGFL+ LPFL+IDM++++I+MAM
Sbjct: 157 RIRNLENPQT----AQDVPLSIALPAFIISEMKTAFQIGFLLYLPFLVIDMVISSILMAM 212

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPPT ISLPFK++ F+L+DG++LL  NLV+SF
Sbjct: 213 GMMMLPPTMISLPFKILIFILVDGFNLLTMNLVQSF 248


>gi|327441040|dbj|BAK17405.1| flagellar biosynthesis pathway, component FliP [Solibacillus
           silvestris StLB046]
          Length = 221

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 136/194 (70%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP LLI++T F R +IV S  RT +    +PPN VII LALF+TF++M+PT  +  E  +
Sbjct: 32  APSLLILMTSFARIVIVLSFTRTALATNQMPPNQVIIGLALFLTFFIMAPTFQQVNEQAL 91

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QPL + +I    A  R   PF  FM  +TR+KDL LF++   + + ++     + I   +
Sbjct: 92  QPLFDEEINLEEAYDRATIPFKQFMAQHTRQKDLELFIEYNQAEYPDS----IEEIPMTL 147

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F +SE++ +F++GF+I +PFL+IDM+VA+ +M+MGMMMLPP  ISLPFK++ FVL+
Sbjct: 148 LVPAFALSEIKTAFQMGFMIFIPFLVIDMVVASTLMSMGMMMLPPVMISLPFKILLFVLV 207

Query: 232 DGWSLLVENLVKSF 245
           DGW L++++L++SF
Sbjct: 208 DGWYLVMKSLLQSF 221


>gi|15616704|ref|NP_239916.1| type III secretion system protein [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|12644517|sp|P57184|FLIP_BUCAI RecName: Full=Flagellar biosynthetic protein fliP
 gi|25403546|pir||B84939 flagellar biosynthetic protein fliP [imported] - Buchnera sp.
           (strain APS)
 gi|10038767|dbj|BAB12802.1| flagellar biosynthetic protein fliP [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
          Length = 379

 Score =  188 bits (478), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 143/217 (65%), Gaps = 8/217 (3%)

Query: 32  DLSISTWIV--RTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           D    TW V  +T    T L+  P  L+M+T F R +IVF +LR  +G    PPN +++ 
Sbjct: 166 DDGSQTWSVPVQTLVFLTSLTFLPAFLLMMTSFTRIVIVFGLLRNALGTPYAPPNQILLG 225

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+TF++MSPT ++  +    P    ++    AI + + P   FM N  R  DL LF 
Sbjct: 226 LALFLTFFIMSPTFEKIYKDAYVPFSQEKMNMEDAILKGSMPLKKFMLNQIRTPDLELFS 285

Query: 150 DMAH-SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMA 208
            +AH SS++N    KND I  RIL+PSF+ SEL+ +F+IGF I +PFLIID++VA+++MA
Sbjct: 286 KLAHISSYKN----KND-IPMRILLPSFITSELKTAFQIGFTIFIPFLIIDLVVASVLMA 340

Query: 209 MGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +GMMM+PP++ISLPFK++ FVL+DGW LL+ +L  SF
Sbjct: 341 LGMMMVPPSTISLPFKLMLFVLVDGWQLLITSLAHSF 377


>gi|288573013|ref|ZP_06391370.1| flagellar biosynthetic protein FliP [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288568754|gb|EFC90311.1| flagellar biosynthetic protein FliP [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 256

 Score =  188 bits (477), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 90/216 (41%), Positives = 148/216 (68%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D+S S  IV    + T+LS+AP +L+MVT F R ++V   +R  +G+   PPN VI++
Sbjct: 47  PQDVSTSLQIV---ALLTVLSVAPAILLMVTSFTRVLVVLGFVRNALGLQQTPPNQVIVT 103

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF++ ++M+PT D     G+ P M  +I    A++ V  P   FM + TRE++LSL +
Sbjct: 104 LALFLSLFIMAPTWDVMYSQGLSPYMEGRIGSMEALENVTTPLRRFMLSQTREEELSLMV 163

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            M+     ++     D I  ++L+P++M+SEL+ +F++G +I +PF+++DMI+++++M+M
Sbjct: 164 SMSGLERPSSA----DDIPNKVLLPAYMLSELKSAFQMGIVIYVPFIVVDMIISSVLMSM 219

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GM+MLPP  ISLPFKV+ FV+ DGW+L+V +L++SF
Sbjct: 220 GMIMLPPMMISLPFKVLLFVMADGWNLVVVSLIRSF 255


>gi|332531133|ref|ZP_08407047.1| flagellar biosynthesis protein FliP [Hylemonella gracilis ATCC
           19624]
 gi|332039418|gb|EGI75830.1| flagellar biosynthesis protein FliP [Hylemonella gracilis ATCC
           19624]
          Length = 267

 Score =  188 bits (477), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 135/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+M+T F R +IV S+LR  +G  S PPN VII L+LF+TF+VM
Sbjct: 64  IQTLLFFTALSFLPAVLLMMTGFTRIVIVLSLLRQALGTQSAPPNQVIIGLSLFLTFFVM 123

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PT DR      QP   N +T   A+ R   P   FM   TR+ DL+LF+ ++      T
Sbjct: 124 GPTFDRVYAEAYQPYTRNALTFEQAVDRAEVPVREFMSKQTRQSDLALFVRLSKLDAATT 183

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                ++   R+LIP+F+ SEL+ +F+ GFLI +PFL+IDM+VA+++M++GMMML P  +
Sbjct: 184 ----AENAPMRVLIPAFVTSELKTAFQFGFLIFIPFLVIDMVVASVLMSLGMMMLSPVLV 239

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL DGW+LL+ +L  SF
Sbjct: 240 ALPFKLMLFVLADGWNLLIGSLAASF 265


>gi|85058021|ref|YP_453723.1| flagellar biosynthesis protein FliP [Sodalis glossinidius str.
           'morsitans']
 gi|84778541|dbj|BAE73318.1| flagellar protein FliP [Sodalis glossinidius str. 'morsitans']
          Length = 256

 Score =  188 bits (477), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 138/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T L+  P  L++++ F R IIV SILR  +G  S PPN +++ LAL +TF+VM
Sbjct: 53  VQTLVLLTSLTFLPAALLLMSGFTRIIIVLSILRNALGTPSAPPNQILLGLALCLTFFVM 112

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD        P   +QI   TAI+R A+P   FM   TRE DLSL+  +     +  
Sbjct: 113 SPVLDSIYRDAYLPFSQDQIDMDTAIERAAQPLRQFMLTQTRETDLSLYARLG----KQA 168

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                + +  +IL+P+F+ SEL+ +F+IGF + +PFLIID+++A+++MA+GMMMLPPT++
Sbjct: 169 AFAGPEQVPMQILLPAFVTSELKTAFQIGFTLFIPFLIIDLVIASVLMALGMMMLPPTTV 228

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FV++DGW LL+ +L +SF
Sbjct: 229 SLPFKLMLFVMVDGWQLLLGSLAQSF 254


>gi|134300235|ref|YP_001113731.1| flagellar biosynthesis protein FliP [Desulfotomaculum reducens
           MI-1]
 gi|134052935|gb|ABO50906.1| flagellar biosynthetic protein FliP [Desulfotomaculum reducens
           MI-1]
          Length = 257

 Score =  188 bits (477), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 139/200 (69%), Gaps = 6/200 (3%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+LS+ P  L+M+T F R I+V S LR+ +G    PPN V+I LALF+T ++M+P     
Sbjct: 62  TLLSMVPAFLMMLTSFTRIIVVLSFLRSALGTQQTPPNQVLIGLALFLTIFIMNPVYQDI 121

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN-D 165
            +  IQP + NQ+T   A  + A+P   FM   TREKDL LF+++A       D  KN +
Sbjct: 122 NKNSIQPYLANQLTYEQATDQAAKPLRNFMVRQTREKDLGLFLNIAK-----MDKPKNAN 176

Query: 166 HIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKV 225
            +   +L+P+F+ISEL+ +F+IGF++ +PFL+IDM+VA+ +M+MGM MLPP  ++LPFK+
Sbjct: 177 EVPMSVLVPAFVISELKTAFQIGFILFVPFLVIDMVVASTLMSMGMFMLPPVMVALPFKL 236

Query: 226 IFFVLIDGWSLLVENLVKSF 245
           + FV++DGW L+V++LV+SF
Sbjct: 237 LLFVMVDGWYLVVKSLVESF 256


>gi|188589499|ref|YP_001920217.1| flagellar biosynthetic protein FliP [Clostridium botulinum E3 str.
           Alaska E43]
 gi|251778351|ref|ZP_04821271.1| flagellar biosynthetic protein FliP [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|188499780|gb|ACD52916.1| flagellar biosynthetic protein FliP [Clostridium botulinum E3 str.
           Alaska E43]
 gi|243082666|gb|EES48556.1| flagellar biosynthetic protein FliP [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 259

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 142/200 (71%), Gaps = 3/200 (1%)

Query: 46  FTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDR 105
           FTIL++ P ++IM+T F R +IVFS +++ MG+    PN ++  LALF+T ++MSP  + 
Sbjct: 62  FTILAVLPSIVIMLTSFTRIVIVFSFIKSAMGVQQAIPNQILTGLALFLTIFIMSPVYNE 121

Query: 106 SIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKND 165
                 QP +   IT+  AI+  ++P   FM   TREKDL LF+++ +      ++T+ +
Sbjct: 122 VNTKAFQPYIEQSITQEEAIEIGSKPIKDFMLKQTREKDLELFVEINNVDKE--ELTR-E 178

Query: 166 HIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKV 225
           +I +  LIP+F ISEL+ +F+IGFLI LPF++IDM+VA+++M+MGMMMLPP  +SLPFK+
Sbjct: 179 NIPFTTLIPAFAISELKTAFQIGFLIYLPFIVIDMVVASVLMSMGMMMLPPAMVSLPFKL 238

Query: 226 IFFVLIDGWSLLVENLVKSF 245
           + FV++DGW LLV++L+ SF
Sbjct: 239 LLFVMVDGWYLLVKSLIMSF 258


>gi|158320529|ref|YP_001513036.1| flagellar biosynthetic protein FliP [Alkaliphilus oremlandii
           OhILAs]
 gi|158140728|gb|ABW19040.1| flagellar biosynthetic protein FliP [Alkaliphilus oremlandii
           OhILAs]
          Length = 269

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 88/197 (44%), Positives = 141/197 (71%), Gaps = 8/197 (4%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIMVT F R IIV S LR  +     PP  V+I LALF+TF++M+P      +  +
Sbjct: 77  APAILIMVTSFTRIIIVLSFLRNALATQQTPPTQVLIGLALFLTFFIMAPVASEINQNAL 136

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN---DHIE 168
           QP +N +IT+  A++   +P   FM   TREKDL+LF++ +     N+++++N   + I+
Sbjct: 137 QPFLNQEITQQQAVEEAMDPLREFMFRQTREKDLALFIEAS-----NSEVSENFQVEDIK 191

Query: 169 YRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFF 228
              LIP+F+ISEL+ +F++GF++ +PF+++DM+VA+++M+MGMMMLPP  ISLPFK++ F
Sbjct: 192 TTTLIPAFIISELKTAFQMGFVLFIPFIVLDMVVASVLMSMGMMMLPPAMISLPFKLMLF 251

Query: 229 VLIDGWSLLVENLVKSF 245
           V++DGW++L+++L+ SF
Sbjct: 252 VMVDGWNVLIKSLLLSF 268


>gi|15596643|ref|NP_250137.1| flagellar biosynthesis protein FliP [Pseudomonas aeruginosa PAO1]
 gi|107100880|ref|ZP_01364798.1| hypothetical protein PaerPA_01001910 [Pseudomonas aeruginosa PACS2]
 gi|116049391|ref|YP_791806.1| flagellar biosynthesis protein FliP [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892681|ref|YP_002441550.1| flagellar biosynthesis protein FliP [Pseudomonas aeruginosa LESB58]
 gi|254234545|ref|ZP_04927868.1| flagellar biosynthetic protein FliP [Pseudomonas aeruginosa C3719]
 gi|254239796|ref|ZP_04933118.1| flagellar biosynthetic protein FliP [Pseudomonas aeruginosa 2192]
 gi|296390187|ref|ZP_06879662.1| flagellar biosynthesis protein FliP [Pseudomonas aeruginosa PAb1]
 gi|313106445|ref|ZP_07792676.1| flagellar biosynthetic protein FliP [Pseudomonas aeruginosa 39016]
 gi|12230927|sp|Q51468|FLIP_PSEAE RecName: Full=Flagellar biosynthetic protein fliP
 gi|9947397|gb|AAG04835.1|AE004574_6 flagellar biosynthetic protein FliP [Pseudomonas aeruginosa PAO1]
 gi|115584612|gb|ABJ10627.1| flagellar biosynthetic protein FliP [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166476|gb|EAZ51987.1| flagellar biosynthetic protein FliP [Pseudomonas aeruginosa C3719]
 gi|126193174|gb|EAZ57237.1| flagellar biosynthetic protein FliP [Pseudomonas aeruginosa 2192]
 gi|218772909|emb|CAW28721.1| flagellar biosynthetic protein FliP [Pseudomonas aeruginosa LESB58]
 gi|310879178|gb|EFQ37772.1| flagellar biosynthetic protein FliP [Pseudomonas aeruginosa 39016]
          Length = 255

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 134/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+ S P N V++ LALF+T +VM+P  D
Sbjct: 56  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQSTPSNQVLVGLALFLTMFVMAPVFD 115

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +     +QP +N QI    A+Q+   P   FM   TR  DL LF+ ++    + TDI   
Sbjct: 116 KINSQALQPYLNEQIPAQEALQKAEVPLKAFMLAQTRTSDLELFVRLS----KRTDIGSP 171

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           +     IL+P+F+ SEL+ +F+IGF+I +PFLIID++V++++MAMGMMML P  ISLPFK
Sbjct: 172 EATPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDLVVSSVLMAMGMMMLSPLIISLPFK 231

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 232 IMLFVLVDGWALIIGTLAGSF 252


>gi|197285499|ref|YP_002151371.1| flagellar biosynthetic protein [Proteus mirabilis HI4320]
 gi|194682986|emb|CAR43419.1| flagellar biosynthetic protein [Proteus mirabilis HI4320]
          Length = 256

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 101/248 (40%), Positives = 154/248 (62%), Gaps = 11/248 (4%)

Query: 3   RYCFFALFLVT---PELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLI 57
           R+  FA  L+    P   FA+     V++ P      +W   V+T    T L   P +L+
Sbjct: 13  RWPLFASVLILSLLPSHAFAQ--FPSVISHPLPGGGQSWSLPVQTLIFITALGFIPAVLL 70

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           M+T F R IIV  +LR  +G  S PPN V++ LALFMTF++M+P  D+  +    P   +
Sbjct: 71  MMTSFTRIIIVLGLLRNALGTPSAPPNQVVLGLALFMTFFIMAPVFDKIYQDAYLPFSED 130

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           +IT   A+   ++P   FM   TRE DL+LF  +A +    T     D +  RIL+P+++
Sbjct: 131 KITFEQALDNGSQPLRQFMMQQTRETDLALFARLADAPAFET----RDSVPMRILVPAYI 186

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
            SEL+ +F+IGF+I +PFLIID++VA+++MA+GMMM+PP ++SLPFK++ FVL+DGW L+
Sbjct: 187 TSELKTAFQIGFMIFIPFLIIDLVVASVLMALGMMMVPPATVSLPFKLMLFVLVDGWQLI 246

Query: 238 VENLVKSF 245
           + +L +SF
Sbjct: 247 LGSLAQSF 254


>gi|313200553|ref|YP_004039211.1| flagellar biosynthetic protein flip [Methylovorus sp. MP688]
 gi|312439869|gb|ADQ83975.1| flagellar biosynthetic protein FliP [Methylovorus sp. MP688]
          Length = 270

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 135/193 (69%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +L+M+T F R IIV S+LR  +G  + PPN V++ LALF+TF+VMSP +D+      Q
Sbjct: 81  PAVLLMMTGFTRIIIVLSLLRQALGTPTSPPNQVLVGLALFLTFFVMSPVMDKIYVEAYQ 140

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           PL  N+IT   A+++ A P   FM   TRE D++LFM ++    R+  +   +    R+L
Sbjct: 141 PLSENKITLQEALEKGAAPLKTFMLKQTREADIALFMRIS----RSDAVDGPEQTPLRVL 196

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+FM SEL+ +F+IGF I +PFLIIDM+VA+++M+MGMMM+ P  ++LPFK++ FVL+D
Sbjct: 197 VPAFMTSELKTAFQIGFAIFIPFLIIDMVVASVLMSMGMMMVSPAIVALPFKLMLFVLVD 256

Query: 233 GWSLLVENLVKSF 245
           GW L++ +L +SF
Sbjct: 257 GWQLVLGSLAESF 269


>gi|261407968|ref|YP_003244209.1| flagellar biosynthetic protein FliP [Paenibacillus sp. Y412MC10]
 gi|329929296|ref|ZP_08283049.1| flagellar biosynthetic protein FliP [Paenibacillus sp. HGF5]
 gi|261284431|gb|ACX66402.1| flagellar biosynthetic protein FliP [Paenibacillus sp. Y412MC10]
 gi|328936665|gb|EGG33108.1| flagellar biosynthetic protein FliP [Paenibacillus sp. HGF5]
          Length = 250

 Score =  187 bits (476), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 135/194 (69%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +L+++T F R +IV   +RT +G    PPN V+I LALF+T +VM+PTL    E+ +
Sbjct: 59  APAILVLMTSFTRIVIVLGFVRTSLGTQQTPPNQVLIGLALFLTLFVMAPTLSSMNEVAL 118

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QP +  +IT+  A+ +  +P   FM  +TREKDL LFM+   +    +     + I   +
Sbjct: 119 QPYLKGEITQAEALDKAQDPMKKFMFAHTREKDLLLFMNYTGAEKPES----YEDIPLTV 174

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F ISEL+  F++GF+I +PFL+ID++VA+++MAMGMMMLPP  ISLPFK++ FVL+
Sbjct: 175 LVPAFAISELKTGFQMGFMIFIPFLVIDIVVASVLMAMGMMMLPPVMISLPFKILLFVLV 234

Query: 232 DGWSLLVENLVKSF 245
           DGW L+V++++ SF
Sbjct: 235 DGWYLVVKSMLMSF 248


>gi|82702484|ref|YP_412050.1| flagellar biosynthesis protein FliP [Nitrosospira multiformis ATCC
           25196]
 gi|82410549|gb|ABB74658.1| flagellar biosynthetic protein FliP [Nitrosospira multiformis ATCC
           25196]
          Length = 262

 Score =  187 bits (476), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 134/193 (69%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +L+M+T F R IIV S+LR  +G  S PPN V++ LALF+TF+VMSP  D+  +   Q
Sbjct: 73  PAVLLMMTGFTRVIIVLSLLRQALGTQSSPPNQVLVGLALFLTFFVMSPVFDKIYQDAYQ 132

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P + N++T   A+++ A P   FM   TRE DL+LF+ ++     N      + +  R+L
Sbjct: 133 PYVENRMTMEQALEKGAVPLKAFMLKQTRETDLALFVKLSGRPQLNGP----EEVSLRVL 188

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+F+ SEL+ +F+IGF + +PFLIIDM+VA+++M+MGMMM+ P  ++LPFK++ FVL+D
Sbjct: 189 VPAFVTSELKTAFQIGFAVFIPFLIIDMVVASVLMSMGMMMVSPALVALPFKIMLFVLVD 248

Query: 233 GWSLLVENLVKSF 245
           GW +L+ +L +SF
Sbjct: 249 GWHMLIGSLAESF 261


>gi|167464152|ref|ZP_02329241.1| flagellar biosynthesis protein FliP [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 257

 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 87/194 (44%), Positives = 137/194 (70%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP  LI++T F R +IV   +RT +G   +PPN V++ LALF+T ++M+PTL    ++ +
Sbjct: 66  APAFLILMTSFTRIVIVLGFVRTSLGTQQMPPNQVLVGLALFLTLFIMAPTLGDINQVAV 125

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QP +  ++ +T A+++ AEP   FM ++TR KDL LF+D +++   N      +      
Sbjct: 126 QPYIKGELNQTQALEKAAEPIKKFMWSHTRPKDLQLFLDYSNAEKPNGP----EDTPIAA 181

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F ISEL+ +F++GF+I +PFL+IDMI+++ +MAMGMMMLPP  ISLPFK++ FVL+
Sbjct: 182 LVPAFAISELKTAFQMGFMIFIPFLVIDMIISSTLMAMGMMMLPPVMISLPFKILLFVLV 241

Query: 232 DGWSLLVENLVKSF 245
           DGW L+V++L+ S+
Sbjct: 242 DGWYLVVKSLLVSY 255


>gi|293395593|ref|ZP_06639876.1| flagellar biosynthetic protein FliP [Serratia odorifera DSM 4582]
 gi|291421912|gb|EFE95158.1| flagellar biosynthetic protein FliP [Serratia odorifera DSM 4582]
          Length = 259

 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 150/229 (65%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T  + T LS  P +L+M+T F R IIV  +LR  +
Sbjct: 33  AIAQLPGLISQPLAGGGQSWTLPVQTLVLLTSLSFLPAMLLMMTSFTRIIIVLGLLRNAL 92

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  + PPN V++ LALF+TF++M+P  D+  +    P   ++I+  TAI + A+P   FM
Sbjct: 93  GTPTAPPNQVMLGLALFLTFFIMAPVFDKVYQDAYLPFSQDKISMETAIDQGAQPLREFM 152

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+L+  +A+       +   + +  RIL+P+++ SEL+ +F+IGF + +PFL
Sbjct: 153 LRQTREADLALYARLANLP----PLAGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFL 208

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 209 IIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSF 257


>gi|90579937|ref|ZP_01235745.1| flagellar biosynthesis protein [Vibrio angustum S14]
 gi|90438822|gb|EAS64005.1| flagellar biosynthesis protein [Vibrio angustum S14]
          Length = 282

 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 137/206 (66%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T L   P ++I++T F R ++V SILR  MG+   P N VII +ALF+TF+VM
Sbjct: 80  LQILALMTALGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIALFLTFFVM 139

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP +D+     +QP +N QIT   A+ +  +P   FM   TR KDL  F++M+ S+  + 
Sbjct: 140 SPVIDKINANAVQPYINEQITAKEALAKAEDPMRQFMLKQTRVKDLETFVNMSGSTADDP 199

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                  +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+I+MAMGMMML P  +
Sbjct: 200 Q-----TVPLTVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASILMAMGMMMLSPMIV 254

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 255 SLPFKLMLFVLVDGWNLILSTLAGSF 280


>gi|85859180|ref|YP_461382.1| flagellar biosynthesis protein FliP [Syntrophus aciditrophicus SB]
 gi|85722271|gb|ABC77214.1| flagellar biosynthetic protein [Syntrophus aciditrophicus SB]
          Length = 262

 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 140/207 (67%), Gaps = 4/207 (1%)

Query: 39  IVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYV 98
           +++   I T+LS+ P +L+M+T F R +IV S+LR  MG   +P N +II L+LF+TF++
Sbjct: 59  VIQLLFILTVLSLTPAILLMLTSFTRIVIVLSLLRQAMGTQQMPSNQIIIGLSLFLTFFI 118

Query: 99  MSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRN 158
           MSP         ++P  + +I+   AI+R   P   FM   TREKD++LF+ ++      
Sbjct: 119 MSPVWQSVHSEALKPYYDEEISGEQAIERAVIPVKAFMLKQTREKDIALFLQISKGKRPE 178

Query: 159 TDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTS 218
               K   +   +L+P+F+ISEL+ +F+IGFL+ LPF IIDM+VA+++++MGMMMLPP  
Sbjct: 179 ----KPADLALSVLVPAFVISELKTAFQIGFLLFLPFFIIDMVVASVLLSMGMMMLPPIM 234

Query: 219 ISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +SLPFK++ FVL+DGW L++ +LV+SF
Sbjct: 235 MSLPFKLLLFVLVDGWYLIIGSLVQSF 261


>gi|188025878|ref|ZP_02997695.1| hypothetical protein PROSTU_02049 [Providencia stuartii ATCC 25827]
 gi|188020828|gb|EDU58868.1| hypothetical protein PROSTU_02049 [Providencia stuartii ATCC 25827]
          Length = 185

 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 89/186 (47%), Positives = 129/186 (69%), Gaps = 4/186 (2%)

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R IIV  +LR  +G  S PPN V++ LALF+TF+VMSP  D++     QP   ++I
Sbjct: 2   TSFTRIIIVLGLLRNALGTPSAPPNQVLLGLALFLTFFVMSPVADQAYREAYQPFSEDKI 61

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           +  TA++R   PF  FM   TRE DL+LF  +A       +I +   +  RIL+P+F+ S
Sbjct: 62  SLETALERGTAPFRTFMLGQTRESDLALFARIAKVG----EIQEAKDVPMRILVPAFITS 117

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F+IGF I +PFLIID++VA+++MA+GMMM+PP ++SLPFK++ FVL+DGW LL+ 
Sbjct: 118 ELKTAFQIGFTIFIPFLIIDLVVASVLMALGMMMVPPATVSLPFKLMLFVLVDGWQLLLG 177

Query: 240 NLVKSF 245
           +L +SF
Sbjct: 178 SLSQSF 183


>gi|322382378|ref|ZP_08056285.1| flagellar biosynthesis protein FliP [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321153731|gb|EFX46106.1| flagellar biosynthesis protein FliP [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 255

 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 87/194 (44%), Positives = 137/194 (70%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP  LI++T F R +IV   +RT +G   +PPN V++ LALF+T ++M+PTL    ++ +
Sbjct: 64  APAFLILMTSFTRIVIVLGFVRTSLGTQQMPPNQVLVGLALFLTLFIMAPTLGDINQVAV 123

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QP +  ++ +T A+++ AEP   FM ++TR KDL LF+D +++   N      +      
Sbjct: 124 QPYIKGELNQTQALEKAAEPIKKFMWSHTRPKDLQLFLDYSNAEKPNGP----EDTPIAA 179

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F ISEL+ +F++GF+I +PFL+IDMI+++ +MAMGMMMLPP  ISLPFK++ FVL+
Sbjct: 180 LVPAFAISELKTAFQMGFMIFIPFLVIDMIISSTLMAMGMMMLPPVMISLPFKILLFVLV 239

Query: 232 DGWSLLVENLVKSF 245
           DGW L+V++L+ S+
Sbjct: 240 DGWYLVVKSLLVSY 253


>gi|308068668|ref|YP_003870273.1| flagellar biosynthetic protein fliP [Paenibacillus polymyxa E681]
 gi|310641559|ref|YP_003946317.1| flagellar transport protein flip [Paenibacillus polymyxa SC2]
 gi|305857947|gb|ADM69735.1| Flagellar biosynthetic protein fliP [Paenibacillus polymyxa E681]
 gi|309246509|gb|ADO56076.1| Flagellar transport protein FliP [Paenibacillus polymyxa SC2]
          Length = 251

 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 141/202 (69%), Gaps = 6/202 (2%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T++S+AP LL+++T F R +IV   +RT +G   +PPN V++ LALF+T ++M+PT  
Sbjct: 53  LITVISVAPALLVLMTSFTRIVIVLGFVRTSLGTQQMPPNQVLVGLALFLTLFIMAPTFS 112

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
              E  +QP +   IT++ A+ + + P   FM ++TREKDL LFM      +   +  KN
Sbjct: 113 AMNETALQPYLKGDITQSQALDKASVPIKTFMFSHTREKDLLLFMK-----YTKMEKPKN 167

Query: 165 -DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPF 223
              I   +++P++ ISEL+ +F++GF+I +PFL+ID++V++ +MAMGMMMLPP  ISLPF
Sbjct: 168 YQDIPLTVMVPAYAISELKTAFQMGFMIFIPFLVIDIVVSSTLMAMGMMMLPPVMISLPF 227

Query: 224 KVIFFVLIDGWSLLVENLVKSF 245
           K++ FVL+DGW L+V++L+ SF
Sbjct: 228 KILLFVLVDGWYLVVKSLLLSF 249


>gi|20807873|ref|NP_623044.1| flagellar biosynthesis protein FliP [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516437|gb|AAM24648.1| Flagellar biosynthesis/type III secretory pathway protein
           [Thermoanaerobacter tengcongensis MB4]
          Length = 221

 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 101/225 (44%), Positives = 153/225 (68%), Gaps = 8/225 (3%)

Query: 21  SSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGS 80
           S+L   +  P++LS S  IV      T+L++AP +LIM+T F R +IV + LR  +G+  
Sbjct: 4   SNLVSSVTSPSNLSTSLQIVLLL---TVLTLAPSILIMMTSFTRIVIVLAFLRNALGLQQ 60

Query: 81  VPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNT 140
           +PPN V+I LALF+TFY+M+P         I+P +  QI +  A QR  +P   FM   T
Sbjct: 61  MPPNQVLIGLALFLTFYIMAPVGYDINNNAIKPYVEGQINQYEAYQRAIKPLKNFMLRQT 120

Query: 141 REKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDM 200
           R+ DL+LF+++A        + K + +  R++IP+F+ISEL+ +FEIGF+I +PFL+ID+
Sbjct: 121 RQNDLALFVNLAK-----IKVDKVEDLPMRVVIPAFIISELKTAFEIGFIIYIPFLVIDI 175

Query: 201 IVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IVA+++M+MGM MLPP  ISLPFKV+ F+L+DGW+L+V++L+  F
Sbjct: 176 IVASVLMSMGMFMLPPVLISLPFKVLLFILVDGWNLVVKSLILGF 220


>gi|89075523|ref|ZP_01161934.1| flagellar biosynthesis protein [Photobacterium sp. SKA34]
 gi|89048795|gb|EAR54366.1| flagellar biosynthesis protein [Photobacterium sp. SKA34]
          Length = 282

 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 137/206 (66%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T L   P ++I++T F R ++V SILR  MG+   P N VII +ALF+TF+VM
Sbjct: 80  LQILALMTALGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIALFLTFFVM 139

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP +D+     +QP +N QIT   A+ +  +P   FM   TR KDL  F++M+ S+  + 
Sbjct: 140 SPVIDKINADAVQPYINEQITAKEALAKAEDPMRQFMLKQTRVKDLETFVNMSGSTADDP 199

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                  +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+I+MAMGMMML P  +
Sbjct: 200 QT-----VPLTVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASILMAMGMMMLSPMIV 254

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 255 SLPFKLMLFVLVDGWNLILSTLAGSF 280


>gi|221640808|ref|YP_002527070.1| flagellar biosynthesis protein FliP [Rhodobacter sphaeroides KD131]
 gi|221161589|gb|ACM02569.1| Type III secretion system inner membrane P protein [Rhodobacter
           sphaeroides KD131]
          Length = 238

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 137/212 (64%), Gaps = 5/212 (2%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S++T  V+   + T+LS+ P L +M+TCFP  + V SILR  +G+   PPN++I+SLALF
Sbjct: 31  SLATRSVQLIAVITLLSLVPALAMMITCFPFIVTVLSILRQAIGLQQAPPNMLIVSLALF 90

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T+YVM P    +   GI PL  N++    A+   A PF  FM        L+     A 
Sbjct: 91  LTWYVMDPVFTEAWTKGIAPLTRNELDLPQALAAAAIPFRSFMAGRIDPDTLA-----AL 145

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            + R         + + +L+PSF++SE++R+FEIGFLI LPFLIID++V+ ++M+MGMMM
Sbjct: 146 QALRPGPAAPPSEVSFSVLVPSFLLSEIQRAFEIGFLIYLPFLIIDLVVSAVLMSMGMMM 205

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +PP  +S+PFK+ FFV+ DGWSL+   LV+S+
Sbjct: 206 VPPAVVSMPFKLAFFVVADGWSLISGALVRSY 237


>gi|315648123|ref|ZP_07901224.1| flagellar biosynthetic protein FliP [Paenibacillus vortex V453]
 gi|315276769|gb|EFU40112.1| flagellar biosynthetic protein FliP [Paenibacillus vortex V453]
          Length = 250

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 137/194 (70%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +L+++T F R +IV   +RT +G    PPN V+I LALF+T +VM+PTL    ++ +
Sbjct: 59  APAILVLMTSFTRIVIVLGFVRTSLGTMQTPPNQVLIGLALFLTLFVMAPTLSSINDVAL 118

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QP +  +I++T A+ +  +P   FM ++TREKDL LFM+   +    T     + I   +
Sbjct: 119 QPYLKGEISQTEALDKAQDPMKKFMFSHTREKDLLLFMNYTGAEKPET----YEDIPLTV 174

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F ISEL+  F++GF+I +PFL+ID++VA+++MAMGMMMLPP  ISLPFK++ FVL+
Sbjct: 175 LVPAFAISELKTGFQMGFMIFIPFLVIDIVVASVLMAMGMMMLPPVMISLPFKILLFVLV 234

Query: 232 DGWSLLVENLVKSF 245
           DGW L+V++++ SF
Sbjct: 235 DGWYLVVKSMLMSF 248


>gi|227355990|ref|ZP_03840382.1| flagellar biosynthetic protein [Proteus mirabilis ATCC 29906]
 gi|227163978|gb|EEI48880.1| flagellar biosynthetic protein [Proteus mirabilis ATCC 29906]
          Length = 256

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 101/248 (40%), Positives = 153/248 (61%), Gaps = 11/248 (4%)

Query: 3   RYCFFALFLVT---PELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLI 57
           R+  FA  L+    P   FA+     V++ P       W   V+T    T L   P +L+
Sbjct: 13  RWPLFASVLILSLLPSHAFAQ--FPSVISHPLPGGGQNWSLPVQTLIFITALGFIPAVLL 70

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           M+T F R IIV  +LR  +G  S PPN V++ LALFMTF++M+P  D+  +    P   +
Sbjct: 71  MMTSFTRIIIVLGLLRNALGTPSAPPNQVVLGLALFMTFFIMAPVFDKIYQDAYLPFSED 130

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           +IT   A+   ++P   FM   TRE DL+LF  +A +    T     D +  RIL+P+++
Sbjct: 131 KITFEQALDNGSQPLRQFMMQQTRETDLALFARLADAPAFET----RDSVPMRILVPAYI 186

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
            SEL+ +F+IGF+I +PFLIID++VA+++MA+GMMM+PP ++SLPFK++ FVL+DGW L+
Sbjct: 187 TSELKTAFQIGFMIFIPFLIIDLVVASVLMALGMMMVPPATVSLPFKLMLFVLVDGWQLI 246

Query: 238 VENLVKSF 245
           + +L +SF
Sbjct: 247 LGSLAQSF 254


>gi|148976423|ref|ZP_01813129.1| flagellar biosynthesis protein P [Vibrionales bacterium SWAT-3]
 gi|145964246|gb|EDK29502.1| flagellar biosynthesis protein P [Vibrionales bacterium SWAT-3]
          Length = 309

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 143/218 (65%), Gaps = 8/218 (3%)

Query: 28  NIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVI 87
           N   D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VI
Sbjct: 98  NGGEDYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVI 154

Query: 88  ISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSL 147
           I +A+F+TF++MSP +++  E  +QP +N QIT   A      P   FM   TR KDL  
Sbjct: 155 IGIAIFLTFFIMSPVINQVNEQAVQPYLNEQITARQAFDVAQGPIKSFMLKQTRIKDLET 214

Query: 148 FMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVM 207
           F++++ S     ++T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++M
Sbjct: 215 FVEISGS-----EVTNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLM 269

Query: 208 AMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           AMGMMML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 270 AMGMMMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 307


>gi|256830495|ref|YP_003159223.1| flagellar biosynthetic protein FliP [Desulfomicrobium baculatum DSM
           4028]
 gi|256579671|gb|ACU90807.1| flagellar biosynthetic protein FliP [Desulfomicrobium baculatum DSM
           4028]
          Length = 231

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 139/217 (64%), Gaps = 4/217 (1%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           PA+       +    + T+LS+AP  ++ VT F R IIVF  LR  MG   +PPN V+ S
Sbjct: 19  PAEPQKVAVALEIMALLTMLSMAPAFVLTVTSFTRIIIVFHFLRQAMGTQQMPPNQVLAS 78

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LA+FMT  +M PT     +  +QP +N +I    A++R   P   F+  +TREKDLS+F 
Sbjct: 79  LAIFMTVVIMMPTGRTINDTALQPYLNEEIGYGEALERAETPLRTFLFKHTREKDLSVFF 138

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            +             D +   IL+P+++ISEL+  F+IGFLI +PFLI+DM+VA+I+++M
Sbjct: 139 SITGLERPQ----NKDEVPTMILVPAYLISELKTGFQIGFLIYIPFLILDMVVASILLSM 194

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           GMMMLPP  +SLPFK++ FV++DGW+L++ +LV SF+
Sbjct: 195 GMMMLPPVMVSLPFKILLFVMVDGWNLIIGSLVNSFV 231


>gi|120554901|ref|YP_959252.1| flagellar biosynthesis protein FliP [Marinobacter aquaeolei VT8]
 gi|120324750|gb|ABM19065.1| flagellar biosynthetic protein FliP [Marinobacter aquaeolei VT8]
          Length = 253

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/206 (42%), Positives = 143/206 (69%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T L+  P +L+M+T F R I+VF+ILR  +G+ + P N +++ LALF++ ++M
Sbjct: 51  LQILALMTALTFLPAMLMMMTSFTRIIVVFAILRQALGLQATPSNQILLGLALFLSIFIM 110

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            P L+ +  +G+QP +  ++T   A++  ++PF  FM   TRE DL+LFM +A   +   
Sbjct: 111 KPVLEEANRVGLQPYLQEEVTSLEAVELASQPFRKFMLEQTREDDLALFMRIADVQYE-- 168

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
             T  D + + IL+P+F+ SEL+ +F+IGF++ +PFLIIDM+VA+++MAMGMMML P  I
Sbjct: 169 --TPQD-VSFWILMPAFVTSELKTAFQIGFILFIPFLIIDMVVASVLMAMGMMMLSPIII 225

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++  L  S+
Sbjct: 226 SLPFKIMLFVLVDGWALIMGTLAASY 251


>gi|163738043|ref|ZP_02145459.1| flagellar biosynthetic protein FliP [Phaeobacter gallaeciensis
           BS107]
 gi|163742561|ref|ZP_02149947.1| flagellar biosynthetic protein FliP [Phaeobacter gallaeciensis
           2.10]
 gi|161384146|gb|EDQ08529.1| flagellar biosynthetic protein FliP [Phaeobacter gallaeciensis
           2.10]
 gi|161388659|gb|EDQ13012.1| flagellar biosynthetic protein FliP [Phaeobacter gallaeciensis
           BS107]
          Length = 247

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/212 (43%), Positives = 136/212 (64%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           SIS   ++   + T+LS+AP LLIM+TCFP  + V SILR  +G+   PPN+++ISLALF
Sbjct: 37  SISARSIQLILLITVLSLAPGLLIMITCFPFLVTVLSILRQAIGLQQAPPNMLMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T++VM P    +   GI PL+  Q+   T ++R  +PF VFM       D   F  +A 
Sbjct: 97  LTYFVMEPVFTEAWTTGINPLIEEQLDVETGLERALQPFRVFMAARL---DPDTFYAIAD 153

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                  I          L+ SFM+SE+ R+F++GFL+ LPFL+ID++VA ++M+MGMMM
Sbjct: 154 LRPSTAGIDPTADAPLSTLVSSFMLSEIARAFQVGFLVFLPFLVIDLVVAAVLMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +PP  +S+PFK+ FFV+ DGWSL+   LV+S+
Sbjct: 214 VPPAVVSMPFKLAFFVVADGWSLIASALVRSY 245


>gi|332799191|ref|YP_004460690.1| flagellar biosynthetic protein FliP [Tepidanaerobacter sp. Re1]
 gi|332696926|gb|AEE91383.1| flagellar biosynthetic protein FliP [Tepidanaerobacter sp. Re1]
          Length = 258

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 139/201 (69%), Gaps = 3/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TILS+AP +L ++T F R IIV S +R G+G+  VPP  V+I LALF+T +VM+P   
Sbjct: 60  LLTILSLAPSILTLLTSFTRTIIVLSFVRNGLGVQQVPPTQVLIGLALFITVFVMAPVWT 119

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
                 IQP MN +I  + A++R   P   FM   TREKDL+LF+   H +   T +   
Sbjct: 120 EINSEAIQPYMNQEIDTSEALRRSQIPLRNFMFRQTREKDLALFV---HYAKLETPLNTL 176

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D I   +LIPSF+ISEL+ +F++GF+I +PFL+IDMIV++ +M+MGM+MLPP  ISLPFK
Sbjct: 177 DDIPTYVLIPSFIISELKTAFQMGFIIFIPFLVIDMIVSSTLMSMGMLMLPPIMISLPFK 236

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FV++DGW+L++ +++  F
Sbjct: 237 ILLFVMVDGWNLVINSILAGF 257


>gi|90411033|ref|ZP_01219047.1| flagellar biosynthesis protein [Photobacterium profundum 3TCK]
 gi|90328246|gb|EAS44557.1| flagellar biosynthesis protein [Photobacterium profundum 3TCK]
          Length = 284

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/214 (44%), Positives = 141/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+   G+ T L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 77  DYSVTLQIL---GLMTALGFLPAIVILMTSFTRIVVVLSILRQAMGLQQTPSNQVIIGIA 133

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LFMTF+VMSP +D+     +QP +N +IT   A +    P   FM   TR KDL  F++M
Sbjct: 134 LFMTFFVMSPVIDKVNIDAVQPYINEEITAAQAFETAQVPLRQFMLKQTRVKDLESFVNM 193

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + S+      T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 194 SGSTA-----TAPEDVPITVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 248

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 249 MMLSPMIVSLPFKLMLFVLVDGWNLILTTLAGSF 282


>gi|269961630|ref|ZP_06175992.1| Flagellar biosynthetic protein fliP [Vibrio harveyi 1DA3]
 gi|269833671|gb|EEZ87768.1| Flagellar biosynthetic protein fliP [Vibrio harveyi 1DA3]
          Length = 289

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/214 (42%), Positives = 140/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 82  DYSVTLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 138

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF++MSP L+   +  +QP +N Q+T   A      P   FM   TR KDL  F++M
Sbjct: 139 LFLTFFIMSPVLNEINDQAVQPYLNEQVTAREAFDAAQAPMKAFMLKQTRIKDLETFVNM 198

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +       ++T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 199 SGE-----EVTNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 253

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 254 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 287


>gi|319944172|ref|ZP_08018448.1| flagellar biosynthetic protein FliP [Lautropia mirabilis ATCC
           51599]
 gi|319742467|gb|EFV94878.1| flagellar biosynthetic protein FliP [Lautropia mirabilis ATCC
           51599]
          Length = 245

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 98/240 (40%), Positives = 153/240 (63%), Gaps = 3/240 (1%)

Query: 8   ALFLVTPELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIMVTCFPRF 65
           AL    P  V+A+++L       AD   +TW V  +T   F+ LS  P +L+++T F R 
Sbjct: 5   ALLAGAPLDVWAQATLSLQSTAAAD-GGTTWSVPVQTLLFFSALSFIPAVLLLMTSFTRI 63

Query: 66  IIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAI 125
           IIV S+LR  +G+ + PPN V++ ++LF+T ++MSPTLDR      QPL   +I   TA+
Sbjct: 64  IIVLSLLRQALGLQASPPNQVLVGISLFLTAFIMSPTLDRIYTEAYQPLAEKRIDFETAL 123

Query: 126 QRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSF 185
           Q+ + P   FM   TR  DL LF  +A     +        + ++ ++P+F+ISEL+ +F
Sbjct: 124 QKGSVPLRDFMLKQTRASDLELFARLARVKAPDDKPLSAQDMPFKAIVPAFVISELKTAF 183

Query: 186 EIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +IGF+I +PF++ID+I A+++M++GMMM+ P  ++LPFK++ FVL DGW+LLV +LV SF
Sbjct: 184 QIGFMIFIPFILIDLICASVLMSLGMMMVSPVLVALPFKLVLFVLADGWNLLVGSLVASF 243


>gi|260772332|ref|ZP_05881248.1| flagellar biosynthesis protein FliP [Vibrio metschnikovii CIP
           69.14]
 gi|260611471|gb|EEX36674.1| flagellar biosynthesis protein FliP [Vibrio metschnikovii CIP
           69.14]
          Length = 299

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 143/214 (66%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 92  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 148

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           +F+TF++MSP L++  +  +QP +N QI+   A     +P   FM   TR KDL  F+++
Sbjct: 149 IFLTFFIMSPVLNQINDQAVQPYLNEQISARQAFDLAQDPMKSFMLKQTRLKDLETFVNI 208

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           A S+ +N +      +   ILIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 209 AGSNAQNPE-----DVSMAILIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 263

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 264 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 297


>gi|311695203|gb|ADP98076.1| flagellar biosynthesis protein FliP [marine bacterium HP15]
          Length = 258

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/206 (42%), Positives = 143/206 (69%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T L+  P +L+M+T F R I+VF+ILR  +G+ S P N +++ LALF++ ++M
Sbjct: 56  LQILALMTALTFLPAMLMMMTSFTRIIVVFAILRQAIGLQSTPSNQILLGLALFLSIFIM 115

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            P L+ +  + +QP M  ++T   A++  ++PF  FM   TRE DL+LFM ++ + +   
Sbjct: 116 KPVLEEANRVALQPYMQEEVTSLEAVELASQPFRKFMLEQTRESDLALFMRISDTQYE-- 173

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
             T  D + + IL+P+F+ SEL+ +F+IGF++ +PFLIIDM+VA+++MAMGMMML P  I
Sbjct: 174 --TPQD-VSFWILMPAFVTSELKTAFQIGFILFIPFLIIDMVVASVLMAMGMMMLSPIII 230

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++  L  S+
Sbjct: 231 SLPFKIMLFVLVDGWALIMGTLAASY 256


>gi|308273529|emb|CBX30131.1| Flagellar biosynthetic protein fliP [uncultured Desulfobacterium
           sp.]
          Length = 225

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 146/217 (67%), Gaps = 7/217 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P  +S+   +++   + T+LS+AP +LIM+T F R  IVFS LR  +G    P N +I  
Sbjct: 16  PEQVSV---LIQILFLLTVLSLAPAILIMMTPFTRLAIVFSFLRQALGTQQTPSNQIIAG 72

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TF++M P         +QP +  +I++ TA++    P   FM   TREKDL++F+
Sbjct: 73  LSLFITFFIMMPQWQEINNNALQPYLEKKISQETALKEAMIPIRKFMFRQTREKDLAIFV 132

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            M+ S   N+     + I    LIP+F+ISEL+ +F IGF++ +PFLIIDM+VA+++++M
Sbjct: 133 KMSKSEKPNSP----EDISMTTLIPAFVISELKTAFIIGFVLFVPFLIIDMVVASVLLSM 188

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           GMMMLPP  ISLPFK++ FVL+DGW+L+V ++VKSF+
Sbjct: 189 GMMMLPPILISLPFKLMLFVLVDGWNLIVGSMVKSFV 225


>gi|34558376|ref|NP_908191.1| flagellar biosynthesis protein FliP [Wolinella succinogenes DSM
           1740]
 gi|34484095|emb|CAE11091.1| FLAGELLAR BIOSYNTHESIS PROTEIN [Wolinella succinogenes]
          Length = 247

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 137/194 (70%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP L++++T F R IIVFS LRT MG    PP  +++SLA+ +TF++M P   +S E+GI
Sbjct: 57  APSLVLVMTSFTRLIIVFSFLRTAMGTQQSPPTQLLVSLAMVLTFFIMEPIAKQSYEIGI 116

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           +P +  +I    A  +   PF  FM  NTREKDL+LF  +    +  T     + I   +
Sbjct: 117 KPYLAKEIPYDVAFVKSVGPFKEFMIRNTREKDLALFYRIRGMENPQTI----EDIPLTM 172

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           +IP+FMISE++ +F+IGFLI LPFL+IDM++++I+MAMGMMMLPP  ISLPFK++ FVL+
Sbjct: 173 VIPAFMISEMKTAFQIGFLIYLPFLVIDMVISSILMAMGMMMLPPVMISLPFKILVFVLV 232

Query: 232 DGWSLLVENLVKSF 245
           DG++LLV +LV+SF
Sbjct: 233 DGFNLLVGSLVESF 246


>gi|163801855|ref|ZP_02195752.1| flagellar biosynthesis protein P [Vibrio sp. AND4]
 gi|159174363|gb|EDP59167.1| flagellar biosynthesis protein P [Vibrio sp. AND4]
          Length = 289

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 139/214 (64%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 82  DYSVTLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 138

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VMSP L+   +  IQP +N Q+T   A      P   FM   TR KDL  F+DM
Sbjct: 139 LFLTFFVMSPVLNEINDNAIQPYLNEQLTARQAFDTAQVPMKAFMLKQTRIKDLETFVDM 198

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +        +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 199 SGE-----QVTNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 253

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 254 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 287


>gi|297584051|ref|YP_003699831.1| flagellar biosynthetic protein FliP [Bacillus selenitireducens
           MLS10]
 gi|297142508|gb|ADH99265.1| flagellar biosynthetic protein FliP [Bacillus selenitireducens
           MLS10]
          Length = 226

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 132/194 (68%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LI++T F R +IV S +R G+    +PPN VII LALF+TF+VM+PT     E  +
Sbjct: 37  APAILILMTSFTRIVIVLSFVRNGLATQQMPPNQVIIGLALFLTFFVMAPTFSEVNEAAL 96

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QPL +  I++  A      P   FM  +TRE+DL+LFM  A      +     + I    
Sbjct: 97  QPLFDGDISQEEAFDEATIPMKEFMAQHTRERDLALFMGYAGQERPES----LEDIPLTS 152

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F+ISEL+ +F+IGF+I +PFL+IDM+VA+++M+MGMMMLPP  I+LPFKV+ FVL+
Sbjct: 153 LVPAFVISELKTAFQIGFMIFVPFLVIDMVVASVLMSMGMMMLPPVMIALPFKVLLFVLV 212

Query: 232 DGWSLLVENLVKSF 245
           DGW L+V +L+ +F
Sbjct: 213 DGWHLVVRSLLYTF 226


>gi|330828809|ref|YP_004391761.1| flagellar biosynthetic protein FliP [Aeromonas veronii B565]
 gi|328803945|gb|AEB49144.1| Flagellar biosynthetic protein FliP [Aeromonas veronii B565]
          Length = 257

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 138/206 (66%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T LS  P ++IM+T F R I+V  ILR  +G+   P N V+I +ALFM+F++M
Sbjct: 52  LQVLALMTALSFLPAMVIMMTSFTRIIVVLGILRQAIGLQQSPSNQVLIGIALFMSFFIM 111

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR  +  +QP +   I    A++R   P   FM   TR KDL+ FM++A     N 
Sbjct: 112 SPVLDRINDEALQPYLAETIQAKEALERAELPIHQFMLAQTRIKDLNTFMEIA-----NV 166

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            + K   +  R+LIP+F+ SEL+ +F+IGF++ LPFL+ID++VA+I+MAMGMMML P  +
Sbjct: 167 QVEKPADVPLRVLIPAFVTSELKTAFQIGFMLFLPFLVIDLVVASILMAMGMMMLSPMIV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FV++DGW+L++ +L  SF
Sbjct: 227 SLPFKLMLFVMVDGWNLILGSLANSF 252


>gi|329901241|ref|ZP_08272766.1| Flagellar biosynthesis protein fliP [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549173|gb|EGF33765.1| Flagellar biosynthesis protein fliP [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 251

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 131/193 (67%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P  L+M+T F R IIV S+LR  +G  S PPN V++ LALF+T +VM P  D+       
Sbjct: 62  PAALLMMTSFTRIIIVLSLLRQALGTQSAPPNQVMVGLALFLTLFVMGPVFDKIYADAYL 121

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           PL  N+I  T A++R A P   FM   TR+ DL+L++ M++S      +   D +  RIL
Sbjct: 122 PLQENKINMTQAMERGAAPLKAFMMKQTRQADLALYVKMSNSPA----LQGPDDVPLRIL 177

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+F+ SEL+ +F+I F I +PFLIIDM+VA+++M+MGMMM+ P+ +SLPFK++ FVL+D
Sbjct: 178 VPAFITSELKTAFQISFAIFIPFLIIDMVVASVLMSMGMMMVSPSIVSLPFKLMLFVLVD 237

Query: 233 GWSLLVENLVKSF 245
           GW LL+ +L +SF
Sbjct: 238 GWQLLIGSLAQSF 250


>gi|152997437|ref|YP_001342272.1| flagellar biosynthesis protein FliP [Marinomonas sp. MWYL1]
 gi|150838361|gb|ABR72337.1| flagellar biosynthetic protein FliP [Marinomonas sp. MWYL1]
          Length = 245

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 159/247 (64%), Gaps = 6/247 (2%)

Query: 1   MIRYCFFALFLVTPELVFAKSSLHDVMNIP-ADLSIS-TWIVRTFGIFTILSIAPILLIM 58
           MIR+    L LV P   +A+  L  V  +  AD S   T  ++   I T L++ P  L+M
Sbjct: 1   MIRFVSL-LLLVFPAFSWAEVGLPAVKVVTNADGSQDYTVSLQILFIMTALTLLPAALMM 59

Query: 59  VTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQ 118
           +T F R I+V +ILR  +G+   P N ++I +ALF+T ++M+PTLDR  E+ +QP +  +
Sbjct: 60  MTAFTRIIVVLAILRQAIGLQQTPSNQIMIGMALFLTLFIMTPTLDRVNEVALQPYLKEE 119

Query: 119 ITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMI 178
           +T   A++  + P   FM   TRE D++LF+ +A    +   I   + + + IL+P+F+ 
Sbjct: 120 MTSIQAVEAASVPVRDFMLAQTREDDIALFVKLAG---KEGTIQSMETLPFTILMPAFVT 176

Query: 179 SELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLV 238
           SEL+ +F+IGF+I +PFLI+DM+VA+++MAMGMMML P  ISLPFK++ FV++DGWS+++
Sbjct: 177 SELKTAFQIGFMIFIPFLIVDMVVASVLMAMGMMMLSPIIISLPFKIMLFVMVDGWSMIM 236

Query: 239 ENLVKSF 245
             L  SF
Sbjct: 237 GTLAASF 243


>gi|326319061|ref|YP_004236733.1| flagellar biosynthetic protein FliP [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323375897|gb|ADX48166.1| flagellar biosynthetic protein FliP [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 259

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/207 (45%), Positives = 135/207 (65%), Gaps = 4/207 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P LL+M+T F R +IV S++R  +G  S PPN VII L+LF+TF+VM
Sbjct: 56  IQTLLFFTALSFLPALLLMMTGFTRIVIVLSLIRQAIGTQSAPPNQVIIGLSLFLTFFVM 115

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PT DR       P  NN IT   A++R   P   FM   TR+ D +LF  +A      T
Sbjct: 116 GPTFDRVYADAYLPYSNNTITFEQAVERAEAPMRSFMLKQTRQSDFALFARLAKLPSGAT 175

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
             T       R+L+P+F+ SEL+ +F+IGF+I +PFL+IDM+V++I+M++GMMML P  +
Sbjct: 176 AETA----PMRVLVPAFVTSELKSAFQIGFMIFIPFLVIDMVVSSILMSLGMMMLSPVLV 231

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSFI 246
           +LPFK++ FVL DGW+LL+ +L  SF+
Sbjct: 232 ALPFKLMLFVLADGWNLLLGSLAASFV 258


>gi|90021817|ref|YP_527644.1| flagellar biosynthesis protein FliP [Saccharophagus degradans 2-40]
 gi|89951417|gb|ABD81432.1| flagellar biosynthetic protein FliP [Saccharophagus degradans 2-40]
          Length = 280

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 91/199 (45%), Positives = 135/199 (67%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T L+  P +LIM+T F R IIVFSILR  +G+   P N ++I L LF+TF++M+P +++ 
Sbjct: 84  TALTFLPAILIMMTAFTRIIIVFSILRQALGLQQSPSNQILIGLTLFLTFFIMTPVIEKV 143

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            +  +QP +  QIT   A++   +P   FM  NTRE DL LF  +A      T     + 
Sbjct: 144 NQNALQPYIAEQITAQQALEETKKPVRKFMLANTRESDLELFFRIASLEPVATP----EE 199

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           I + +L+PSF+ SEL+ +F+IGF++ +PFL+ID++VA+++MAMGMMML P  ISLPFK++
Sbjct: 200 IPFSVLVPSFITSELKTAFQIGFILFIPFLVIDIVVASVLMAMGMMMLSPLIISLPFKIM 259

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW+L++  L  SF
Sbjct: 260 LFVLVDGWALIIGTLAASF 278


>gi|187935306|ref|YP_001885056.1| flagellar biosynthetic protein FliP [Clostridium botulinum B str.
           Eklund 17B]
 gi|187723459|gb|ACD24680.1| flagellar biosynthetic protein FliP [Clostridium botulinum B str.
           Eklund 17B]
          Length = 259

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 140/200 (70%), Gaps = 3/200 (1%)

Query: 46  FTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDR 105
           FTIL++ P ++IM+T F R +IVFS +++ MG+    PN ++  LALF+T ++MSP  + 
Sbjct: 62  FTILAVLPSIVIMLTSFTRIVIVFSFIKSAMGVQQAIPNQILTGLALFLTIFIMSPVYNE 121

Query: 106 SIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKND 165
                 QP +   IT+  AI+  ++P   FM   TREKDL LF+++   ++ N +    +
Sbjct: 122 VNTKAFQPYVEQSITQEEAIEIGSKPIKDFMLKQTREKDLELFVEI---NNVNKEELTRE 178

Query: 166 HIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKV 225
            + +  LIP+F ISEL+ +F++GFLI LPF++IDM+VA+++M+MGMMMLPP  +SLPFK+
Sbjct: 179 SVPFTTLIPAFAISELKTAFQMGFLIYLPFIVIDMVVASVLMSMGMMMLPPAMVSLPFKL 238

Query: 226 IFFVLIDGWSLLVENLVKSF 245
           + FV++DGW LLV++L+ SF
Sbjct: 239 LLFVMVDGWYLLVKSLIMSF 258


>gi|146307834|ref|YP_001188299.1| flagellar biosynthesis protein FliP [Pseudomonas mendocina ymp]
 gi|145576035|gb|ABP85567.1| flagellar biosynthetic protein FliP [Pseudomonas mendocina ymp]
          Length = 261

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 135/201 (67%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N +++ LALF+T ++M+P  D
Sbjct: 62  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILVGLALFLTLFIMAPIFD 121

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R     +QP +N +I    A+ R   P   FM   TRE DL+LF+ ++    + TD+   
Sbjct: 122 RINTDALQPYLNEEIVAQEALTRAEGPIRDFMLAQTRESDLALFVRLS----KRTDLAGV 177

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           + +   IL+P+F+ SEL+ +F+IGF+I +PFLIIDM+VA+I+MAMGMMML P  ISLPFK
Sbjct: 178 EDVPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDMVVASILMAMGMMMLSPLIISLPFK 237

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 238 IMLFVLVDGWALIMGTLAASF 258


>gi|302670736|ref|YP_003830696.1| flagellar biosynthetic protein FliP [Butyrivibrio proteoclasticus
           B316]
 gi|302395209|gb|ADL34114.1| flagellar biosynthetic protein FliP [Butyrivibrio proteoclasticus
           B316]
          Length = 314

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/199 (46%), Positives = 136/199 (68%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T++S+AP LL+M+T F R I+     RT +G  + PPNLV++ +ALFMT ++M PTL   
Sbjct: 119 TLISLAPTLLVMMTSFTRIIVALHFTRTAIGTQTSPPNLVMLGIALFMTLFIMQPTLTTV 178

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
               + P  N ++ +    +   +PF  FM   T++KD+ LFM++           + D 
Sbjct: 179 YNEAVIPFENGEMDQQEFFEEAMDPFRQFMYGQTQKKDVILFMNIDGIEWDG----ELDS 234

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           I   +LIPSF++SELR +F IGF+I +PF++IDM+VA+++M+MGMMMLPPT+ISLPFK++
Sbjct: 235 IPNVVLIPSFIVSELRTAFIIGFMIYIPFIVIDMVVASVLMSMGMMMLPPTTISLPFKIL 294

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL DGWSL++ NLVKSF
Sbjct: 295 LFVLADGWSLIIGNLVKSF 313


>gi|34498582|ref|NP_902797.1| flagellar biosynthesis protein FliP [Chromobacterium violaceum ATCC
           12472]
 gi|34104436|gb|AAQ60794.1| probable flagellar biosynthetic protein fliP [Chromobacterium
           violaceum ATCC 12472]
          Length = 250

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 137/199 (68%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T L+  P +++M+T F R +IV S+LR  +G    PPN VI+ LALF+T +VM PT D+ 
Sbjct: 53  TALTFIPAMMLMMTAFTRIVIVLSLLRQALGTTQSPPNQVIVGLALFLTLFVMGPTFDQV 112

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
                 P  +++I+   A+   ++P   FM   TREKDL+ F++++ S    +     + 
Sbjct: 113 YAKAWVPFSDDKISFNQALDEGSKPMKAFMLRQTREKDLAFFIEISQSPKPQS----KEE 168

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           +  + LIP+F +SEL+ +F+IGF+I +PF+IID++VA+I+MAMGMMM+ P +ISLPFK++
Sbjct: 169 VSMKTLIPAFAVSELKTAFQIGFMIFIPFMIIDLVVASILMAMGMMMVSPVTISLPFKMM 228

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW+LL+ +LV+SF
Sbjct: 229 LFVLVDGWTLLMGSLVQSF 247


>gi|229591840|ref|YP_002873959.1| flagellar biosynthesis protein FliP [Pseudomonas fluorescens SBW25]
 gi|229363706|emb|CAY51090.1| flagellar biosynthesis [Pseudomonas fluorescens SBW25]
          Length = 247

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 133/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 48  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTLFIMAPVFD 107

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  +  +QP +  ++T   AI +   P   FM + TR  DL LFM ++    + TDI   
Sbjct: 108 KVNQQALQPYLAEKMTAQDAIDKAQGPIKDFMLSQTRSSDLELFMRLS----KRTDIATP 163

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ SEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 164 DQAPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFK 223

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 224 IMLFVLVDGWALIIGTLASSF 244


>gi|27904581|ref|NP_777707.1| putative bifunctional flagellar biosynthesis protein FliO/FliP
           [Buchnera aphidicola str. Bp (Baizongia pistaciae)]
 gi|46395829|sp|Q89AZ2|FLIP_BUCBP RecName: Full=Flagellar biosynthetic protein fliP
 gi|27903978|gb|AAO26812.1| flagellar biosynthetic protein FliP [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
          Length = 360

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 157/243 (64%), Gaps = 10/243 (4%)

Query: 5   CFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIMVTCF 62
           C F LF  +    +A + + DV++  +      W +  +T    T L+  P +L+M+T F
Sbjct: 124 CVFLLFCPS----YAYAGIPDVISHTSSDGGQIWSIPIQTLVFITSLTFIPTVLLMMTSF 179

Query: 63  PRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITET 122
            R +IVFS+LR+ +G    PPN +++ L+L +TF++M+P  D+  +    P   ++I+  
Sbjct: 180 SRIVIVFSLLRSALGTPYSPPNQILVGLSLILTFFIMAPIFDKIYQDSYLPFSEDKISID 239

Query: 123 TAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELR 182
           TAI R A+P   FM N TR+ DL  F  +A+ S      ++ + I  R+L+PSF+ SEL+
Sbjct: 240 TAIVRGAKPLHKFMVNQTRQVDLEFFSKLANIS----TFSRKEEIPMRVLLPSFITSELK 295

Query: 183 RSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLV 242
            +F+IGF I +PFLIID++V++++M++GMMM+PP++ISLPFK++ FVL+DGW LL+ +L 
Sbjct: 296 TAFQIGFTIFIPFLIIDLVVSSVLMSLGMMMVPPSTISLPFKLMLFVLVDGWQLLITSLT 355

Query: 243 KSF 245
            SF
Sbjct: 356 HSF 358


>gi|326204610|ref|ZP_08194466.1| flagellar biosynthetic protein FliP [Clostridium papyrosolvens DSM
           2782]
 gi|325985177|gb|EGD46017.1| flagellar biosynthetic protein FliP [Clostridium papyrosolvens DSM
           2782]
          Length = 243

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 135/204 (66%), Gaps = 5/204 (2%)

Query: 46  FTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDR 105
            T+LSIAP +LIM+T F R II+ S LR  +G   +PPN V+I LALF+T +VMSP L  
Sbjct: 39  LTVLSIAPSILIMMTGFTRIIIILSFLRNALGTQQMPPNQVLIGLALFITLFVMSPVLSD 98

Query: 106 SIEMGIQPLMNNQITETTAIQRVAEPF--WVFMR--NNTREKDLSLFMDMAHSSHRNTDI 161
             E   QP  N +IT+  AI + ++    W+  +  +N REKDL LFM +         +
Sbjct: 99  INENAFQPYTNGKITQQQAIDKSSQSIKTWMVKQIFSNKREKDLELFMTLG-GQKEPVKV 157

Query: 162 TKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISL 221
                +   ++ P+F+ISEL  +F+ GFLI LPFLIIDM+V++ +M+MGMMMLPP  ISL
Sbjct: 158 QDASKLSLTMVAPAFLISELTVAFKFGFLIFLPFLIIDMVVSSALMSMGMMMLPPIMISL 217

Query: 222 PFKVIFFVLIDGWSLLVENLVKSF 245
           PFK++ FVL+DGWS+L ++++ SF
Sbjct: 218 PFKILLFVLVDGWSMLTQSIITSF 241


>gi|291286235|ref|YP_003503051.1| flagellar biosynthetic protein FliP [Denitrovibrio acetiphilus DSM
           12809]
 gi|290883395|gb|ADD67095.1| flagellar biosynthetic protein FliP [Denitrovibrio acetiphilus DSM
           12809]
          Length = 243

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 95/218 (43%), Positives = 144/218 (66%), Gaps = 7/218 (3%)

Query: 28  NIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVI 87
           N P D++++  I+    + T +SIAP  L+++T F R +IVFS+LRT MG   +PPN V+
Sbjct: 32  NSPQDVAVTIQIML---LMTFISIAPGFLVLMTSFTRIVIVFSLLRTAMGTSQMPPNQVL 88

Query: 88  ISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSL 147
           +SLAL +TFY+M+P        G+ P     IT    +  V +P   FM  NTR++D+  
Sbjct: 89  LSLALILTFYIMNPVFTEMYNKGLGPYFEETITFQEMVSEVKKPLRKFMLYNTRKQDVRT 148

Query: 148 FMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVM 207
           F+ ++  +   T     D I   +L+ SF++SEL  +F++GFL+ LPFLIID +VA++++
Sbjct: 149 FLSISGEARPKT----ADDIPDLVLLSSFVVSELTTAFQMGFLLFLPFLIIDFVVASVLL 204

Query: 208 AMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +MGMMMLPP  IS+PFK++ FVL+DGW L+V ++VKSF
Sbjct: 205 SMGMMMLPPVMISVPFKIMLFVLVDGWGLIVTSIVKSF 242


>gi|238794007|ref|ZP_04637625.1| Flagellar biosynthetic protein fliP [Yersinia intermedia ATCC
           29909]
 gi|238726639|gb|EEQ18175.1| Flagellar biosynthetic protein fliP [Yersinia intermedia ATCC
           29909]
          Length = 273

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 149/231 (64%), Gaps = 8/231 (3%)

Query: 17  VFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRT 74
           VFA+  L  +++ P      +W   V+T    T LS  P  L+M+T F R IIV  +LR 
Sbjct: 47  VFAQ--LPGIISQPLANGGQSWSLPVQTLVFITTLSFLPAALLMMTSFTRIIIVLGLLRN 104

Query: 75  GMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWV 134
            +G  S PPN V++ LALF+TF++MSP  D+  +    P   ++I+   AI + A+P   
Sbjct: 105 ALGTPSAPPNQVMLGLALFLTFFIMSPVFDKVYQDAYLPFSQDKISMEVAIDKGAQPLRE 164

Query: 135 FMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILP 194
           FM   TRE DL+L+  +A+       +   + +  RIL+P+++ SEL+ +F+IGF + +P
Sbjct: 165 FMLRQTRESDLALYARLANLP----PLEGPEVVPMRILLPAYVTSELKTAFQIGFTVFIP 220

Query: 195 FLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FLIID++VA+++MA+GMMM+PP SISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 221 FLIIDLVVASVLMALGMMMVPPASISLPFKLMLFVLVDGWQLLLGSLAQSF 271


>gi|218288310|ref|ZP_03492609.1| flagellar biosynthetic protein FliP [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218241669|gb|EED08842.1| flagellar biosynthetic protein FliP [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 272

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 129/188 (68%)

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           ++TCF R I+V S +R  + + + PPN V++ LALF+T +VM PTL ++    +QP +  
Sbjct: 83  LMTCFTRVIVVLSFVRNALSLQTSPPNQVLVGLALFITLFVMQPTLQQANTQALQPYLRG 142

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           QI++T AI+R   PF VFM   TR +DL LF+   H +         + I    L+P+F 
Sbjct: 143 QISQTAAIERAEAPFKVFMAKQTRAQDLELFLAYRHETLTAEMERHPEAIAMSALVPAFT 202

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
           +SEL+ +F+IGF+I LPFL+ID++V+T +M+MGMMMLPP  ISLPFKV+ FV+++GW L+
Sbjct: 203 LSELQTAFQIGFMIYLPFLVIDLVVSTTLMSMGMMMLPPVMISLPFKVLLFVMVNGWYLV 262

Query: 238 VENLVKSF 245
           V++L+  +
Sbjct: 263 VKSLLAGY 270


>gi|28899013|ref|NP_798618.1| flagellar biosynthesis protein FliP [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260365241|ref|ZP_05777798.1| flagellar biosynthesis protein FliP [Vibrio parahaemolyticus K5030]
 gi|260878791|ref|ZP_05891146.1| flagellar biosynthesis protein FliP [Vibrio parahaemolyticus
           AN-5034]
 gi|260897386|ref|ZP_05905882.1| flagellar biosynthesis protein FliP [Vibrio parahaemolyticus
           Peru-466]
 gi|28807232|dbj|BAC60502.1| polar flagellar assembly protein FliP [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308088270|gb|EFO37965.1| flagellar biosynthesis protein FliP [Vibrio parahaemolyticus
           Peru-466]
 gi|308094309|gb|EFO44004.1| flagellar biosynthesis protein FliP [Vibrio parahaemolyticus
           AN-5034]
 gi|308115428|gb|EFO52968.1| flagellar biosynthesis protein FliP [Vibrio parahaemolyticus K5030]
          Length = 289

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 139/214 (64%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 82  DYSVTLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 138

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VMSP L+   +  IQP +N Q+T   A      P   FM   TR KDL  F++M
Sbjct: 139 LFLTFFVMSPVLNEINDTAIQPYLNEQVTAREAFDAAQVPMKAFMLKQTRIKDLETFVNM 198

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +        +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 199 SGE-----QVTNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 253

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 254 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 287


>gi|312962263|ref|ZP_07776755.1| flagellar biosynthetic protein FliP [Pseudomonas fluorescens WH6]
 gi|311283600|gb|EFQ62189.1| flagellar biosynthetic protein FliP [Pseudomonas fluorescens WH6]
          Length = 247

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 133/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 48  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFD 107

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  +  +QP +  ++T   AI +   P   FM + TR  DL LFM ++    + TDI   
Sbjct: 108 KVNQQALQPYLAEKMTAQDAIDKAQGPIKDFMLSQTRSSDLELFMRLS----KRTDIASP 163

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ SEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 164 DQAPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFK 223

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 224 IMLFVLVDGWALIIGTLASSF 244


>gi|304311110|ref|YP_003810708.1| Flagellar transport protein FliP [gamma proteobacterium HdN1]
 gi|301796843|emb|CBL45055.1| Flagellar transport protein FliP [gamma proteobacterium HdN1]
          Length = 253

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 91/212 (42%), Positives = 139/212 (65%), Gaps = 5/212 (2%)

Query: 36  STWIV--RTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
            +W V  +  G  T+L++ P +++M+T F R IIVFSILR  +G+   P N +++ LALF
Sbjct: 43  ESWSVSLQVLGFMTVLTLLPAIVLMMTAFTRIIIVFSILRQAIGLQQAPSNQILVGLALF 102

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T +VM P  D    + ++P    +I    AIQ  + P   FM    RE DL+LF+++A 
Sbjct: 103 LTLFVMRPVFDEINRVAVEPYQAEKIDGMQAIQAASGPLRKFMMAQIREADLTLFIELAG 162

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
              R  ++   D +   I+IP+F+ SEL+ +F+IGFL+ +PFLIIDM+VA+++MAMGMMM
Sbjct: 163 EQDRYHEV---DEVPLTIIIPAFITSELKTAFQIGFLLFIPFLIIDMVVASVLMAMGMMM 219

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           L P  ISLPFK++ FV +DGW+++V +L  S+
Sbjct: 220 LSPMIISLPFKIMLFVFVDGWAMVVGSLAASY 251


>gi|330502776|ref|YP_004379645.1| flagellar biosynthesis protein FliP [Pseudomonas mendocina NK-01]
 gi|328917062|gb|AEB57893.1| flagellar biosynthesis protein FliP [Pseudomonas mendocina NK-01]
          Length = 261

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 135/201 (67%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N +++ LALF+T ++M+P  D
Sbjct: 62  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILVGLALFLTMFIMAPVFD 121

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R     +QP +N +I    A+ R   P   FM   TRE DL+LF+ ++    + TD+   
Sbjct: 122 RINTDALQPYLNEEIIAQEALTRAEGPIRDFMLAQTRESDLALFVRLS----KRTDLAGV 177

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           + +   IL+P+F+ SEL+ +F+IGF+I +PFLIIDM+VA+I+MAMGMMML P  ISLPFK
Sbjct: 178 EDVPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDMVVASILMAMGMMMLSPLIISLPFK 237

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 238 IMLFVLVDGWALIMGTLAASF 258


>gi|269103167|ref|ZP_06155864.1| flagellar biosynthesis protein FliP [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163065|gb|EEZ41561.1| flagellar biosynthesis protein FliP [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 272

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/214 (42%), Positives = 141/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T L   P ++I++T F R ++V SILR  +G+   P N VII +A
Sbjct: 65  DYSVTLQIL---ALMTALGFLPAIVILMTSFTRIVVVMSILRQALGLQQTPSNQVIIGIA 121

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VMSP LDR     +QP +N QIT   A+++   P   FM   TR KDL  F+++
Sbjct: 122 LFLTFFVMSPVLDRINAQAVQPYINEQITAPQALEKAKVPMREFMLKQTRVKDLETFVNI 181

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + +      ++    +   +LIP+F+ SEL+ +F+IGF++ LPFL+ID++VA+++MAMGM
Sbjct: 182 SGA-----KVSDPQQVPMTVLIPAFITSELKTAFQIGFMLFLPFLVIDLVVASVLMAMGM 236

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 237 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 270


>gi|120613021|ref|YP_972699.1| flagellar biosynthesis protein FliP [Acidovorax citrulli AAC00-1]
 gi|120591485|gb|ABM34925.1| flagellar biosynthetic protein FliP [Acidovorax citrulli AAC00-1]
          Length = 262

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 135/207 (65%), Gaps = 4/207 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+M+T F R +IV S++R  +G  S PPN VII L+LF+TF+VM
Sbjct: 59  IQTLLFFTALSFLPAVLLMMTGFTRIVIVLSLIRQAIGTQSAPPNQVIIGLSLFLTFFVM 118

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PT DR       P  NN IT   A++R   P   FM   TR+ D +LF  +A      T
Sbjct: 119 GPTFDRVYADAYLPYSNNTITFEQAVERAEAPMRSFMLKQTRQSDFALFARLAKLPSGAT 178

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
             T       R+L+P+F+ SEL+ +F+IGF+I +PFL+IDM+V++I+M++GMMML P  +
Sbjct: 179 AETA----PMRVLVPAFVTSELKSAFQIGFMIFIPFLVIDMVVSSILMSLGMMMLSPVLV 234

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSFI 246
           +LPFK++ FVL DGW+LL+ +L  SF+
Sbjct: 235 ALPFKLMLFVLADGWNLLLGSLAASFV 261


>gi|54308125|ref|YP_129145.1| flagellar biosynthesis protein FliP [Photobacterium profundum SS9]
 gi|46912551|emb|CAG19343.1| Putative polar flagellar assembly protein, FliP [Photobacterium
           profundum SS9]
          Length = 284

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 140/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+   G+ T L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 77  DYSVTLQIL---GLMTALGFLPAIIILMTSFTRIVVVLSILRQAMGLQQTPSNQVIIGIA 133

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+T +VMSP +D+     +QP +N +IT   A +    P   FM   TR KDL  F++M
Sbjct: 134 LFLTLFVMSPVIDKVNADAVQPYINEEITAAQAFETAQVPLRQFMLKQTRVKDLESFVNM 193

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + S+      T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 194 SGSTA-----TAPEDVPITVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 248

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 249 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 282


>gi|222112240|ref|YP_002554504.1| flagellar biosynthesis protein flip [Acidovorax ebreus TPSY]
 gi|221731684|gb|ACM34504.1| flagellar biosynthetic protein FliP [Acidovorax ebreus TPSY]
          Length = 251

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 134/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+M+T F R +IV S+LR  +G  S PPN VII L+LF+T +VM
Sbjct: 48  IQTLLFFTALSFLPAVLLMMTGFTRIVIVLSLLRQAIGTQSAPPNQVIIGLSLFLTLFVM 107

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PTLD+  +    P   N IT   AIQR   P   FM   TR+ D +LF  +A      T
Sbjct: 108 GPTLDKVYQEAYVPYTTNAITFEQAIQRAEAPMRGFMLKQTRQSDFALFARLAKLDEGVT 167

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
             T       R+L+P+F+ SEL+ +F+IGF+I +PFLIIDM+V++++M++GMMML P  +
Sbjct: 168 AETA----PLRVLVPAFVTSELKSAFQIGFMIFIPFLIIDMVVSSVLMSLGMMMLSPVLV 223

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL DGW+LL+ +L  SF
Sbjct: 224 ALPFKLMLFVLADGWNLLIGSLAASF 249


>gi|328474450|gb|EGF45255.1| flagellar biosynthesis protein FliP [Vibrio parahaemolyticus 10329]
          Length = 289

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 139/214 (64%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 82  DYSVTLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 138

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VMSP L+   +  IQP +N Q+T   A      P   FM   TR KDL  F++M
Sbjct: 139 LFLTFFVMSPVLNEINDTAIQPYLNEQVTAREAFDAAQVPMKAFMLKQTRIKDLETFVNM 198

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +        +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 199 SGE-----QVTNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 253

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 254 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 287


>gi|327481256|gb|AEA84566.1| flagellar biosynthesis protein FliP [Pseudomonas stutzeri DSM 4166]
          Length = 258

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/201 (46%), Positives = 131/201 (65%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++I L LF+T ++M+P  D
Sbjct: 59  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILIGLTLFLTLFIMAPVFD 118

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP ++ QI    AI R   P   FM   TRE DL LF+ ++      TDI   
Sbjct: 119 RINQDALQPYLSEQIPAQEAIARAEVPLKNFMLAQTRESDLELFVRLSQ----RTDIASP 174

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           +     IL+P+F+ SEL+ +F+IGF+I +PFLIIDM+VA+++MAMGMMML P  ISLPFK
Sbjct: 175 EAAPMTILVPAFVTSELKTAFQIGFMIFIPFLIIDMVVASVLMAMGMMMLSPLIISLPFK 234

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L++  L  SF
Sbjct: 235 IMLFVLVDGWGLIIGTLAGSF 255


>gi|156975420|ref|YP_001446327.1| flagellar biosynthesis protein FliP [Vibrio harveyi ATCC BAA-1116]
 gi|156527014|gb|ABU72100.1| hypothetical protein VIBHAR_03151 [Vibrio harveyi ATCC BAA-1116]
          Length = 289

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 139/214 (64%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 82  DYSVTLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 138

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VMSP L+   +  IQP +N Q+T   A      P   FM   TR KDL  F++M
Sbjct: 139 LFLTFFVMSPVLNEINDNAIQPYLNEQVTARQAFDAAQVPMKAFMLKQTRIKDLETFVNM 198

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +        +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 199 SGE-----QVTNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 253

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 254 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 287


>gi|257484903|ref|ZP_05638944.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289629020|ref|ZP_06461974.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651610|ref|ZP_06482953.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298487821|ref|ZP_07005861.1| Flagellar biosynthesis protein fliP [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157546|gb|EFH98626.1| Flagellar biosynthesis protein fliP [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330866458|gb|EGH01167.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330986502|gb|EGH84605.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011077|gb|EGH91133.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 250

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 153/248 (61%), Gaps = 23/248 (9%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPA-----------DLSISTWIVRTFGIFTILSIAPILLI 57
           L +VTP ++ A     D ++IPA           + S+S  I+    I T LS  P  ++
Sbjct: 12  LVMVTPAVLAA-----DPLSIPAITLSNGADGQQEYSVSLQILL---IMTALSFIPAFVM 63

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           ++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  DR  +  +QP +  
Sbjct: 64  LMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFDRVNQDALQPYLAE 123

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           ++T   A+ +   P   FM   TR  DL LFM ++    + TDI   D     IL+P+F+
Sbjct: 124 KLTAQDAVAKAQVPIKDFMLAQTRTSDLELFMRLS----KRTDIPTPDAAPLTILVPAFV 179

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
           ISEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK++ FVL+DGW+L+
Sbjct: 180 ISELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFKIMLFVLVDGWALI 239

Query: 238 VENLVKSF 245
           V  L  SF
Sbjct: 240 VGTLAGSF 247


>gi|262276385|ref|ZP_06054194.1| flagellar biosynthesis protein FliP [Grimontia hollisae CIP 101886]
 gi|262220193|gb|EEY71509.1| flagellar biosynthesis protein FliP [Grimontia hollisae CIP 101886]
          Length = 277

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 92/214 (42%), Positives = 140/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I     + T L   P ++I++T F R ++V +ILR  MG+   P N VII +A
Sbjct: 71  DYSVTLQI---LALMTALGFLPAIVILMTSFTRIVVVMAILRQAMGLQQTPSNQVIIGIA 127

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           +F+T ++MSP +DR     +QP +N +IT   A  RV  P   FM   TR KDL  F++M
Sbjct: 128 MFLTLFIMSPVIDRMNVAAVQPYLNEEITAREAFDRVQVPLREFMLQQTRVKDLETFVNM 187

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + +      +T+ + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 188 SGA-----QVTEAEQVPMTVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 242

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 243 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 276


>gi|260899945|ref|ZP_05908340.1| flagellar biosynthesis protein FliP [Vibrio parahaemolyticus
           AQ4037]
 gi|308107285|gb|EFO44825.1| flagellar biosynthesis protein FliP [Vibrio parahaemolyticus
           AQ4037]
          Length = 289

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 139/214 (64%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 82  DYSVTLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 138

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VMSP L+   +  IQP +N Q+T   A      P   FM   TR KDL  F++M
Sbjct: 139 LFLTFFVMSPVLNEINDTAIQPYLNEQVTAREAFDAAQVPMKAFMLKQTRIKDLETFVNM 198

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +        +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 199 SGE-----QVTNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 253

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 254 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 287


>gi|153834137|ref|ZP_01986804.1| flagellar biosynthesis protein [Vibrio harveyi HY01]
 gi|148869507|gb|EDL68505.1| flagellar biosynthesis protein [Vibrio harveyi HY01]
          Length = 280

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 139/214 (64%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 73  DYSVTLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 129

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VMSP L+   +  IQP +N Q+T   A      P   FM   TR KDL  F++M
Sbjct: 130 LFLTFFVMSPVLNEINDNAIQPYLNEQVTARQAFDAAQVPMKAFMLKQTRIKDLETFVNM 189

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +        +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 190 SGE-----QVTNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 244

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 245 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 278


>gi|153953789|ref|YP_001394554.1| flagellar biosynthesis protein FliP [Clostridium kluyveri DSM 555]
 gi|219854405|ref|YP_002471527.1| hypothetical protein CKR_1062 [Clostridium kluyveri NBRC 12016]
 gi|146346670|gb|EDK33206.1| FliP [Clostridium kluyveri DSM 555]
 gi|219568129|dbj|BAH06113.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 258

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 136/193 (70%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +++M+T F R ++VF  LRT MG    PPN V++ LALF+T ++M P   +     IQ
Sbjct: 69  PSIIMMMTSFVRIVVVFGFLRTAMGTQQSPPNQVLVGLALFLTVFIMLPVYGKINSEAIQ 128

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P + N IT+  A++R A+P   FM   TR+KDL LF+D A     N ++TK++   Y ++
Sbjct: 129 PYLQNGITQEQAVERGAKPLREFMLKQTRQKDLKLFVDEAK---LNYEVTKDNAPLY-VV 184

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           IP+++ISEL+ +F+IGFL+ +PF+IID++V +++M+MGM MLPP  ISLPFK++ FV+ D
Sbjct: 185 IPAYIISELKTAFQIGFLLYIPFMIIDLVVGSVLMSMGMFMLPPVMISLPFKLLLFVMTD 244

Query: 233 GWSLLVENLVKSF 245
           GW LLV++L+ SF
Sbjct: 245 GWYLLVKSLIISF 257


>gi|4322007|gb|AAD15910.1| polar flagellar assembly protein FliP [Vibrio parahaemolyticus]
          Length = 289

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 139/214 (64%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 82  DYSVTLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 138

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VMSP L+   +  IQP +N Q+T   A      P   FM   TR KDL  F++M
Sbjct: 139 LFLTFFVMSPVLNEINDTAIQPYLNEQVTAREAFDAAQVPMKAFMLKQTRIKDLETFVNM 198

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +        +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 199 SGE-----QVTNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 253

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 254 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 287


>gi|218778860|ref|YP_002430178.1| flagellar biosynthetic protein FliP [Desulfatibacillum alkenivorans
           AK-01]
 gi|218760244|gb|ACL02710.1| Flagellar biosynthetic protein FliP [Desulfatibacillum alkenivorans
           AK-01]
          Length = 256

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 94/216 (43%), Positives = 146/216 (67%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P  +S+   +++   + T+L++AP +L+++T F R  +VFS LR  +G   +PPN V++ 
Sbjct: 45  PEQVSV---LLQIVALLTVLTLAPAILMLMTSFTRLAVVFSFLRHALGTQQMPPNQVMVG 101

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+T ++M P         +QP +N +I +  AI++   P   FM  +TREKDL+LF+
Sbjct: 102 LALFLTVFIMMPVWKDINTNALQPYLNEEIGDQEAIEKAVTPLREFMFRHTREKDLALFV 161

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            ++  +  N+       +    LIP+F+ISEL  +F IGF+I +PFLIIDM+VA+++++M
Sbjct: 162 KISGEAKPNSP----KDVTIWTLIPAFVISELTTAFMIGFIIYVPFLIIDMVVASVLLSM 217

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FVL+DGWSL+V +LV+SF
Sbjct: 218 GMMMLPPVMISLPFKLMLFVLVDGWSLIVGSLVQSF 253


>gi|289829471|ref|ZP_06547083.1| flagellar biosynthesis protein FliP [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
          Length = 186

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 131/188 (69%), Gaps = 4/188 (2%)

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           M+T F R IIVF +LR  +G  S PPN V++ LALF+TF++MSP +D+      QP    
Sbjct: 1   MMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQ 60

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           +I+   A+ + A+P   FM   TRE DL+LF  +A+S      +   + +  RIL+P+++
Sbjct: 61  KISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGP----LQGPEAVPMRILLPAYV 116

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
            SEL+ +F+IGF I +PFLIID+++A+++MA+GMMM+PP +I+LPFK++ FVL+DGW LL
Sbjct: 117 TSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLL 176

Query: 238 VENLVKSF 245
           V +L +SF
Sbjct: 177 VGSLAQSF 184


>gi|169831899|ref|YP_001717881.1| flagellar biosynthetic protein FliP [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638743|gb|ACA60249.1| flagellar biosynthetic protein FliP [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 260

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 138/206 (66%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           VR     T++S+ P  L+MVT F R ++V + LR G+G+   PP  V+I LALF+T ++M
Sbjct: 59  VRLLLFLTVISLLPAFLVMVTSFTRIVVVLAFLRAGLGIYQAPPGSVLIGLALFLTVFIM 118

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +P   +  E  I+P +  +I +  A +R A P   FM  +TREKDL LF+ MA   +   
Sbjct: 119 APVYAQVNEQAIEPFLRGEIDQVEAQERAAGPLREFMLRHTREKDLDLFVRMAEIEN--- 175

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                + +   ++IP+F+ISEL+ +F +GF++ LPFLIIDM+VA+I+++MGM MLPP  I
Sbjct: 176 --PVPNELPLTVVIPAFIISELKTAFTMGFMLYLPFLIIDMVVASILLSMGMFMLPPVMI 233

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW L+V +LV+SF
Sbjct: 234 SLPFKLLLFVLVDGWYLVVRSLVESF 259


>gi|254478865|ref|ZP_05092229.1| flagellar biosynthetic protein FliP [Carboxydibrachium pacificum
           DSM 12653]
 gi|214035178|gb|EEB75888.1| flagellar biosynthetic protein FliP [Carboxydibrachium pacificum
           DSM 12653]
          Length = 221

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 102/228 (44%), Positives = 153/228 (67%), Gaps = 14/228 (6%)

Query: 21  SSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGS 80
           S+L   +  P++LS S  IV      T+L++AP +LIM+T F R +IV + LR  +G+  
Sbjct: 4   SNLVSSVTSPSNLSTSLQIVLLL---TVLTLAPSILIMMTSFTRIVIVLAFLRNALGLQQ 60

Query: 81  VPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNT 140
           +PPN V+I LALF+TFY+M+P         I+P +  QI +  A +R  +P   FM   T
Sbjct: 61  MPPNQVLIGLALFLTFYIMAPVGYDINNNAIKPYVEGQINQYEAYERAIKPLKSFMLRQT 120

Query: 141 REKDLSLFMDMAHSSHRNTDITKNDHIE---YRILIPSFMISELRRSFEIGFLIILPFLI 197
           R+ DL+LF+++A          K D +E    R++IP+F+ISEL+ +FEIGF+I +PFL+
Sbjct: 121 RQNDLALFVNLAK--------IKADKVEDLPMRVVIPAFIISELKTAFEIGFIIYIPFLV 172

Query: 198 IDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           ID+IVA+++M+MGM MLPP  ISLPFKV+ F+L+DGW+L+V++L+  F
Sbjct: 173 IDIIVASVLMSMGMFMLPPVLISLPFKVLLFILVDGWNLVVKSLILGF 220


>gi|161484783|ref|NP_669792.2| flagellar biosynthesis protein FliP [Yersinia pestis KIM 10]
 gi|161511402|ref|NP_992929.2| flagellar biosynthesis protein FliP [Yersinia pestis biovar
           Microtus str. 91001]
 gi|161760581|ref|YP_070220.2| flagellar biosynthesis protein FliP [Yersinia pseudotuberculosis IP
           32953]
 gi|162100177|ref|YP_651108.2| flagellar biosynthesis protein FliP [Yersinia pestis Antiqua]
 gi|162139435|ref|YP_648231.2| flagellar biosynthesis protein FliP [Yersinia pestis Nepal516]
 gi|167401077|ref|ZP_02306580.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|115347552|emb|CAL20461.1| flagellar biosynthetic protein FliP [Yersinia pestis CO92]
 gi|167049466|gb|EDR60874.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar Antiqua
           str. UG05-0454]
          Length = 246

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 146/227 (64%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  +++ P      +W   V+T    T LS  P  L+M+T F R IIV  +LR  MG 
Sbjct: 22  AQLPGIISQPLANGGQSWSLPVQTLVFITTLSFLPAALLMMTSFTRIIIVLGLLRNAMGT 81

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ LALF+TF++MSP  D+  +    P   ++I+   A+ + ++P   FM  
Sbjct: 82  PSAPPNQVMLGLALFLTFFIMSPVFDKVYQEAYLPFSQDKISMDVALDKGSQPLREFMLR 141

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+L+  +A+       +   + +  RIL+P+++ SEL+ +F+IGF + +PFLII
Sbjct: 142 QTRESDLALYARLANLP----PLEGPEMVPMRILLPAYVTSELKTAFQIGFTVFIPFLII 197

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D++VA+++MA+GMMM+PP SISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 198 DLVVASVLMALGMMMVPPASISLPFKLMLFVLVDGWQLLLGSLAQSF 244


>gi|74055044|gb|AAZ95849.1| FliP [Aeromonas hydrophila]
          Length = 259

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 137/206 (66%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T LS  P ++IM+T F R IIV  ILR  +G+   P N V+I +ALFM+F++M
Sbjct: 53  LQVLALMTALSFLPAMVIMMTSFTRIIIVLGILRQAIGLQQSPSNQVLIGIALFMSFFIM 112

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR     +QP +   I    A+++   P   FM   TR KDL+ FM++A     N 
Sbjct: 113 SPVLDRINNEALQPYLAETIQAKEALEKAELPIHQFMLAQTRIKDLNTFMEIA-----NV 167

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            + K   +  R+LIP+F+ SEL+ +F+IGF++ LPFL+ID++VA+I+MAMGMMML P  +
Sbjct: 168 QVDKPAEVPLRVLIPAFVTSELKTAFQIGFMLFLPFLVIDLVVASILMAMGMMMLSPMLV 227

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FV++DGW+L++ +L  SF
Sbjct: 228 SLPFKLMLFVMVDGWNLILGSLANSF 253


>gi|27365290|ref|NP_760818.1| flagellar biosynthesis protein FliP [Vibrio vulnificus CMCP6]
 gi|37680655|ref|NP_935264.1| flagellar biosynthesis protein FliP [Vibrio vulnificus YJ016]
 gi|320155674|ref|YP_004188053.1| flagellar biosynthesis protein FliP [Vibrio vulnificus MO6-24/O]
 gi|27361437|gb|AAO10345.1| flagellar biosynthetic protein FliP [Vibrio vulnificus CMCP6]
 gi|37199404|dbj|BAC95235.1| flagellar biosynthesis pathway, component FliP [Vibrio vulnificus
           YJ016]
 gi|319930986|gb|ADV85850.1| flagellar biosynthesis protein FliP [Vibrio vulnificus MO6-24/O]
          Length = 289

 Score =  185 bits (469), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 134/206 (65%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T+L   P ++I++T F R ++V SILR  MG+   P N VII +ALF+TF++M
Sbjct: 87  LQILALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIALFLTFFIM 146

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP ++   E  +QP +N Q+T   A      P   FM   TR KDL  F++M+     N 
Sbjct: 147 SPVINEVNEQAVQPYLNEQLTAREAFDAAQGPMKAFMLKQTRVKDLETFVNMSGEQATNP 206

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           +      +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGMMML P  +
Sbjct: 207 E-----DVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGMMMLSPMIV 261

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 262 SLPFKLMLFVLVDGWNLILSTLAGSF 287


>gi|258511388|ref|YP_003184822.1| flagellar biosynthetic protein FliP [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257478114|gb|ACV58433.1| flagellar biosynthetic protein FliP [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 272

 Score =  185 bits (469), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 129/188 (68%)

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           ++TCF R I+V S +R  + + + PPN V++ LALF+T +VM PTL ++    +QP +  
Sbjct: 83  LMTCFTRVIVVLSFVRNALSLQTSPPNQVLVGLALFITLFVMQPTLQQANTQALQPYLRG 142

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           QI++T AI+R   PF VFM   TR +DL LF+   H +         + I    L+P+F 
Sbjct: 143 QISQTAAIERAEAPFKVFMAKQTRAQDLELFLAYRHETLTAEMERHPEAIAMSALVPAFT 202

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
           +SEL+ +F+IGF+I LPFL+ID++V+T +M+MGMMMLPP  ISLPFKV+ FV+++GW L+
Sbjct: 203 LSELQTAFQIGFMIYLPFLVIDLVVSTTLMSMGMMMLPPVMISLPFKVLLFVMVNGWYLV 262

Query: 238 VENLVKSF 245
           V++L+  +
Sbjct: 263 VKSLLVGY 270


>gi|150390469|ref|YP_001320518.1| flagellar biosynthetic protein FliP [Alkaliphilus metalliredigens
           QYMF]
 gi|149950331|gb|ABR48859.1| flagellar biosynthetic protein FliP [Alkaliphilus metalliredigens
           QYMF]
          Length = 267

 Score =  185 bits (469), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 92/201 (45%), Positives = 137/201 (68%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TILSIAP +LIM+T F R +IV S LR  +     PP  +II LALF+TF+ M+P   
Sbjct: 70  LLTILSIAPAILIMMTSFTRIVIVLSFLRNAIATQQTPPTQIIIGLALFLTFFTMAPIAT 129

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
                 +QP +  ++ +  A++R  EP   FM   TREKDL+LF+++++S       T+ 
Sbjct: 130 DINTNALQPYLAEELGQEEALERAMEPIREFMFRQTREKDLALFIEVSNSEMP----TEV 185

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
             I    LIP+F+ISEL+ +F++GF++ +PF++IDM+VA+ +MAMGMMMLPP  ISLPFK
Sbjct: 186 ADIATSTLIPAFIISELKTAFQMGFILFIPFIVIDMVVASTLMAMGMMMLPPAMISLPFK 245

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ F+++DGW++LV  L+ SF
Sbjct: 246 LLLFIMVDGWNILVRALIMSF 266


>gi|311992339|gb|ADQ26743.1| flagellar export component [Aeromonas hydrophila]
          Length = 258

 Score =  185 bits (469), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 137/206 (66%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T LS  P ++IM+T F R IIV  ILR  +G+   P N V+I +ALFM+F++M
Sbjct: 52  LQVLALMTALSFLPAMVIMMTSFTRIIIVLGILRQAIGLQQSPSNQVLIGIALFMSFFIM 111

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR     +QP +   I    A+++   P   FM   TR KDL+ FM++A     N 
Sbjct: 112 SPVLDRINNEALQPYLAETIQAKEALEKAELPIHQFMLAQTRIKDLNTFMEIA-----NV 166

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            + K   +  R+LIP+F+ SEL+ +F+IGF++ LPFL+ID++VA+I+MAMGMMML P  +
Sbjct: 167 QVDKPADVPLRVLIPAFVTSELKTAFQIGFMLFLPFLVIDLVVASILMAMGMMMLSPMLV 226

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FV++DGW+L++ +L  SF
Sbjct: 227 SLPFKLMLFVMVDGWNLILGSLANSF 252


>gi|291558213|emb|CBL35330.1| flagellar biosynthetic protein FliP [Eubacterium siraeum V10Sc8a]
          Length = 296

 Score =  185 bits (469), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 91/208 (43%), Positives = 130/208 (62%), Gaps = 9/208 (4%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+LS+AP LL+M+T F R II FS LRT M   S PPN+V+  L+LF+T ++M P     
Sbjct: 87  TVLSLAPSLLVMMTSFARIIICFSFLRTAMQTQSTPPNMVLTGLSLFLTIFIMWPVFSEI 146

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            E   QP    ++T   AI    +P   FM   T   D+  F+D+   S  +      D+
Sbjct: 147 NETAYQPYAAGEMTMEQAIDAAGKPLKTFMLKQTTNDDMKFFLDLKGQSMSDVTGGATDN 206

Query: 167 IE---------YRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPT 217
           I          +  +IP+F++SEL+R+F++GFLI +PFL+ID++V++ +MAMGMMMLPP 
Sbjct: 207 ITLENYSEKLGFETVIPAFIVSELKRAFQMGFLIFIPFLVIDLVVSSTLMAMGMMMLPPA 266

Query: 218 SISLPFKVIFFVLIDGWSLLVENLVKSF 245
            ISLPFK+I FVL+DGW L+V  +V S+
Sbjct: 267 MISLPFKIILFVLVDGWQLMVGTIVNSY 294


>gi|167750712|ref|ZP_02422839.1| hypothetical protein EUBSIR_01690 [Eubacterium siraeum DSM 15702]
 gi|167656391|gb|EDS00521.1| hypothetical protein EUBSIR_01690 [Eubacterium siraeum DSM 15702]
          Length = 307

 Score =  185 bits (469), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 91/208 (43%), Positives = 130/208 (62%), Gaps = 9/208 (4%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+LS+AP LL+M+T F R II FS LRT M   S PPN+V+  L+LF+T ++M P     
Sbjct: 98  TVLSLAPSLLVMMTSFARIIICFSFLRTAMQTQSTPPNMVLTGLSLFLTIFIMWPVFSEI 157

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            E   QP    ++T   AI    +P   FM   T   D+  F+D+   S  +      D+
Sbjct: 158 NETAYQPYAAGEMTMEQAIDAAGKPLKTFMLKQTTNDDMKFFLDLKGQSMSDVTGGATDN 217

Query: 167 IE---------YRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPT 217
           I          +  +IP+F++SEL+R+F++GFLI +PFL+ID++V++ +MAMGMMMLPP 
Sbjct: 218 ITLENYSEKLGFETVIPAFIVSELKRAFQMGFLIFIPFLVIDLVVSSTLMAMGMMMLPPA 277

Query: 218 SISLPFKVIFFVLIDGWSLLVENLVKSF 245
            ISLPFK+I FVL+DGW L+V  +V S+
Sbjct: 278 MISLPFKIILFVLVDGWQLMVGTIVNSY 305


>gi|153836933|ref|ZP_01989600.1| flagellar biosynthetic protein FliP [Vibrio parahaemolyticus
           AQ3810]
 gi|149749706|gb|EDM60451.1| flagellar biosynthetic protein FliP [Vibrio parahaemolyticus
           AQ3810]
          Length = 276

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 139/214 (64%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 69  DYSVTLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 125

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VMSP L+   +  IQP +N Q+T   A      P   FM   TR KDL  F++M
Sbjct: 126 LFLTFFVMSPVLNEINDTAIQPYLNEQVTAREAFDVAQVPMKAFMLKQTRIKDLETFVNM 185

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +        +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 186 SGE-----QVTNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 240

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 241 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 274


>gi|117618724|ref|YP_855914.1| flagellar biosynthesis protein FliP [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560131|gb|ABK37079.1| flagellar biosynthetic protein FliP [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 259

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 137/206 (66%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T LS  P ++IM+T F R IIV  ILR  +G+   P N V+I +ALFM+F++M
Sbjct: 53  LQVLALMTALSFLPAIVIMMTSFTRIIIVLGILRQAIGLQQSPSNQVLIGIALFMSFFIM 112

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR     +QP +   I    A+++   P   FM   TR KDL+ FM++A     N 
Sbjct: 113 SPVLDRINNEALQPYLAETIQAKEALEKAELPIHQFMLAQTRIKDLNTFMEIA-----NV 167

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            + K   +  R+LIP+F+ SEL+ +F+IGF++ LPFL+ID++VA+I+MAMGMMML P  +
Sbjct: 168 QVDKPADVPLRVLIPAFVTSELKTAFQIGFMLFLPFLVIDLVVASILMAMGMMMLSPMLV 227

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FV++DGW+L++ +L  SF
Sbjct: 228 SLPFKLMLFVMVDGWNLILGSLANSF 253


>gi|269836609|ref|YP_003318837.1| flagellar biosynthetic protein FliP [Sphaerobacter thermophilus DSM
           20745]
 gi|269785872|gb|ACZ38015.1| flagellar biosynthetic protein FliP [Sphaerobacter thermophilus DSM
           20745]
          Length = 274

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 134/203 (66%), Gaps = 4/203 (1%)

Query: 43  FGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPT 102
           F + T L++ P LL+MVT F R IIV S  R  +G+  +PPN V++ LALF+T ++M+P 
Sbjct: 75  FVLLTFLALLPTLLMMVTSFTRVIIVLSFARNAIGVPQLPPNQVLLGLALFLTIFIMAPV 134

Query: 103 LDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDIT 162
                   +QP +  +I +  A+ R   P   FM   TRE+DL+LFM +       T   
Sbjct: 135 WQEVNRTALQPYLAGEIAQAEAMDRAVRPLREFMLRQTRERDLALFMQLGQQPRPRTP-- 192

Query: 163 KNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLP 222
             D +   +L+PSF++SEL+ +F++GF+I +PFLIIDMIV++ +M+MGM+MLPP  +SLP
Sbjct: 193 --DDVPTWVLVPSFIVSELKTAFQMGFVIFIPFLIIDMIVSSALMSMGMIMLPPVIVSLP 250

Query: 223 FKVIFFVLIDGWSLLVENLVKSF 245
           FKV+ FV++DGW L+V +LV SF
Sbjct: 251 FKVLLFVMVDGWDLIVRSLVMSF 273


>gi|84388121|ref|ZP_00991017.1| flagellar biosynthesis protein [Vibrio splendidus 12B01]
 gi|84377188|gb|EAP94058.1| flagellar biosynthesis protein [Vibrio splendidus 12B01]
          Length = 309

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 143/218 (65%), Gaps = 8/218 (3%)

Query: 28  NIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVI 87
           N   D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VI
Sbjct: 98  NGGEDYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVI 154

Query: 88  ISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSL 147
           I +A+F+TF++MSP +++  E  +QP +N QI+   A      P   FM   TR KDL  
Sbjct: 155 IGIAIFLTFFIMSPVINQVNEQAVQPYLNEQISARQAFDVAQGPIKSFMLKQTRIKDLET 214

Query: 148 FMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVM 207
           F++++ +     ++T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++M
Sbjct: 215 FVEISGA-----EVTNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLM 269

Query: 208 AMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           AMGMMML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 270 AMGMMMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 307


>gi|332559786|ref|ZP_08414108.1| FliP2 [Rhodobacter sphaeroides WS8N]
 gi|332277498|gb|EGJ22813.1| FliP2 [Rhodobacter sphaeroides WS8N]
          Length = 238

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 91/212 (42%), Positives = 136/212 (64%), Gaps = 5/212 (2%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S++   V+   + T+LS+ P L +M+TCFP  + V SILR  +G+   PPN++I+SLALF
Sbjct: 31  SLTARSVQLIAVITLLSLVPALAMMITCFPFIVTVLSILRQAIGLQQAPPNMLIVSLALF 90

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T+YVM P    +   GI PL  N++    A+   A PF  FM        L+     A 
Sbjct: 91  LTWYVMDPVFTEAWTRGIGPLTRNELDLPQALAAAAVPFRGFMTGRIDPDTLA-----AL 145

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            + R         + + +L+PSF++SE++R+FEIGFLI LPFLIID++V+ ++M+MGMMM
Sbjct: 146 QALRPGPAAPPSEVSFSVLVPSFLLSEIQRAFEIGFLIYLPFLIIDLVVSAVLMSMGMMM 205

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +PP  +S+PFK+ FFV+ DGWSL+   LV+S+
Sbjct: 206 VPPAVVSMPFKLAFFVVADGWSLISGALVRSY 237


>gi|77464887|ref|YP_354391.1| flagellar biosynthesis protein FliP [Rhodobacter sphaeroides 2.4.1]
 gi|77389305|gb|ABA80490.1| Type III secretion system inner membrane P protein [Rhodobacter
           sphaeroides 2.4.1]
          Length = 239

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 91/212 (42%), Positives = 136/212 (64%), Gaps = 5/212 (2%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S++   V+   + T+LS+ P L +M+TCFP  + V SILR  +G+   PPN++I+SLALF
Sbjct: 32  SLTARSVQLIAVITLLSLVPALAMMITCFPFIVTVLSILRQAIGLQQAPPNMLIVSLALF 91

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T+YVM P    +   GI PL  N++    A+   A PF  FM        L+     A 
Sbjct: 92  LTWYVMDPVFTEAWTRGIGPLTRNELDLPQALAAAAVPFRGFMTGRIDPDTLA-----AL 146

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            + R         + + +L+PSF++SE++R+FEIGFLI LPFLIID++V+ ++M+MGMMM
Sbjct: 147 QALRPGPAAPPSEVSFSVLVPSFLLSEIQRAFEIGFLIYLPFLIIDLVVSAVLMSMGMMM 206

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +PP  +S+PFK+ FFV+ DGWSL+   LV+S+
Sbjct: 207 VPPAVVSMPFKLAFFVVADGWSLISGALVRSY 238


>gi|330808228|ref|YP_004352690.1| flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376336|gb|AEA67686.1| Flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 249

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 92/201 (45%), Positives = 132/201 (65%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 50  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFD 109

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  +IT   A+ +   P   FM   TR  DL LFM ++    + TDI   
Sbjct: 110 RVNQDALQPYLAEKITAQDAVAKAEVPIKDFMLAQTRSSDLELFMRLS----KRTDIPSA 165

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ SEL+ +F+IGF+I +PFLIID++VA+I+MAMGMMML P  ISLPFK
Sbjct: 166 DQAPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDLVVASILMAMGMMMLSPLIISLPFK 225

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 226 IMLFVLVDGWALIIGTLAGSF 246


>gi|145298356|ref|YP_001141197.1| flagellar biosynthesis protein FliP [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851128|gb|ABO89449.1| Flagellar biosynthesis protein FliP [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 249

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 139/206 (67%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T LS  P ++IM+T F R IIV  ILR  +G+   P N V+I +ALFM+F++M
Sbjct: 43  LQVLALMTALSFLPAVVIMMTSFTRIIIVLGILRQAIGLQQSPSNQVLIGIALFMSFFIM 102

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LDR  +  +QP +   I    A+++   P   FM + TR KDL+ FM++A     + 
Sbjct: 103 SPVLDRINDEALQPYLAETIQAREALEKAELPIHQFMLSQTRIKDLNTFMEIA-----DV 157

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            + K   +  R+LIP+F+ SEL+ +F+IGF++ LPFL+ID++VA+I+MAMGMMML P  +
Sbjct: 158 QVDKPAEVPLRVLIPAFVTSELKTAFQIGFMLFLPFLVIDLVVASILMAMGMMMLSPMLV 217

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FV++DGW+L++ +L  SF
Sbjct: 218 SLPFKLMLFVMVDGWNLILGSLANSF 243


>gi|330940696|gb|EGH43707.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 250

 Score =  184 bits (468), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 92/201 (45%), Positives = 133/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 51  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQAPSNQILTGMALFLTMFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  +++   A+ +   P   FM   TR  DL LFM ++    + TDI   
Sbjct: 111 RVNQDALQPYLAEKLSAQDAVAKAQVPIKDFMLAQTRTSDLELFMRLS----KRTDIPTP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ISEL+ +F+IGF+I +PFLIIDM+VA+++MAMGMMML P  ISLPFK
Sbjct: 167 DAAPLTILVPAFVISELKTAFQIGFMIFIPFLIIDMVVASVLMAMGMMMLSPLIISLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L+V  L  SF
Sbjct: 227 IMLFVLVDGWALIVGTLAGSF 247


>gi|284007164|emb|CBA72448.1| flagellar biosynthesis protein FliP [Arsenophonus nasoniae]
          Length = 245

 Score =  184 bits (468), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 96/231 (41%), Positives = 143/231 (61%), Gaps = 12/231 (5%)

Query: 23  LHDVMNIPADLSI------STWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRT 74
           LH    IPA  S        +W   V+T    T L   P LL+M T F R IIV  +LR 
Sbjct: 17  LHAYAAIPAITSQPLANGGQSWSLPVQTLIFITALGFIPALLLMTTSFTRIIIVLGLLRN 76

Query: 75  GMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWV 134
            +G  + PPN +++ LALFMTF+VMSP  D+  +    P    +IT    +   A+P   
Sbjct: 77  ALGTPTAPPNQILLGLALFMTFFVMSPVFDKIYQNAYLPFSEEKITIEVDLSEGAKPLRQ 136

Query: 135 FMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILP 194
           FM   TR+ DL+LF  +A+ S   T       +  RIL+P+F+ SEL+ +F+IGF++ +P
Sbjct: 137 FMLQQTRQPDLALFARLANDSEYQT----QADVPMRILVPAFITSELKTAFQIGFMLFIP 192

Query: 195 FLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FLIID++VA+++MA+GMMM+PP ++++PFK++ FVL+DGW L++ +L +SF
Sbjct: 193 FLIIDLVVASVLMALGMMMVPPATVAMPFKLMLFVLVDGWQLILGSLAQSF 243


>gi|160880831|ref|YP_001559799.1| flagellar biosynthetic protein FliP [Clostridium phytofermentans
           ISDg]
 gi|160429497|gb|ABX43060.1| flagellar biosynthetic protein FliP [Clostridium phytofermentans
           ISDg]
          Length = 281

 Score =  184 bits (468), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 134/194 (69%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIM+T F R I+V   +R+ +G  + PPN V+I LALF+T ++MSP +       +
Sbjct: 91  APSILIMLTSFIRIIVVLHFVRSALGTQTTPPNQVLIGLALFLTLFIMSPIITNINTNAV 150

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QPL   +IT+  A  +  EP   FM + T EKD+ LF+D+A      T++     +    
Sbjct: 151 QPLSKGEITQEQAFTQGMEPLRDFMFDQTNEKDMQLFLDIAGV----TEVNDRADVPSTA 206

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           LIP+F+ISELR +F IGFLI +PFLIIDM+VA+ +M+MGMMMLPPT+IS+PFK++ F++ 
Sbjct: 207 LIPAFIISELRAAFIIGFLIYIPFLIIDMVVASTLMSMGMMMLPPTTISMPFKILLFIMA 266

Query: 232 DGWSLLVENLVKSF 245
           DGW+L++ +++KSF
Sbjct: 267 DGWNLIIGSVIKSF 280


>gi|254474923|ref|ZP_05088309.1| flagellar biosynthetic protein FliP [Ruegeria sp. R11]
 gi|214029166|gb|EEB70001.1| flagellar biosynthetic protein FliP [Ruegeria sp. R11]
          Length = 247

 Score =  184 bits (468), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 93/212 (43%), Positives = 136/212 (64%), Gaps = 3/212 (1%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S+S   ++   + T+LS+AP LLIMVTCFP  + V SILR  +G+   PPN+++ISLALF
Sbjct: 37  SLSARSIQLILLITVLSLAPGLLIMVTCFPFLVTVLSILRQAIGLQQAPPNMMMISLALF 96

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T++VM P  + + + GI PL+  QI   T ++R   PF  FM       D   F  +A 
Sbjct: 97  LTYFVMEPVFNEAWQTGINPLIEEQIDVETGMERALVPFREFM---AARLDPDTFYAIAD 153

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
                  I          L+ SF++SE+ R+F++GFL+ LPFL+ID++VA ++M+MGMMM
Sbjct: 154 LRPGTAGIDPTPDAPLSTLVSSFLLSEIARAFQVGFLVFLPFLVIDLVVAAVLMSMGMMM 213

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +PP  +SLPFK+ FFV+ DGWSL+   LV+S+
Sbjct: 214 VPPAVVSLPFKLAFFVVADGWSLIASALVRSY 245


>gi|121596084|ref|YP_987980.1| flagellar biosynthesis protein FliP [Acidovorax sp. JS42]
 gi|120608164|gb|ABM43904.1| flagellar biosynthetic protein FliP [Acidovorax sp. JS42]
          Length = 251

 Score =  184 bits (468), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 134/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+M+T F R +IV S+LR  +G  S PPN VII L+LF+T +VM
Sbjct: 48  IQTLLFFTALSFLPAVLLMMTGFTRIVIVLSLLRQAIGTQSAPPNQVIIGLSLFLTLFVM 107

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PTLD+  +    P   N IT   AIQ+   P   FM   TR+ D +LF  +A      T
Sbjct: 108 GPTLDKVYQEAYVPYTTNAITFEQAIQKAEAPMRGFMLKQTRQSDFALFARLAKLDEGVT 167

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
             T       R+L+P+F+ SEL+ +F+IGF+I +PFLIIDM+V++++M++GMMML P  +
Sbjct: 168 AETA----PLRVLVPAFVTSELKSAFQIGFMIFIPFLIIDMVVSSVLMSLGMMMLSPVLV 223

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL DGW+LL+ +L  SF
Sbjct: 224 ALPFKLMLFVLADGWNLLIGSLAASF 249


>gi|323705431|ref|ZP_08117006.1| flagellar biosynthetic protein FliP [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535333|gb|EGB25109.1| flagellar biosynthetic protein FliP [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 249

 Score =  184 bits (468), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 136/194 (70%), Gaps = 5/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIM+T F R I+V S LR  +G+  +PPN V+I LALF+TF++M+P   +  +  I
Sbjct: 60  APSILIMMTSFTRIIVVLSFLRNALGLQQMPPNQVLIGLALFLTFFIMAPVGSQINKDSI 119

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QP M  +IT   A  +  +P   FM   TR+ DL+LF++++    ++ +      +  R+
Sbjct: 120 QPYMQGKITPQEAYVKARDPLKNFMLKQTRKNDLNLFINLSKLKVKSVN-----DVPLRV 174

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           +IPSF+ISEL+ +FEIGF+I +PFLIIDM+VA+++M+MGM MLPP  ISLPFK++ F+L+
Sbjct: 175 VIPSFIISELKTAFEIGFIIYIPFLIIDMVVASVLMSMGMFMLPPVLISLPFKLLLFILV 234

Query: 232 DGWSLLVENLVKSF 245
           DGW++L ++LV  F
Sbjct: 235 DGWNILAKSLVIGF 248


>gi|157371197|ref|YP_001479186.1| flagellar biosynthesis protein FliP [Serratia proteamaculans 568]
 gi|157322961|gb|ABV42058.1| flagellar biosynthetic protein FliP [Serratia proteamaculans 568]
          Length = 274

 Score =  184 bits (468), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 140/206 (67%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T LS  P +L+M+T F R IIV  +LR  +G  S PPN V++ LALF+TF++M
Sbjct: 71  VQTLVLLTSLSFLPAMLLMMTSFTRIIIVLGLLRNALGTPSAPPNQVMLGLALFLTFFIM 130

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP  D+  +    P   ++I+   A+ + ++P   FM   TRE DL+L+  +A+      
Sbjct: 131 SPVFDKVYQDAYLPFSQDKISLDVAMDKGSQPLREFMLRQTRETDLALYAKLANLP---- 186

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +  RIL+P+++ SEL+ +F+IGF + +PFLIID++VA+++MA+GMMM+PP +I
Sbjct: 187 PLAGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFLIIDLVVASVLMALGMMMVPPATI 246

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 247 SLPFKLMLFVLVDGWQLLLGSLAQSF 272


>gi|145598592|ref|YP_001162668.1| flagellar biosynthesis protein FliP [Yersinia pestis Pestoides F]
 gi|149366232|ref|ZP_01888267.1| flagellar biosynthetic protein FliP [Yersinia pestis CA88-4125]
 gi|153950312|ref|YP_001401271.1| flagellar biosynthesis protein FliP [Yersinia pseudotuberculosis IP
           31758]
 gi|165925983|ref|ZP_02221815.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938702|ref|ZP_02227257.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166010952|ref|ZP_02231850.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166210900|ref|ZP_02236935.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167420038|ref|ZP_02311791.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167425832|ref|ZP_02317585.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170024627|ref|YP_001721132.1| flagellar biosynthesis protein FliP [Yersinia pseudotuberculosis
           YPIII]
 gi|186895134|ref|YP_001872246.1| flagellar biosynthesis protein FliP [Yersinia pseudotuberculosis
           PB1/+]
 gi|218928941|ref|YP_002346816.1| flagellar biosynthesis protein FliP [Yersinia pestis CO92]
 gi|229896265|ref|ZP_04511435.1| flagellar biosynthetic protein FliP [Yersinia pestis Pestoides A]
 gi|229897202|ref|ZP_04512358.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229897929|ref|ZP_04513080.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229902840|ref|ZP_04517957.1| flagellar biosynthetic protein FliP [Yersinia pestis Nepal516]
 gi|270486627|ref|ZP_06203701.1| flagellar biosynthetic protein FliP [Yersinia pestis KIM D27]
 gi|294504013|ref|YP_003568075.1| flagellar biosynthesis protein [Yersinia pestis Z176003]
 gi|21959354|gb|AAM86043.1|AE013852_5 flagellar biosynthesis protein [Yersinia pestis KIM 10]
 gi|45436250|gb|AAS61806.1| flagellar biosynthesis protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51589311|emb|CAH20932.1| flagellar biosynthetic protein FliP [Yersinia pseudotuberculosis IP
           32953]
 gi|108776112|gb|ABG18631.1| flagellar biosynthetic protein FliP [Yersinia pestis Nepal516]
 gi|108779105|gb|ABG13163.1| flagellar biosynthetic protein FliP [Yersinia pestis Antiqua]
 gi|145210288|gb|ABP39695.1| flagellar biosynthetic protein FliP [Yersinia pestis Pestoides F]
 gi|149292645|gb|EDM42719.1| flagellar biosynthetic protein FliP [Yersinia pestis CA88-4125]
 gi|152961807|gb|ABS49268.1| flagellar biosynthetic protein FliP [Yersinia pseudotuberculosis IP
           31758]
 gi|165913316|gb|EDR31938.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165922187|gb|EDR39364.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165990296|gb|EDR42597.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166208080|gb|EDR52560.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166961733|gb|EDR57754.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167055231|gb|EDR65028.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169751161|gb|ACA68679.1| flagellar biosynthetic protein FliP [Yersinia pseudotuberculosis
           YPIII]
 gi|186698160|gb|ACC88789.1| flagellar biosynthetic protein FliP [Yersinia pseudotuberculosis
           PB1/+]
 gi|229680287|gb|EEO76386.1| flagellar biosynthetic protein FliP [Yersinia pestis Nepal516]
 gi|229688970|gb|EEO81035.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229693539|gb|EEO83588.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701188|gb|EEO89217.1| flagellar biosynthetic protein FliP [Yersinia pestis Pestoides A]
 gi|262361801|gb|ACY58522.1| flagellar biosynthesis protein [Yersinia pestis D106004]
 gi|262366063|gb|ACY62620.1| flagellar biosynthesis protein [Yersinia pestis D182038]
 gi|270335131|gb|EFA45908.1| flagellar biosynthetic protein FliP [Yersinia pestis KIM D27]
 gi|294354472|gb|ADE64813.1| flagellar biosynthesis protein [Yersinia pestis Z176003]
 gi|320015442|gb|ADV99013.1| flagellar biosynthetic protein FliP [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 274

 Score =  184 bits (468), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 146/227 (64%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  +++ P      +W   V+T    T LS  P  L+M+T F R IIV  +LR  MG 
Sbjct: 50  AQLPGIISQPLANGGQSWSLPVQTLVFITTLSFLPAALLMMTSFTRIIIVLGLLRNAMGT 109

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ LALF+TF++MSP  D+  +    P   ++I+   A+ + ++P   FM  
Sbjct: 110 PSAPPNQVMLGLALFLTFFIMSPVFDKVYQEAYLPFSQDKISMDVALDKGSQPLREFMLR 169

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+L+  +A+       +   + +  RIL+P+++ SEL+ +F+IGF + +PFLII
Sbjct: 170 QTRESDLALYARLANLP----PLEGPEMVPMRILLPAYVTSELKTAFQIGFTVFIPFLII 225

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D++VA+++MA+GMMM+PP SISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 226 DLVVASVLMALGMMMVPPASISLPFKLMLFVLVDGWQLLLGSLAQSF 272


>gi|330972449|gb|EGH72515.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 250

 Score =  184 bits (468), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/201 (45%), Positives = 133/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 51  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  +++   A+ +   P   FM   TR  DL LFM ++    + TDI   
Sbjct: 111 RVNQDALQPYLAEKLSAQDAVAKAQVPIKDFMLAQTRTSDLELFMRLS----KRTDIPTP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ISEL+ +F+IGF+I +PFLIIDM+VA+++MAMGMMML P  ISLPFK
Sbjct: 167 DAAPLTILVPAFVISELKTAFQIGFMIFIPFLIIDMVVASVLMAMGMMMLSPLIISLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L+V  L  SF
Sbjct: 227 IMLFVLVDGWALIVGTLAGSF 247


>gi|326796455|ref|YP_004314275.1| flagellar biosynthetic protein FliP [Marinomonas mediterranea
           MMB-1]
 gi|326547219|gb|ADZ92439.1| flagellar biosynthetic protein FliP [Marinomonas mediterranea
           MMB-1]
          Length = 251

 Score =  184 bits (468), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 138/201 (68%), Gaps = 3/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T L++ P  LIM+T F R IIV SILR  +G+   P N +I+ +ALF+T ++M PTLD
Sbjct: 52  IMTALTLLPSALIMMTSFTRIIIVLSILRQALGLQQAPSNQIILGMALFLTLFIMGPTLD 111

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  E  +QP +++ +T   A++  + P   FM   TRE D++LF+ +A    +   I   
Sbjct: 112 QINESALQPYLSDNMTSLQAVKAASIPIREFMLGQTREDDIALFVKLAG---KEGQIPSL 168

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           + + + IL+P+F+ SEL+ +F+IGF++ +PFLI+DM+VA+++MAMGMMML P  ISLPFK
Sbjct: 169 EDLPFTILMPAFVTSELKTAFQIGFMLFIPFLIVDMVVASVLMAMGMMMLSPIIISLPFK 228

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FV++DGWS+++  L  SF
Sbjct: 229 IMLFVMVDGWSMIMGTLAASF 249


>gi|238755315|ref|ZP_04616658.1| Flagellar biosynthetic protein fliP [Yersinia ruckeri ATCC 29473]
 gi|238706451|gb|EEP98825.1| Flagellar biosynthetic protein fliP [Yersinia ruckeri ATCC 29473]
          Length = 262

 Score =  184 bits (468), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 146/227 (64%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  +++ P      +W   V+T  + T LS  P  L+M+T F R IIV  +LR  +G 
Sbjct: 38  AQLPGIISQPLANGGQSWSLPVQTLVLITSLSFLPAALLMMTSFTRIIIVLGLLRNALGT 97

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ LALF+TF++MSP  D+  +    P   ++I+   AI + A+P   FM  
Sbjct: 98  PSAPPNQVMLGLALFLTFFIMSPVFDKVYQDAYLPFSQDKISMDIAIDKGAQPLREFMLR 157

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+L+  +A+           + +  RIL+P+++ SEL+ +F+IGF + +PFLII
Sbjct: 158 QTRETDLALYARLANMPA----FEGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFLII 213

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 214 DLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSF 260


>gi|260222420|emb|CBA31966.1| Flagellar biosynthetic protein fliP [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 218

 Score =  184 bits (467), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 135/207 (65%), Gaps = 4/207 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+M+T F R +IV S+LR  +G  S PPN VI+ L+LF+TF+VM
Sbjct: 15  IQTLLFFTALSFIPAVLLMMTGFTRIVIVLSLLRQALGTQSAPPNQVIVGLSLFLTFFVM 74

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PT DR      QP     ++   A+Q+   P   FM   TR+ D SLF  +A       
Sbjct: 75  GPTFDRIYADAYQPYSQGTMSFDQALQKAEVPIRNFMVKQTRQSDFSLFAKLAKLPPD-- 132

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
              K D    R+L+P+F+ISEL+ +F+IGF+I +PFL+ID++VA+++M++GMMML P  +
Sbjct: 133 --MKADTAPIRVLVPAFVISELKSAFQIGFMIFIPFLVIDIVVASVLMSLGMMMLSPVLV 190

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSFI 246
           +LPFK++ FVL DGW+LL+ +L  SF+
Sbjct: 191 ALPFKLMLFVLADGWNLLIGSLAASFV 217


>gi|330964683|gb|EGH64943.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 250

 Score =  184 bits (467), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/201 (45%), Positives = 133/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 51  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  ++T   A+ +   P   FM   TR  DL LFM ++    + TDI   
Sbjct: 111 RVNQDALQPYLAGKLTAQDAVAKAQVPIKDFMLAQTRTSDLELFMRLS----KRTDIPTP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ISEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 167 DAAPLTILVPAFVISELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L+V  L  SF
Sbjct: 227 IMLFVLVDGWALIVGTLAGSF 247


>gi|116694514|ref|YP_728725.1| flagellar biosynthesis protein FliP [Ralstonia eutropha H16]
 gi|113529013|emb|CAJ95360.1| flagellar biosynthesis protein [Ralstonia eutropha H16]
          Length = 261

 Score =  184 bits (467), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 98/224 (43%), Positives = 148/224 (66%), Gaps = 6/224 (2%)

Query: 25  DVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVP 82
            V++ PA      W   V+T  + T LS  P  ++++T F R IIV  +LR+ +G  + P
Sbjct: 41  GVISKPAPGGGQIWSLPVQTLVLLTSLSFLPAAMLLMTGFTRIIIVLGLLRSALGTATSP 100

Query: 83  PNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTRE 142
           PN V++ L+LF+TF+VM+P  DR      +PL  N+I+   A  + AEP   FM   TRE
Sbjct: 101 PNQVLVGLSLFLTFFVMAPVFDRVYNDAYKPLSENKISLEAAAAKAAEPLKAFMLRQTRE 160

Query: 143 KDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIV 202
           KDL++F  MA +     ++   + +   IL+P+F+ SEL+ +F+IGF I +PFLIID++V
Sbjct: 161 KDLAMFAQMAKAP----EMQGPEEVPLSILVPAFVTSELKTAFQIGFTIFIPFLIIDLVV 216

Query: 203 ATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           A+++MAMGMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF+
Sbjct: 217 ASVLMAMGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSFM 260


>gi|224418310|ref|ZP_03656316.1| flagellar biosynthesis protein FliP [Helicobacter canadensis MIT
           98-5491]
 gi|253827632|ref|ZP_04870517.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
           98-5491]
 gi|313141841|ref|ZP_07804034.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
           98-5491]
 gi|253511038|gb|EES89697.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
           98-5491]
 gi|313130872|gb|EFR48489.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
           98-5491]
          Length = 250

 Score =  184 bits (467), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 144/218 (66%), Gaps = 7/218 (3%)

Query: 28  NIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVI 87
           N PADL     I+    + T+L +AP L++M T F R +IVFS LRT +G    PP  ++
Sbjct: 39  NEPADL---VAILNIVVVLTLLVLAPSLILMATSFARLLIVFSFLRTALGTQQSPPTQLL 95

Query: 88  ISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSL 147
           +S AL +T ++M P      E G++P +  +I+   A  R ++PF  FM  NTR KDL+L
Sbjct: 96  VSFALILTMFIMEPVFKEGYEQGVKPYVAKEISYQEAFVRASQPFKDFMIRNTRPKDLAL 155

Query: 148 FMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVM 207
           F  +    +  T       + + I +P+F+ISE++ +F+IGFL+ LPFL+IDM++++I+M
Sbjct: 156 FYRIRGMENPQT----AQDVPFTIALPAFIISEMKTAFQIGFLLYLPFLVIDMVISSILM 211

Query: 208 AMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           AMGMMMLPPT ISLPFK++ F+L+DG++LL  NLV+SF
Sbjct: 212 AMGMMMLPPTMISLPFKILIFILVDGFNLLTMNLVESF 249


>gi|146282916|ref|YP_001173069.1| flagellar biosynthetic protein FliP [Pseudomonas stutzeri A1501]
 gi|145571121|gb|ABP80227.1| flagellar biosynthetic protein FliP [Pseudomonas stutzeri A1501]
          Length = 199

 Score =  184 bits (467), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 93/199 (46%), Positives = 130/199 (65%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T LS  P  ++++T F R IIVFSILR  +G+   P N ++I L LF+T ++M+P  DR 
Sbjct: 2   TALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILIGLTLFLTLFIMAPVFDRI 61

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            +  +QP ++ QI    AI R   P   FM   TRE DL LF+ ++      TDI   + 
Sbjct: 62  NQDALQPYLSEQIPAQEAIARAEVPLKNFMLAQTRESDLELFVRLSQ----RTDIASPEA 117

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
               IL+P+F+ SEL+ +F+IGF+I +PFLIIDM+VA+++MAMGMMML P  ISLPFK++
Sbjct: 118 APMTILVPAFVTSELKTAFQIGFMIFIPFLIIDMVVASVLMAMGMMMLSPLIISLPFKIM 177

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW L++  L  SF
Sbjct: 178 LFVLVDGWGLIIGTLAGSF 196


>gi|68343342|gb|AAY90948.1| flagellar biosynthetic protein FliP [Pseudomonas fluorescens Pf-5]
          Length = 241

 Score =  184 bits (467), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 132/201 (65%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 42  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFD 101

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  ++T   A+ +   P   FM   TR  DL LFM ++    + TDI   
Sbjct: 102 RVNQDALQPYLAEKLTAQDAVAKAQVPIKDFMLAQTRSSDLELFMRLS----KRTDIASP 157

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ SEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 158 DQAPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFK 217

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 218 IMLFVLVDGWALIIGTLAGSF 238


>gi|330961233|gb|EGH61493.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 250

 Score =  184 bits (467), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 92/201 (45%), Positives = 133/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 51  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  ++T   A+ +   P   FM   TR  DL LFM ++    + TDI   
Sbjct: 111 RVNQDALQPYLAEKLTAQDAVAKAQVPIKDFMLAQTRTSDLELFMRLS----KRTDIPTP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ISEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 167 DAAPLTILVPAFVISELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L+V  L  SF
Sbjct: 227 IMLFVLVDGWALIVGTLAGSF 247


>gi|71735211|ref|YP_275528.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555764|gb|AAZ34975.1| flagellar biosynthetic protein FliP [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320325127|gb|EFW81196.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329386|gb|EFW85379.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330889047|gb|EGH21708.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 250

 Score =  184 bits (467), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 153/248 (61%), Gaps = 23/248 (9%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPA-----------DLSISTWIVRTFGIFTILSIAPILLI 57
           L +VTP ++ A     D ++IPA           + S+S  I+    I T LS  P  ++
Sbjct: 12  LVMVTPAVLAA-----DPLSIPAITLSNGADGQQEYSVSLQILL---IMTALSFIPAFVM 63

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           ++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  DR  +  +QP +  
Sbjct: 64  LMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFDRVNQDALQPYLAE 123

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           +++   A+ +   P   FM   TR  DL LFM ++    + TDI   D     IL+P+F+
Sbjct: 124 KLSAQDAVAKAQVPIKDFMLAQTRTSDLELFMRLS----KRTDIPTPDAAPLTILVPAFV 179

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
           ISEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK++ FVL+DGW+L+
Sbjct: 180 ISELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFKIMLFVLVDGWALI 239

Query: 238 VENLVKSF 245
           V  L  SF
Sbjct: 240 VGTLAGSF 247


>gi|327399031|ref|YP_004339900.1| flagellar biosynthetic protein FliP [Hippea maritima DSM 10411]
 gi|327181660|gb|AEA33841.1| flagellar biosynthetic protein FliP [Hippea maritima DSM 10411]
          Length = 249

 Score =  184 bits (467), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 134/195 (68%), Gaps = 4/195 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIM+T F R IIV +ILR  +G   +PPN ++I +ALF+T ++MSP ++   +   
Sbjct: 58  APSILIMMTSFTRIIIVLAILRQALGTQQMPPNQILIGIALFLTLFIMSPQINTIYKTAY 117

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
            PL  N+IT   A +   +P   FM   TR+KDL+LF+ +A   +          +   I
Sbjct: 118 LPLQKNEITLEGAYKNATKPLKTFMLKQTRQKDLALFLRIAKKPNPKNP----QELSMDI 173

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           +IP+F+ISEL+ +FE+GF+I +PFLIIDM+V++I+M+MGMMMLPP  ISLPFK++ FVL 
Sbjct: 174 VIPAFIISELKTAFEMGFIIYIPFLIIDMVVSSILMSMGMMMLPPIMISLPFKLLIFVLA 233

Query: 232 DGWSLLVENLVKSFI 246
           DGW+L+V +L KSF+
Sbjct: 234 DGWNLVVMSLFKSFM 248


>gi|328496288|gb|AEB21292.1| FliP [Yersinia ruckeri]
          Length = 263

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 146/227 (64%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  +++ P      +W   V+T  + T LS  P  L+M+T F R IIV  +LR  +G 
Sbjct: 39  AQLPGIISQPLANGGQSWSLPVQTLVLITSLSFLPAALLMMTSFTRIIIVLGLLRNALGT 98

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ LALF+TF++MSP  D+  +    P   ++I+   AI + A+P   FM  
Sbjct: 99  PSAPPNQVMLGLALFLTFFIMSPVFDKVYQDAYLPFSQDKISMDIAIDKGAQPLREFMLR 158

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+L+  +A+           + +  RIL+P+++ SEL+ +F+IGF + +PFLII
Sbjct: 159 QTRETDLALYARLANMPA----FEGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFLII 214

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 215 DLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSF 261


>gi|237750901|ref|ZP_04581381.1| flagellar biosynthesis protein FliP [Helicobacter bilis ATCC 43879]
 gi|229373346|gb|EEO23737.1| flagellar biosynthesis protein FliP [Helicobacter bilis ATCC 43879]
          Length = 275

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 134/202 (66%), Gaps = 8/202 (3%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP L++M+T F R +IV   LRT +G    PP  V++SLA+ +TF++M P +  +  +GI
Sbjct: 71  APSLVLMMTSFTRILIVLGFLRTALGTQQSPPTQVLVSLAMILTFFIMEPVIKDAYNVGI 130

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTD--ITKN----- 164
           +P M  +I    A +    PF  FM  NTR  D++LF  + +      D   TK      
Sbjct: 131 KPYMEEKIGYEEAFEETMRPFKKFMLMNTRHSDIALFYKIRNEEPPQMDNITTKEQFEAL 190

Query: 165 -DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPF 223
            D +   I++PSFMISEL+ +F+IGFL+ LPFL+IDM++A+++MAMGMMMLPP  ISLPF
Sbjct: 191 IDKVSLSIILPSFMISELKTAFQIGFLLYLPFLVIDMVIASVLMAMGMMMLPPVMISLPF 250

Query: 224 KVIFFVLIDGWSLLVENLVKSF 245
           K++ FVL+DG++LL+ NLV+SF
Sbjct: 251 KILIFVLVDGFNLLIWNLVRSF 272


>gi|123442774|ref|YP_001006751.1| flagellar biosynthesis protein FliP [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089735|emb|CAL12588.1| flagellar biosynthetic protein FliP [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 228

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 147/229 (64%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T    T LS  P  L+M+T F R IIV  +LR  +
Sbjct: 2   AMAQLPGIISQPLANGGQSWSLPVQTLVFITTLSFLPAALLMMTSFTRIIIVLGLLRNAL 61

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ LALF+TF++MSP  D+  +    P   ++I+   A+ + ++P   FM
Sbjct: 62  GTPSAPPNQVMLGLALFLTFFIMSPVFDKVYQDAYLPFSQDKISMEVAMDKGSQPLREFM 121

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+L+  +A+       +   + +  RIL+P+++ SEL+ +F+IGF + +PFL
Sbjct: 122 LRQTRESDLALYARLANLPP----LEGPEVVPLRILLPAYVTSELKTAFQIGFTVFIPFL 177

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID++VA+++MA+GMMM+PP SISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 178 IIDLVVASVLMALGMMMVPPASISLPFKLMLFVLVDGWQLLLGSLAQSF 226


>gi|238758099|ref|ZP_04619279.1| Flagellar biosynthetic protein fliP [Yersinia aldovae ATCC 35236]
 gi|238703637|gb|EEP96174.1| Flagellar biosynthetic protein fliP [Yersinia aldovae ATCC 35236]
          Length = 249

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 146/229 (63%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T    T LS  P  L+M+T F R IIV  +LR  +
Sbjct: 23  ALAQLPGIISQPLANGGQSWSLPVQTLVFITTLSFLPAALLMMTSFTRIIIVLGLLRNAL 82

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ L LF+TF++MSP  D+  +    P   ++I+   AI + A+P   FM
Sbjct: 83  GTPSAPPNQVMLGLTLFLTFFIMSPVFDKVYQDAYLPFSQDKISMEVAIDKGAQPLREFM 142

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+L+  +A+       +   + +  RIL+P+++ SEL+ +F+IGF + +PFL
Sbjct: 143 LRQTRESDLALYARLANLPP----LEGPEVVPMRILLPAYVTSELKTAFQIGFTVFIPFL 198

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID++VA+++MA+GMMM+PP SISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 199 IIDLVVASVLMALGMMMVPPASISLPFKLMLFVLVDGWQLLLGSLAQSF 247


>gi|254228442|ref|ZP_04921868.1| flagellar biosynthetic protein FliP, putative [Vibrio sp. Ex25]
 gi|262393598|ref|YP_003285452.1| flagellar biosynthesis protein FliP [Vibrio sp. Ex25]
 gi|151939030|gb|EDN57862.1| flagellar biosynthetic protein FliP, putative [Vibrio sp. Ex25]
 gi|262337192|gb|ACY50987.1| flagellar biosynthesis protein FliP [Vibrio sp. Ex25]
          Length = 289

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 137/214 (64%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 82  DYSVTLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 138

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VMSP L+   +  +QP +N Q+T   A      P   FM   TR KDL  F+ M
Sbjct: 139 LFLTFFVMSPVLNEINDKAVQPYLNEQVTAREAFDAAQAPMKAFMLKQTRIKDLETFVTM 198

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +     N +      +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 199 SGEQVENPE-----DVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 253

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 254 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 287


>gi|91223555|ref|ZP_01258820.1| flagellar biosynthesis protein P [Vibrio alginolyticus 12G01]
 gi|91191641|gb|EAS77905.1| flagellar biosynthesis protein P [Vibrio alginolyticus 12G01]
          Length = 289

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 137/214 (64%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 82  DYSVTLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 138

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VMSP L+   +  +QP +N Q+T   A      P   FM   TR KDL  F+ M
Sbjct: 139 LFLTFFVMSPVLNEINDKAVQPYLNEQVTAREAFDAAQAPMKAFMLKQTRIKDLETFVTM 198

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +     N +      +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 199 SGEQVENPE-----DVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 253

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 254 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 287


>gi|330876029|gb|EGH10178.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|331016991|gb|EGH97047.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 250

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/201 (45%), Positives = 133/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 51  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  ++T   A+ +   P   FM   TR  DL LFM ++    + TDI   
Sbjct: 111 RVNQDALQPYLAEKLTAQDAVAKAQVPIKDFMLAQTRTSDLELFMRLS----KRTDIPTP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ISEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 167 DAAPLTILVPAFVISELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L+V  L  SF
Sbjct: 227 IMLFVLVDGWALIVGTLAGSF 247


>gi|28869176|ref|NP_791795.1| flagellar biosynthetic protein FliP [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967547|ref|ZP_03395695.1| flagellar biosynthetic protein FliP [Pseudomonas syringae pv.
           tomato T1]
 gi|301382884|ref|ZP_07231302.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           tomato Max13]
 gi|302061094|ref|ZP_07252635.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           tomato K40]
 gi|302131290|ref|ZP_07257280.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28852416|gb|AAO55490.1| flagellar biosynthetic protein FliP [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927848|gb|EEB61395.1| flagellar biosynthetic protein FliP [Pseudomonas syringae pv.
           tomato T1]
          Length = 250

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/201 (45%), Positives = 133/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 51  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  ++T   A+ +   P   FM   TR  DL LFM ++    + TDI   
Sbjct: 111 RVNQDALQPYLAEKLTAQDAVAKAQVPIKDFMLAQTRTSDLELFMRLS----KRTDIPTP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ISEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 167 DAAPLTILVPAFVISELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L+V  L  SF
Sbjct: 227 IMLFVLVDGWALIVGTLAGSF 247


>gi|258592488|emb|CBE68797.1| Flagellar transport protein FliP [NC10 bacterium 'Dutch sediment']
          Length = 243

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 135/201 (67%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+L++AP L+IM+T F R IIV S LRT MG   +PPN V+I L LF+TF+VM+P  +
Sbjct: 46  LLTLLAMAPALVIMLTSFSRIIIVLSFLRTAMGTQQMPPNQVLIGLTLFLTFFVMAPVGE 105

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +     +QP ++ Q+ +  A++R  +P   FM   TRE+DL+L + +A            
Sbjct: 106 QINREALQPYLSRQLAQEAALERALQPLRTFMFKQTRERDLALMVHLARLERPKDRAAVP 165

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
            H    +L+P++ ISELR +F+IGF++ +PFL+IDM+V++++++MGM+ LPP  IS PFK
Sbjct: 166 TH----VLVPAYAISELRTAFQIGFVLFIPFLVIDMVVSSVLISMGMLFLPPPVISFPFK 221

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL DGW L+V +LV  F
Sbjct: 222 LLLFVLADGWHLVVRSLVIGF 242


>gi|330861094|emb|CBX71361.1| flagellar biosynthetic protein fliP [Yersinia enterocolitica
           W22703]
          Length = 237

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 147/229 (64%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T    T LS  P  L+M+T F R IIV  +LR  +
Sbjct: 11  AMAQLPGIISQPLANGGQSWSLPVQTLVFITTLSFLPAALLMMTSFTRIIIVLGLLRNAL 70

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ LALF+TF++MSP  D+  +    P   ++I+   A+ + ++P   FM
Sbjct: 71  GTPSAPPNQVMLGLALFLTFFIMSPVFDKVYQDAYLPFSQDKISMEVAMDKGSQPLREFM 130

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+L+  +A+       +   + +  RIL+P+++ SEL+ +F+IGF + +PFL
Sbjct: 131 LRQTRESDLALYARLANLP----PLEGPEVVPLRILLPAYVTSELKTAFQIGFTVFIPFL 186

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID++VA+++MA+GMMM+PP SISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 187 IIDLVVASVLMALGMMMVPPASISLPFKLMLFVLVDGWQLLLGSLAQSF 235


>gi|258514015|ref|YP_003190237.1| flagellar biosynthesis protein FliP [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257777720|gb|ACV61614.1| flagellar biosynthetic protein FliP [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 256

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 131/193 (67%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +L+M+T F R +IV S LR  +G    PPN V+I LALF+T ++M P  +   E  ++
Sbjct: 67  PAILLMMTSFTRIVIVLSFLRNALGTQQTPPNQVLIGLALFLTVFIMKPVYNDLNEQALK 126

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P + NQIT+  A  R A P   FM   TRE DL+LF+ +A +        +ND +   ++
Sbjct: 127 PYLANQITQEEAQNRAAGPLKEFMLKQTRESDLALFIGVAKAQKPQN---RND-VPLHLV 182

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           IP+F+ISEL+ SF++GFLI +PFL+ID +VA+ +M+MGM MLPP   SLPFK++ FV++D
Sbjct: 183 IPAFIISELKTSFQMGFLIYIPFLVIDAVVASTLMSMGMFMLPPAMFSLPFKLLLFVMVD 242

Query: 233 GWSLLVENLVKSF 245
           GW L+V++LV+SF
Sbjct: 243 GWYLVVKSLVESF 255


>gi|328958270|ref|YP_004375656.1| flagellar biosynthesis protein FliP [Carnobacterium sp. 17-4]
 gi|328674594|gb|AEB30640.1| flagellar biosynthesis protein FliP [Carnobacterium sp. 17-4]
          Length = 254

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 157/249 (63%), Gaps = 16/249 (6%)

Query: 7   FALFLVT----PELVFAK------SSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILL 56
           F LFL++    P++V A       S L + +   ++   ++ +V+ F + T LS+AP  L
Sbjct: 11  FTLFLMSSLLFPQVVTAAEITDGLSGLSEALG--SETGETSQVVQLFLLTTALSLAPTFL 68

Query: 57  IMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMN 116
           ++ TCF R I+V S +R+ +G    PPNLV++ +ALF++ ++M P     +   I P +N
Sbjct: 69  VLTTCFTRIIVVLSFVRSSLGTQQNPPNLVLMGIALFLSLFIMQPVYTDVMNEAITPYIN 128

Query: 117 NQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSF 176
            +I+   A +    P   FM   TR++D+ LF+D++ ++ +  D+     +   + IP+F
Sbjct: 129 EEISGQAAFESAELPIKEFMYKQTRDEDIQLFLDISETA-KPADV---KELPLTVAIPAF 184

Query: 177 MISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSL 236
           +ISELR +F IGFLI +PFL+ID++VA+I+M+MGM ML P  ISLPFK++ FVL+DGW L
Sbjct: 185 IISELRTAFSIGFLIFIPFLVIDIVVASILMSMGMFMLSPVMISLPFKLLLFVLVDGWYL 244

Query: 237 LVENLVKSF 245
           +VE+LV  F
Sbjct: 245 VVESLVTGF 253


>gi|238788324|ref|ZP_04632118.1| Flagellar biosynthetic protein fliP [Yersinia frederiksenii ATCC
           33641]
 gi|238723570|gb|EEQ15216.1| Flagellar biosynthetic protein fliP [Yersinia frederiksenii ATCC
           33641]
          Length = 243

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 147/229 (64%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T    T LS  P  L+M+T F R IIV  +LR  +
Sbjct: 17  ALAQLPGIISQPLANGGQSWSLPVQTLVFITTLSFLPAALLMMTSFTRIIIVLGLLRNAL 76

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ LALF+TF++MSP  D+  +    P   ++I+   A+ + ++P   FM
Sbjct: 77  GTPSAPPNQVMLGLALFLTFFIMSPVFDKVYQDAYLPFSQDKISMEVAMDKGSQPLREFM 136

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+L+  +A+       +   + +  RIL+P+++ SEL+ +F+IGF + +PFL
Sbjct: 137 LRQTRESDLALYARLANIPA----LEGPEVVPMRILLPAYVTSELKTAFQIGFTVFIPFL 192

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID++VA+++MA+GMMM+PP SISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 193 IIDLVVASVLMALGMMMVPPASISLPFKLMLFVLVDGWQLLLGSLAQSF 241


>gi|188592196|ref|YP_001796794.1| flagellar biosynthesis protein flip [Cupriavidus taiwanensis LMG
           19424]
 gi|170938570|emb|CAP63557.1| fliP: flagellar biosynthesis protein. fliP/mopC/spaP family
           [Cupriavidus taiwanensis LMG 19424]
          Length = 274

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/224 (43%), Positives = 147/224 (65%), Gaps = 6/224 (2%)

Query: 25  DVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVP 82
            V++ PA      W   V+T  + T LS  P  ++M+T F R IIV  +LR  +G  + P
Sbjct: 54  GVISKPAPGGGQIWSLPVQTLVLLTSLSFLPAAMLMMTGFTRVIIVLGLLRNALGTATSP 113

Query: 83  PNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTRE 142
           PN V++ L+LF+TF+VM+P  DR      +PL  N+++   A  + AEP   FM   TRE
Sbjct: 114 PNQVLVGLSLFLTFFVMAPVFDRVYNDAYKPLSENKLSLEAAAAKAAEPLKAFMLRQTRE 173

Query: 143 KDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIV 202
           KDL++F  MA +     ++   + +   IL+P+F+ SEL+ +F+IGF I +PFLIID++V
Sbjct: 174 KDLAMFAQMAKAP----EMQGPEEVPLSILVPAFVTSELKTAFQIGFTIFIPFLIIDLVV 229

Query: 203 ATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           A+++MAMGMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF+
Sbjct: 230 ASVLMAMGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSFM 273


>gi|161501973|ref|YP_258777.2| flagellar biosynthesis protein FliP [Pseudomonas fluorescens Pf-5]
          Length = 249

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 132/201 (65%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 50  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFD 109

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  ++T   A+ +   P   FM   TR  DL LFM ++    + TDI   
Sbjct: 110 RVNQDALQPYLAEKLTAQDAVAKAQVPIKDFMLAQTRSSDLELFMRLS----KRTDIASP 165

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ SEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 166 DQAPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFK 225

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 226 IMLFVLVDGWALIIGTLAGSF 246


>gi|89899371|ref|YP_521842.1| flagellar biosynthesis protein FliP [Rhodoferax ferrireducens T118]
 gi|89344108|gb|ABD68311.1| flagellar biosynthetic protein FliP [Rhodoferax ferrireducens T118]
          Length = 260

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/217 (42%), Positives = 141/217 (64%), Gaps = 5/217 (2%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P+ +S S  I +T   FT LS  P +L+M+T F R +IV S++R  +G  S PPN VI+ 
Sbjct: 48  PSGVSFSVPI-QTLLFFTALSFLPAVLLMMTGFTRIVIVLSLMRQALGTQSAPPNQVIVG 106

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+TF VM PTLD+       P  N+ +    A+ +  +P   FM   TR+ DL+LF 
Sbjct: 107 LSLFLTFLVMGPTLDKVYSEAYLPYTNSGMPFEQALAKAEDPLRQFMSKQTRQSDLALFA 166

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            +A      T  T    +  R+L+P+F+ SEL+ +F+IGF+I +PFL+ID++VA+++M++
Sbjct: 167 KLAKLEPGATAQT----VPMRVLVPAFVTSELKSAFQIGFMIFIPFLVIDIVVASVLMSL 222

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           GMMML P  ++LPFK++ FVL DGW+LL+ +L  SF+
Sbjct: 223 GMMMLSPVLVALPFKLMLFVLADGWNLLIGSLAASFV 259


>gi|254457934|ref|ZP_05071361.1| flagellar biosynthetic protein FliP [Campylobacterales bacterium GD
           1]
 gi|207085327|gb|EDZ62612.1| flagellar biosynthetic protein FliP [Campylobacterales bacterium GD
           1]
          Length = 244

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 133/193 (68%), Gaps = 4/193 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +++++T F RF+IVF  LR  +G   VPP  +++ LA+ +TF+VM P   ++ + GI
Sbjct: 54  APSMVLVMTTFTRFVIVFGFLRQALGTQQVPPTQLLVMLAMILTFFVMEPIGQKAYDNGI 113

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           +P +  +I    A ++   PF  FM  NTREKDL+LF  +    +  T       +   +
Sbjct: 114 KPYIEEKIGYEEAFEKSTLPFKNFMIRNTREKDLALFFRIRGMENPAT----VSDVPLSV 169

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           +IPSF+ISEL+ +FEIGFL+ LPFL+IDM+VA+I+M+MGMMMLPP  ISLPFK++ FVLI
Sbjct: 170 IIPSFVISELKTAFEIGFLLFLPFLVIDMVVASILMSMGMMMLPPVMISLPFKILVFVLI 229

Query: 232 DGWSLLVENLVKS 244
           DGWSLL+ NL+ +
Sbjct: 230 DGWSLLIGNLIAT 242


>gi|307264883|ref|ZP_07546445.1| flagellar biosynthetic protein FliP [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|326389467|ref|ZP_08211034.1| flagellar biosynthetic protein FliP [Thermoanaerobacter ethanolicus
           JW 200]
 gi|306920141|gb|EFN50353.1| flagellar biosynthetic protein FliP [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|325994472|gb|EGD52897.1| flagellar biosynthetic protein FliP [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 221

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 132/194 (68%), Gaps = 5/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIM+T F R ++V S LR  +G+  +PPN V+I LALF+T Y+M+P         I
Sbjct: 32  APSILIMMTSFTRIVVVLSFLRNALGLQQMPPNQVLIGLALFLTLYIMAPVGQDINNNAI 91

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           +P    +IT+  A Q   +P   FM   TR+ DL+LF+ +A     N +      +  R+
Sbjct: 92  KPYTEGKITQEEAYQNAIKPLKNFMLKQTRQSDLNLFVSLAKIKVNNAE-----DLPMRV 146

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           +IPSF+ISEL+ +FEIGF+I +PFLIID++VA+++M+MGM MLPP  ISLPFKV+ F+L+
Sbjct: 147 VIPSFIISELKTAFEIGFIIYIPFLIIDIVVASVLMSMGMFMLPPVLISLPFKVLLFILV 206

Query: 232 DGWSLLVENLVKSF 245
           DGW+L+V++L+  F
Sbjct: 207 DGWNLVVKSLILGF 220


>gi|126463729|ref|YP_001044843.1| flagellar biosynthesis protein FliP [Rhodobacter sphaeroides ATCC
           17029]
 gi|126105393|gb|ABN78071.1| flagellar biosynthetic protein FliP [Rhodobacter sphaeroides ATCC
           17029]
          Length = 238

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/212 (42%), Positives = 135/212 (63%), Gaps = 5/212 (2%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S++   V+   + T+LS+ P L +M+TCFP  + V SILR  +G+   PPN++I+SLALF
Sbjct: 31  SLTARSVQLIAVITLLSLVPALAMMITCFPFIVTVLSILRQAIGLQQAPPNMLIVSLALF 90

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T+YVM P    +   GI PL  N++    A+   A PF  FM        L+     A 
Sbjct: 91  LTWYVMDPVFTEAWTRGIGPLTRNELDLPQALAAAAVPFRGFMTGRIDPDTLA-----AL 145

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            + R           + +L+PSF++SE++R+FEIGFLI LPFLIID++V+ ++M+MGMMM
Sbjct: 146 QALRPGPAAPPSEASFSVLVPSFLLSEIQRAFEIGFLIYLPFLIIDLVVSAVLMSMGMMM 205

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +PP  +S+PFK+ FFV+ DGWSL+   LV+S+
Sbjct: 206 VPPAVVSMPFKLAFFVVADGWSLISGALVRSY 237


>gi|260776473|ref|ZP_05885368.1| flagellar biosynthesis protein FliP [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607696|gb|EEX33961.1| flagellar biosynthesis protein FliP [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 244

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 136/206 (66%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A+F+TF++M
Sbjct: 42  LQILALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIAIFLTFFIM 101

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP L+   +  IQP +N QIT   A      P   FM   TR KDL  F++++ S     
Sbjct: 102 SPVLNEINDKAIQPYINEQITARQAFDVAQAPMKDFMLKQTRVKDLETFVNISGS----- 156

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           D T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGMMML P  +
Sbjct: 157 DATAPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGMMMLSPMIV 216

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 217 SLPFKLMLFVLVDGWNLILSTLAGSF 242


>gi|304316893|ref|YP_003852038.1| flagellar biosynthetic protein FliP [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778395|gb|ADL68954.1| flagellar biosynthetic protein FliP [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 249

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 136/194 (70%), Gaps = 5/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIM+T F R I+V S LR  +G+  +PPN V+I L+LF+TF++M+P   +     I
Sbjct: 60  APSILIMMTSFTRIIVVLSFLRNALGLQQMPPNQVLIGLSLFLTFFIMAPVGVQINNDSI 119

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QP M  +IT   A  +  +P   FM   TR+ DL+LF+++A    ++     ND I  R+
Sbjct: 120 QPYMQGKITPQVAYVKARDPLKNFMLKQTRKNDLNLFINLAKIKVKSV----ND-IPLRV 174

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           +IPSF+ISEL+ +FEIGF+I +PFLIIDM+VA+++M+MGM MLPP  ISLPFK++ F+L+
Sbjct: 175 VIPSFIISELKTAFEIGFIIYIPFLIIDMVVASVLMSMGMFMLPPVLISLPFKLLLFILV 234

Query: 232 DGWSLLVENLVKSF 245
           DGW++L ++LV  F
Sbjct: 235 DGWNILAKSLVIGF 248


>gi|30248477|ref|NP_840547.1| flagellar biosynthesis protein FliP [Nitrosomonas europaea ATCC
           19718]
 gi|30138363|emb|CAD84372.1| Flagella transport protein FliP family [Nitrosomonas europaea ATCC
           19718]
          Length = 268

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 134/193 (69%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +++M++ F R IIV S+LR  MG  S PPN V++ LALF++F++MSP +D+       
Sbjct: 78  PAVILMMSSFTRIIIVLSLLRQAMGTQSSPPNQVLLGLALFLSFFIMSPVIDKVYTEAYL 137

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P   ++I+   A+++  +P   FM   TRE D++LF  +A     N +I   D +  +IL
Sbjct: 138 PFSEDKISIVEAMEKAGDPLKSFMLRQTREADIALFARIAE----NGEIESPDQVPMKIL 193

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+++ SEL+ +F+IGF++ +PFLIIDM+VA+ +MAMGMMML P  ISLPFK++ FVL+D
Sbjct: 194 VPAYITSELKTAFQIGFVVFIPFLIIDMVVASTLMAMGMMMLSPMIISLPFKLMLFVLVD 253

Query: 233 GWSLLVENLVKSF 245
           GW+LL+ +L +SF
Sbjct: 254 GWNLLIGSLTQSF 266


>gi|251772432|gb|EES52999.1| flagellar biosynthetic protein FliP [Leptospirillum
           ferrodiazotrophum]
          Length = 272

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 135/194 (69%), Gaps = 3/194 (1%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +L+M+T F R ++V S LR  +G   VPPN V++ L+LF+TF++M+P         I
Sbjct: 81  APAILVMMTSFTRIVVVLSFLRQALGTAQVPPNQVMVGLSLFLTFFIMAPVWQTMNRTAI 140

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QP +  +I    A+ R   P   FM    R+KDL++F  +AH     T  +++D   Y +
Sbjct: 141 QPYLAKEIAPDVALTRGMAPVRDFMFRQVRKKDLAMFERIAHLP--ETPASRDDIPTY-V 197

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           LIP+F++SEL  +FE+GFLI LPFLI+D++V++++M+MGMMMLPPT +SLPFK++ FVL+
Sbjct: 198 LIPAFVVSELSTAFEMGFLIYLPFLILDVVVSSVLMSMGMMMLPPTVVSLPFKILLFVLV 257

Query: 232 DGWSLLVENLVKSF 245
           DGWSL+V +LV+SF
Sbjct: 258 DGWSLIVGSLVQSF 271


>gi|299068762|emb|CBJ40002.1| fliP: flagellar biosynthesis protein. fliP/mopC/spaP family
           [Ralstonia solanacearum CMR15]
          Length = 249

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 134/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L   P +L+M++ F R IIV S+LR  +G  + PPN V+I LALF+TF+VM
Sbjct: 46  VQTLVFLTSLGFLPAILLMMSSFTRIIIVLSLLRHALGTQTTPPNQVLIGLALFLTFFVM 105

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD+       PL +++I+   A+   A P   FM   TRE DL+LF  M +      
Sbjct: 106 SPVLDKVYTDAYLPLRDSKISVEQALDTAATPLRQFMLKQTREPDLALFAKMGNLP---- 161

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            I   D +  R LIP+F+ SEL+ SF+IGF I +PFL+ID++VA ++M+MGMMM+ P+  
Sbjct: 162 PIASPDQVPMRALIPAFVTSELKTSFQIGFAIFIPFLVIDIVVAAVLMSMGMMMVTPSIF 221

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 222 SLPFKIMLFVLVDGWHLLLGSLAQSF 247


>gi|66046673|ref|YP_236514.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           syringae B728a]
 gi|289678972|ref|ZP_06499862.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           syringae FF5]
 gi|63257380|gb|AAY38476.1| Flagellar transport protein FliP [Pseudomonas syringae pv. syringae
           B728a]
 gi|330899441|gb|EGH30860.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330976008|gb|EGH76074.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 250

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 133/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 51  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQAPSNQILTGMALFLTMFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  +++   A+ +   P   FM   TR  DL LFM ++    + TDI   
Sbjct: 111 RVNQDALQPYLAEKLSAQDAVAKAQVPIKDFMLAQTRTSDLELFMRLS----KRTDIPTP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ISEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 167 DAAPLTILVPAFVISELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L+V  L  SF
Sbjct: 227 IMLFVLVDGWALIVGTLAGSF 247


>gi|254506844|ref|ZP_05118983.1| flagellar biosynthetic protein FliP [Vibrio parahaemolyticus 16]
 gi|219550129|gb|EED27115.1| flagellar biosynthetic protein FliP [Vibrio parahaemolyticus 16]
          Length = 244

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 138/206 (66%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A+F+TF++M
Sbjct: 42  LQILALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIAIFLTFFIM 101

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP L++  ++ +QP +N QIT   A      P   FM   TR KDL  F++++ S+    
Sbjct: 102 SPVLNKINDVAVQPYINEQITAREAFDLAQAPMKDFMLKQTRVKDLETFVNISGSTA--- 158

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
             T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGMMML P  +
Sbjct: 159 --TAPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGMMMLSPMIV 216

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 217 SLPFKLMLFVLVDGWNLILSTLAGSF 242


>gi|238782830|ref|ZP_04626859.1| Flagellar biosynthetic protein fliP [Yersinia bercovieri ATCC
           43970]
 gi|238716253|gb|EEQ08236.1| Flagellar biosynthetic protein fliP [Yersinia bercovieri ATCC
           43970]
          Length = 257

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 158/238 (66%), Gaps = 13/238 (5%)

Query: 8   ALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFII 67
           +++    +L+ A+S+  +  ++P         V+T  + T L+  P +L+M+T F R II
Sbjct: 31  SVWAANADLMVARSADGENWSLP---------VQTLVLLTSLTFLPAILLMMTGFTRIII 81

Query: 68  VFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQR 127
           V  +LR  +G  S PPN V+++LALF+TFYVMSP  ++  +   QPL  ++I+  TA++R
Sbjct: 82  VLGLLRNALGTPSTPPNQVLLALALFLTFYVMSPVFNQIYKEAWQPLSEDKISMETALER 141

Query: 128 VAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEI 187
             +P  VFM   TRE DL+L+  MA    +  +    D +  R+L+P+F+ SEL+  F+I
Sbjct: 142 GVQPLRVFMLEQTRESDLALYARMA----KEENFQSKDDVPLRVLLPAFVTSELKTGFQI 197

Query: 188 GFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GF + +PFLIID++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 198 GFTVFIPFLIIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLMGSLAQSF 255


>gi|238764402|ref|ZP_04625352.1| Flagellar biosynthetic protein fliP [Yersinia kristensenii ATCC
           33638]
 gi|238697428|gb|EEP90195.1| Flagellar biosynthetic protein fliP [Yersinia kristensenii ATCC
           33638]
          Length = 243

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 147/229 (64%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T    T LS  P  L+M+T F R IIV  +LR  +
Sbjct: 17  ALAQLPGIISQPLANGGQSWSLPVQTLVFITTLSFLPAALLMMTSFTRIIIVLGLLRNAL 76

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ LALF+TF++MSP  D+  +    P   ++I+   A+ + ++P   FM
Sbjct: 77  GTPSAPPNQVMLGLALFLTFFIMSPVFDKVYQDAYLPFSQDKISMEVAMDKGSQPLREFM 136

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+L+  +A+       +   + +  RIL+P+++ SEL+ +F+IGF + +PFL
Sbjct: 137 LRQTRESDLALYARLANLPP----LEGPEVVPMRILLPAYVTSELKTAFQIGFTVFIPFL 192

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID++VA+++MA+GMMM+PP SISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 193 IIDLVVASVLMALGMMMVPPASISLPFKLMLFVLVDGWQLLLGSLAQSF 241


>gi|169827136|ref|YP_001697294.1| flagellar biosynthesis protein FliP [Lysinibacillus sphaericus
           C3-41]
 gi|168991624|gb|ACA39164.1| Flagellar biosynthetic protein [Lysinibacillus sphaericus C3-41]
          Length = 221

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 135/194 (69%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LI++T F R +IV S +RT +    +PPN VI+ LALF+TF++M+PT     +  +
Sbjct: 32  APSILILMTSFARIVIVLSFVRTALATQQMPPNQVIVGLALFLTFFIMAPTFQEVNKEAL 91

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QPL + +I    A  R + PF  FM  +TR+KDL LF+    S ++       + I   +
Sbjct: 92  QPLFSEEIGLEEAYDRASLPFKEFMSKHTRQKDLDLFL----SYNQAEKPASVEEIPLTM 147

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F +SE++ +F+IGF+I +PFL+IDMIVA+ +M+MGMMMLPP  ISLPFK++ FVL+
Sbjct: 148 LVPAFALSEIKTAFQIGFMIFIPFLVIDMIVASTLMSMGMMMLPPVMISLPFKILLFVLV 207

Query: 232 DGWSLLVENLVKSF 245
           DGW L++++L++SF
Sbjct: 208 DGWYLVMKSLLQSF 221


>gi|226941268|ref|YP_002796342.1| flagellar biosynthesis protein FliP [Laribacter hongkongensis
           HLHK9]
 gi|226716195|gb|ACO75333.1| FliP [Laribacter hongkongensis HLHK9]
          Length = 251

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/199 (44%), Positives = 138/199 (69%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T L+  P LL+M+T F R +IV S+LR  +G+   PPN VI+ L+LF+T +VM+P  D++
Sbjct: 54  TSLTFIPALLLMMTAFTRIVIVLSLLRQAIGLMQSPPNQVIVGLSLFLTLFVMAPVFDQA 113

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
                 P  ++Q+    A ++  +PF  FM   TREKDL+ F+++A  +   T       
Sbjct: 114 YREAWLPYSDSQMNFMQAAEKGVQPFKGFMLKQTREKDLAFFVEIAREAPPATP----AD 169

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           +  + LIP+F++SEL+ +F+IGF++ +PFLIID++VA+++MAMGMMM+ P  ISLPFK++
Sbjct: 170 VSLKTLIPAFVVSELKTAFQIGFMVFIPFLIIDLVVASVLMAMGMMMVSPVIISLPFKLM 229

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW+LL+ +LV+SF
Sbjct: 230 LFVLVDGWTLLIGSLVQSF 248


>gi|207728358|ref|YP_002256752.1| flagellar biosynthetic protein flip [Ralstonia solanacearum MolK2]
 gi|206591604|emb|CAQ57216.1| flagellar biosynthetic protein flip [Ralstonia solanacearum MolK2]
          Length = 252

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 134/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L   P +L+M++ F R IIV S+LR  +G  + PPN V+I LALF+TF+VM
Sbjct: 49  VQTLVFLTSLGFLPAILLMMSSFTRIIIVLSLLRHALGTQTTPPNQVLIGLALFLTFFVM 108

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD+       PL +++I+   A+   A P   FM   TRE DL+LF  M +      
Sbjct: 109 SPVLDKVYTDAYVPLRDSKISVEQALDTAATPLRQFMLKQTREPDLALFAKMGNLP---- 164

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            I   D +  R LIP+F+ SEL+ SF+IGF I +PFL+ID++VA ++M+MGMMM+ P+  
Sbjct: 165 PIASPDQVPMRALIPAFVTSELKTSFQIGFAIFIPFLVIDIVVAAVLMSMGMMMVTPSIF 224

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 225 SLPFKIMLFVLVDGWHLLLGSLAQSF 250


>gi|119476307|ref|ZP_01616658.1| flagellar biosynthesis protein [marine gamma proteobacterium
           HTCC2143]
 gi|119450171|gb|EAW31406.1| flagellar biosynthesis protein [marine gamma proteobacterium
           HTCC2143]
          Length = 270

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 141/209 (67%), Gaps = 4/209 (1%)

Query: 37  TWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTF 96
           T  ++   + T+L++ P  L+M+T F R I+V +ILR  +G+ S P N +I+ LA+F+T 
Sbjct: 64  TVTIQILAVMTVLTLLPSFLMMMTAFTRVIVVLAILRQAIGLQSTPSNQIILGLAIFLTI 123

Query: 97  YVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSH 156
           ++M P  +++    +QP MN +IT   AI   ++PF  FM + TRE DL LFM ++++  
Sbjct: 124 FIMLPVFEQANTQALQPYMNEKITSLEAIDAASKPFHEFMLSQTRETDLDLFMRISNT-- 181

Query: 157 RNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPP 216
             T I   +   + +L P+F+ SEL+ +F++GF++ +PFL+ID++VA+++MAMGMMML P
Sbjct: 182 --TGIQTPEETPFFVLAPAFLTSELKTAFQMGFVLFIPFLVIDLVVASVLMAMGMMMLSP 239

Query: 217 TSISLPFKVIFFVLIDGWSLLVENLVKSF 245
             ISLPFK++ FVL+DGW ++V  L  S+
Sbjct: 240 IIISLPFKIMLFVLVDGWVMIVGTLAASY 268


>gi|220929452|ref|YP_002506361.1| flagellar biosynthesis protein FliP [Clostridium cellulolyticum
           H10]
 gi|219999780|gb|ACL76381.1| flagellar biosynthetic protein FliP [Clostridium cellulolyticum
           H10]
          Length = 266

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 98/206 (47%), Positives = 137/206 (66%), Gaps = 9/206 (4%)

Query: 46  FTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDR 105
            T+L+IAP +LIM+T F R II+ S LR  +G   +PPN V+I LALF+T +VMSP L  
Sbjct: 62  LTVLAIAPSILIMMTGFTRIIIILSFLRNALGTQQMPPNQVLIGLALFITLFVMSPVLSD 121

Query: 106 SIEMGIQPLMNNQITETTAIQRVAEPFWVFMR----NNTREKDLSLFMDMAHSSH--RNT 159
             E   QP  + +IT+  AI + ++    +M     +N REKDL LFM +       R  
Sbjct: 122 INENAFQPYSDGKITQQQAIDKSSQTIKTWMVKQIFSNNREKDLELFMTLGGQKDPIRVQ 181

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           D +K   +   I+ P+F+ISEL  +F+ GFLI LPFLIIDM+V++ +M+MGMMMLPP  I
Sbjct: 182 DASK---LSLTIVAPAFLISELTIAFKFGFLIFLPFLIIDMVVSSALMSMGMMMLPPIMI 238

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGWS+L ++++ SF
Sbjct: 239 SLPFKILLFVLVDGWSMLTQSIITSF 264


>gi|15895419|ref|NP_348768.1| flagellar biosynthesis protein FliP [Clostridium acetobutylicum
           ATCC 824]
 gi|15025142|gb|AAK80108.1|AE007715_13 Flagellar biosynthesis protein FliP [Clostridium acetobutylicum
           ATCC 824]
 gi|325509565|gb|ADZ21201.1| flagellar biosynthesis protein FliP [Clostridium acetobutylicum EA
           2018]
          Length = 261

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 136/193 (70%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +++M+T F R I+V   LRT MG    PPN V+I LALF+T ++M PT  +  +  IQ
Sbjct: 71  PSIIMMMTSFTRIIVVLGFLRTSMGTQQSPPNQVLIGLALFLTMFIMMPTYKQINKNAIQ 130

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P +N  I++  A+  + +P   FM   T +KDL LF+D+ + S +   ITK D + +  +
Sbjct: 131 PYLNKSISQQQALLEMEKPLRTFMYKQTYQKDLKLFIDLDNQSGK---ITK-DTVPFHDI 186

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+F+ISEL+ +F IGFL+ +PFLIID++VA+I+M+MGMMMLPP  +S+PFK++ F+++D
Sbjct: 187 VPAFIISELKTAFTIGFLLYIPFLIIDLVVASILMSMGMMMLPPVMVSMPFKLLLFIMVD 246

Query: 233 GWSLLVENLVKSF 245
           GW L+V++LV SF
Sbjct: 247 GWYLIVKSLVLSF 259


>gi|83747643|ref|ZP_00944679.1| FliP [Ralstonia solanacearum UW551]
 gi|207739724|ref|YP_002258117.1| flagellar biosynthetic protein flip [Ralstonia solanacearum
           IPO1609]
 gi|83725695|gb|EAP72837.1| FliP [Ralstonia solanacearum UW551]
 gi|206593106|emb|CAQ60012.1| flagellar biosynthetic protein flip [Ralstonia solanacearum
           IPO1609]
          Length = 249

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 134/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L   P +L+M++ F R IIV S+LR  +G  + PPN V+I LALF+TF+VM
Sbjct: 46  VQTLVFLTSLGFLPAILLMMSSFTRIIIVLSLLRHALGTQTTPPNQVLIGLALFLTFFVM 105

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD+       PL +++I+   A+   A P   FM   TRE DL+LF  M +      
Sbjct: 106 SPVLDKVYTDAYVPLRDSKISVEQALDTAATPLRQFMLKQTREPDLALFAKMGNLP---- 161

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            I   D +  R LIP+F+ SEL+ SF+IGF I +PFL+ID++VA ++M+MGMMM+ P+  
Sbjct: 162 PIASPDQVPMRALIPAFVTSELKTSFQIGFAIFIPFLVIDIVVAAVLMSMGMMMVTPSIF 221

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 222 SLPFKIMLFVLVDGWHLLLGSLAQSF 247


>gi|300696945|ref|YP_003747606.1| fliP: flagellar biosynthesis protein. fliP/mopC/spaP family
           [Ralstonia solanacearum CFBP2957]
 gi|299073669|emb|CBJ53189.1| fliP: flagellar biosynthesis protein. fliP/mopC/spaP family
           [Ralstonia solanacearum CFBP2957]
          Length = 249

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 134/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L   P +L+M++ F R IIV S+LR  +G  + PPN V+I LALF+TF+VM
Sbjct: 46  VQTLVFLTSLGFLPAILLMMSSFTRIIIVLSLLRHALGTQTTPPNQVLIGLALFLTFFVM 105

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD+       PL +++I+   A+   A P   FM   TRE DL+LF  M +      
Sbjct: 106 SPVLDKVYTDAYVPLRDSKISVEQALDTAATPLRQFMLKQTREPDLALFAKMGNLP---- 161

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            I   D +  R LIP+F+ SEL+ SF+IGF I +PFL+ID++VA ++M+MGMMM+ P+  
Sbjct: 162 PIASPDQVPMRALIPAFVTSELKTSFQIGFAIFIPFLVIDIVVAAVLMSMGMMMVTPSIF 221

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 222 SLPFKIMLFVLVDGWHLLLGSLAQSF 247


>gi|237799248|ref|ZP_04587709.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022103|gb|EGI02160.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 250

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 152/245 (62%), Gaps = 17/245 (6%)

Query: 9   LFLVTPELVFAKSSLHDVMNIPA-DLSISTWIVRTFG-------IFTILSIAPILLIMVT 60
           L +V P ++ A     D ++IPA  LS ST   + +        I T LS  P  ++++T
Sbjct: 12  LVMVAPAVLAA-----DPLSIPAITLSNSTDGQQEYSVSLQILLIMTALSFIPAFVMLMT 66

Query: 61  CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT 120
            F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  DR  +  +QP +  +++
Sbjct: 67  SFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFDRVNQDALQPYLAEKLS 126

Query: 121 ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE 180
              A+ +   P   FM   TR  DL LFM ++    + TDI   D     IL+P+F+ISE
Sbjct: 127 AQDAVAKAQVPIKDFMLAQTRTSDLELFMRLS----KRTDIPTPDAAPLTILVPAFVISE 182

Query: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVEN 240
           L+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK++ FVL+DGW+L+V  
Sbjct: 183 LKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFKIMLFVLVDGWALIVGT 242

Query: 241 LVKSF 245
           L  SF
Sbjct: 243 LAGSF 247


>gi|241763645|ref|ZP_04761695.1| flagellar biosynthetic protein FliP [Acidovorax delafieldii 2AN]
 gi|241367120|gb|EER61486.1| flagellar biosynthetic protein FliP [Acidovorax delafieldii 2AN]
          Length = 263

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/207 (43%), Positives = 138/207 (66%), Gaps = 4/207 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+M+T F R +IV S+LR  +G  S PPN VII L+LF+TF+VM
Sbjct: 60  IQTLLFFTALSFLPAVLLMMTGFTRIVIVLSLLRQALGTQSAPPNQVIIGLSLFLTFFVM 119

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PTLD+  +    P   N I+   A+++   P   FM   TR+ D +LF  +A     + 
Sbjct: 120 GPTLDKVYQDAYLPYTTNTISFEAALEKAEAPMRSFMLKQTRQSDFALFSRLAK---LDV 176

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +T  +    R+L+P+F+ SEL+ +F+IGF+I +PFL+IDM+V++I+M++GMMML P  +
Sbjct: 177 SVTA-ETAPLRVLVPAFVTSELKSAFQIGFMIFIPFLVIDMVVSSILMSLGMMMLSPVLV 235

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSFI 246
           +LPFK++ FVL DGW+LL+ +L  SF+
Sbjct: 236 ALPFKLMLFVLADGWNLLIGSLAASFV 262


>gi|330953762|gb|EGH54022.1| flagellar biosynthesis protein FliP [Pseudomonas syringae Cit 7]
          Length = 250

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 133/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 51  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  +++   A+ +   P   FM   TR  DL LFM ++    + TDI   
Sbjct: 111 RVNQDALQPYLAEKLSAQDAVAKAQVPIKDFMLAQTRTSDLELFMRLS----KRTDIPTP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ISEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 167 DAAPLTILVPAFVISELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L+V  L  SF
Sbjct: 227 IMLFVLVDGWALIVGTLAGSF 247


>gi|126653733|ref|ZP_01725651.1| flagellar biosynthesis protein P [Bacillus sp. B14905]
 gi|126589697|gb|EAZ83833.1| flagellar biosynthesis protein P [Bacillus sp. B14905]
          Length = 221

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 135/194 (69%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LI++T F R +IV S +RT +    +PPN VI+ LALF+TF++M+PT     +  +
Sbjct: 32  APSILILMTSFARIVIVLSFVRTALATQQMPPNQVIVGLALFLTFFIMAPTFQEVNKEAL 91

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QPL + +I    A  R + PF  FM  +TR+KDL LF+    S ++       + I   +
Sbjct: 92  QPLFSEEIGLDEAYDRASLPFKEFMSKHTRQKDLDLFL----SYNQAEKPASVEEIPLTM 147

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F +SE++ +F+IGF+I +PFL+IDMIVA+ +M+MGMMMLPP  ISLPFK++ FVL+
Sbjct: 148 LVPAFALSEIKTAFQIGFMIFIPFLVIDMIVASTLMSMGMMMLPPVMISLPFKILLFVLV 207

Query: 232 DGWSLLVENLVKSF 245
           DGW L++++L++SF
Sbjct: 208 DGWYLVMKSLLQSF 221


>gi|302185375|ref|ZP_07262048.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           syringae 642]
          Length = 250

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 133/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 51  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  +++   A+ +   P   FM   TR  DL LFM ++    + TDI   
Sbjct: 111 RVNQDALQPYLAEKLSAQDAVAKAQVPIKDFMLAQTRTSDLELFMRLS----KRTDIPTP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ISEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 167 DAAPLTILVPAFVISELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L+V  L  SF
Sbjct: 227 IMLFVLVDGWALIVGTLAGSF 247


>gi|160896097|ref|YP_001561679.1| flagellar biosynthesis protein FliP [Delftia acidovorans SPH-1]
 gi|160361681|gb|ABX33294.1| flagellar biosynthetic protein FliP [Delftia acidovorans SPH-1]
          Length = 261

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 135/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+M+T F R +IV S++R  +G  S PPN VII L+LF+T +VM
Sbjct: 58  IQTLLFFTALSFLPAILLMMTGFTRIVIVLSLMRQALGTQSAPPNQVIIGLSLFLTLFVM 117

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PTLDR  +    P   N +T   AI++   P   FM   TR+ D +LF  +A      T
Sbjct: 118 GPTLDRVYQEAYVPYTTNAVTFEQAIEKAEAPMRDFMLKQTRQSDFALFARLAKLDAGVT 177

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
               ++    R+L+P+F+ SEL+ +F+IGF+I +PFL+IDM+V++I+M++GMMML P  +
Sbjct: 178 ----SETAPLRVLVPAFVTSELKTAFQIGFMIFIPFLVIDMVVSSILMSLGMMMLSPVLV 233

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL DGW+LL+ +L  SF
Sbjct: 234 ALPFKLMLFVLADGWNLLIGSLAASF 259


>gi|91776320|ref|YP_546076.1| flagellar biosynthesis protein FliP [Methylobacillus flagellatus
           KT]
 gi|91710307|gb|ABE50235.1| flagellar biosynthetic protein FliP [Methylobacillus flagellatus
           KT]
          Length = 250

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 137/214 (64%), Gaps = 9/214 (4%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
            LSI T I     + T L+  P  L+M+T F R IIV S+LR  +G  S PPN V++ LA
Sbjct: 45  SLSIQTLI-----LLTSLTFLPAALLMMTGFTRIIIVLSLLRQALGTQSSPPNQVLVGLA 99

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VM P  +R      QP    +IT   A+ R + P   FM   TRE DL+LF  M
Sbjct: 100 LFLTFFVMGPVFERIYTEAYQPFDEERITMQEAMVRGSIPLKEFMLKQTRESDLALFFKM 159

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +    R   +   + +  R+L+P+F+ SEL+ +F+IGF I +PFLIIDM+VA+I+M+MGM
Sbjct: 160 S----RADAVATPEEVPLRVLVPAFVTSELKTAFQIGFAIFIPFLIIDMVVASILMSMGM 215

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MM+ P  ++LPFK++ FVL+DGW LL+ +L +SF
Sbjct: 216 MMVSPAIVALPFKLMLFVLVDGWQLLLGSLAQSF 249


>gi|77457776|ref|YP_347281.1| flagellar biosynthesis protein FliP [Pseudomonas fluorescens Pf0-1]
 gi|77381779|gb|ABA73292.1| flagellar biosynthesis protein [Pseudomonas fluorescens Pf0-1]
          Length = 252

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 132/201 (65%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  +I++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 51  IMTALSFIPAAVILMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTLFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R     +QP +  ++T   A+++   P   FM   TR  DL LF+ ++    + TDI   
Sbjct: 111 RVNNDALQPYLAEKLTAQQAVEKAQVPIKDFMLAQTRSSDLELFVRLS----KRTDIATP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ SEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 167 DAAPLTILVPAFVTSELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 227 IMLFVLVDGWALIIGTLASSF 247


>gi|85710189|ref|ZP_01041254.1| Flagellar transport protein FliP [Erythrobacter sp. NAP1]
 gi|85688899|gb|EAQ28903.1| Flagellar transport protein FliP [Erythrobacter sp. NAP1]
          Length = 243

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 134/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + ++L+I P +++M+T F R +IV SILR  +G+   PP  V++ L+LF++ +VM+PTLD
Sbjct: 46  VISLLTILPAIVLMMTSFLRILIVLSILRQALGLQGSPPTQVLVGLSLFLSLFVMAPTLD 105

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
              E+ I+P     I    AI    E F  FM   TRE +L +F D+A            
Sbjct: 106 TVSELAIEPYSAGTIGADAAIASAGEAFHTFMLRQTREANLVMFADIAGIGA----FADA 161

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D I + IL+P+F+ SEL  +F+IGF++ LPFL+ID++VA+++M++GMMML PT ISLPFK
Sbjct: 162 DAIPFSILLPAFVTSELETAFQIGFMLFLPFLVIDLVVASVLMSLGMMMLSPTIISLPFK 221

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGWSLL+ +L  SF
Sbjct: 222 LLLFVLVDGWSLLMGSLAMSF 242


>gi|187926923|ref|YP_001893268.1| flagellar biosynthetic protein FliP [Ralstonia pickettii 12J]
 gi|241665252|ref|YP_002983611.1| flagellar biosynthesis protein FliP [Ralstonia pickettii 12D]
 gi|187728677|gb|ACD29841.1| flagellar biosynthetic protein FliP [Ralstonia pickettii 12J]
 gi|240867279|gb|ACS64939.1| flagellar biosynthetic protein FliP [Ralstonia pickettii 12D]
          Length = 249

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 136/210 (64%), Gaps = 4/210 (1%)

Query: 37  TWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTF 96
           T  V+T    T L   P +++M++ F R IIV S+LR  +G  + PPN V+I LALF+TF
Sbjct: 43  TLPVQTLIFLTSLGFLPAIILMMSSFTRIIIVLSLLRHALGTQTTPPNQVLIGLALFLTF 102

Query: 97  YVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSH 156
           +VMSP LD+       PL +N+IT   A+   A P   FM   TRE DL+LF+ M +   
Sbjct: 103 FVMSPVLDKVYTDAYVPLRDNKITVEQAMDTAATPLRQFMLKQTREPDLALFVKMGNMPA 162

Query: 157 RNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPP 216
               I   +    R LIP+F+ SEL+ +F+IGF I +PFL+ID++VA ++M+MGMMM+ P
Sbjct: 163 ----IASPEQTPMRALIPAFVTSELKSAFQIGFAIFIPFLVIDIVVAAVLMSMGMMMVTP 218

Query: 217 TSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           +  SLPFK++ FVL+DGW LL+ +L +SF+
Sbjct: 219 SIFSLPFKIMLFVLVDGWHLLLGSLAQSFV 248


>gi|83815985|ref|YP_446686.1| flagellar biosynthesis protein FliP [Salinibacter ruber DSM 13855]
 gi|83757379|gb|ABC45492.1| flagellar biosynthetic protein FliP [Salinibacter ruber DSM 13855]
          Length = 279

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 134/194 (69%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP ++I++T F R ++VFSILR  +G+   PP  V+I L+LF++ ++M P L+   +  +
Sbjct: 87  APAIIILMTSFTRLVVVFSILRRALGLQRSPPRQVVIGLSLFLSLFIMQPVLETVHQDAL 146

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           +P ++N+IT+  A  R + P   FM  +TR+KDL LFMDM             D     +
Sbjct: 147 RPYLDNEITQQEAFDRASTPMKRFMLTHTRDKDLMLFMDMGEIES----FEGPDEAPLYV 202

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           ++P+F+ISELR +F+IGF+I LPFLI+D++VA+I+M+MGMMMLPP  ISLP K++ FVL 
Sbjct: 203 VVPAFVISELRIAFQIGFMIFLPFLIVDLVVASILMSMGMMMLPPVMISLPIKLLLFVLT 262

Query: 232 DGWSLLVENLVKSF 245
           DGW L+VE+L++ +
Sbjct: 263 DGWYLIVESLMQGY 276


>gi|323496545|ref|ZP_08101599.1| flagellar biosynthesis protein FliP [Vibrio sinaloensis DSM 21326]
 gi|323318389|gb|EGA71346.1| flagellar biosynthesis protein FliP [Vibrio sinaloensis DSM 21326]
          Length = 291

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/214 (42%), Positives = 141/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 84  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 140

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           +F+TF++MSP L++  E  +QP +N QI+   A      P   FM   TR KDL  F+++
Sbjct: 141 IFLTFFIMSPVLNKINEAAVQPYINEQISAREAFDLAQAPMKDFMLKQTRVKDLETFVNI 200

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + ++  N +      +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 201 SGATVNNPE-----DVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 255

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 256 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 289


>gi|330880585|gb|EGH14734.1| flagellar biosynthesis protein FliP [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 226

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 133/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS  P  ++++T F R IIVFSILR  +G+   P N ++  +ALF+T ++M+P  D
Sbjct: 27  IMTALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTMFIMAPVFD 86

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  +  +QP +  +++   A+ +   P   FM   TR  DL LFM ++    + TDI   
Sbjct: 87  RVNQDALQPYLAEKLSAQDAVAKAQVPIKDFMLAQTRTSDLELFMRLS----KRTDIPTP 142

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     IL+P+F+ISEL+ +F+IGF+I +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 143 DAAPLTILVPAFVISELKTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFK 202

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L+V  L  SF
Sbjct: 203 IMLFVLVDGWALIVGTLAGSF 223


>gi|332161332|ref|YP_004297909.1| flagellar biosynthesis protein FliP [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318605253|emb|CBY26751.1| flagellar biosynthesis protein FliP [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665562|gb|ADZ42206.1| flagellar biosynthesis protein FliP [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 250

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 93/227 (40%), Positives = 146/227 (64%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  +++ P      +W   V+T    T LS  P  L+M+T F R IIV  +LR  +G 
Sbjct: 26  AQLPGIISQPLANGGQSWSLPVQTLVFITTLSFLPAALLMMTSFTRIIIVLGLLRNALGT 85

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ LALF+TF++MSP  D+  +    P   ++I+   A+ + ++P   FM  
Sbjct: 86  PSAPPNQVMLGLALFLTFFIMSPVFDKVYQDAYLPFSQDKISMEVAMDKGSQPLREFMLR 145

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+L+  +A+       +   + +  RIL+P+++ SEL+ +F+IGF + +PFLII
Sbjct: 146 QTRESDLALYARLANLPP----LEGPEVVPLRILLPAYVTSELKTAFQIGFTVFIPFLII 201

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D++VA+++MA+GMMM+PP SISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 202 DLVVASVLMALGMMMVPPASISLPFKLMLFVLVDGWQLLLGSLAQSF 248


>gi|294508622|ref|YP_003572681.1| flagellar biosynthetic protein FliP [Salinibacter ruber M8]
 gi|294344951|emb|CBH25729.1| flagellar biosynthetic protein FliP [Salinibacter ruber M8]
          Length = 284

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 134/194 (69%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP ++I++T F R ++VFSILR  +G+   PP  V+I L+LF++ ++M P L+   +  +
Sbjct: 92  APAIIILMTSFTRLVVVFSILRRALGLQRSPPRQVVIGLSLFLSLFIMQPVLETVHQDAL 151

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           +P ++N+IT+  A  R + P   FM  +TR+KDL LFMDM             D     +
Sbjct: 152 RPYLDNEITQQEAFDRASTPMKRFMLTHTRDKDLMLFMDMGEIE----SFEGPDEAPLYV 207

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           ++P+F+ISELR +F+IGF+I LPFLI+D++VA+I+M+MGMMMLPP  ISLP K++ FVL 
Sbjct: 208 VVPAFVISELRIAFQIGFMIFLPFLIVDLVVASILMSMGMMMLPPVMISLPIKLLLFVLT 267

Query: 232 DGWSLLVENLVKSF 245
           DGW L+VE+L++ +
Sbjct: 268 DGWYLIVESLMQGY 281


>gi|90406809|ref|ZP_01215001.1| flagellar biosynthesis protein [Psychromonas sp. CNPT3]
 gi|90312046|gb|EAS40139.1| flagellar biosynthesis protein [Psychromonas sp. CNPT3]
          Length = 249

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 88/206 (42%), Positives = 137/206 (66%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++     T LS  P +L+++T F R ++V SILR  +G+   P N VI  +ALF+TF++M
Sbjct: 46  LQVLAFMTALSFLPAMLVLMTSFTRIVVVMSILRQALGLQQTPSNQVINGIALFLTFFIM 105

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +P  D+  E  +QP +N  +    AI++  +P   FM   TR KDL  F+++A     N 
Sbjct: 106 TPVFDKINEEALQPYLNEDMNIVQAIEQGKKPLMAFMLAQTRLKDLETFLEIA-----NV 160

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + + + +LIP+F+ SEL+ +F+IGF+I +PFLIID++VA+I+MAMGMMML P  +
Sbjct: 161 QVDTPEEVPFTVLIPAFVTSELKTAFQIGFMIFIPFLIIDLVVASILMAMGMMMLSPMIV 220

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++ +L  SF
Sbjct: 221 SLPFKLMLFVLVDGWNLIMGSLANSF 246


>gi|78777215|ref|YP_393530.1| flagellar biosynthesis protein FliP [Sulfurimonas denitrificans DSM
           1251]
 gi|78497755|gb|ABB44295.1| Flagellar transport protein FliP [Sulfurimonas denitrificans DSM
           1251]
          Length = 246

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 133/193 (68%), Gaps = 4/193 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +++++T F RF+IVF  LR  +G   VPP  +++ L + +TF+VM P   ++ E GI
Sbjct: 56  APSMVLVMTTFTRFVIVFGFLRQALGTQQVPPTQLLVMLGMILTFFVMEPVGIKAYEDGI 115

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           +P +  +I    A  + A PF  FM  NTREKDL+LF  +     +  + T    +   I
Sbjct: 116 KPYIEEKIGYEEAFDKTALPFKNFMIRNTREKDLALFFRI----RKMQNPTTIAEVPLSI 171

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           +IP+F+ISEL+ +FEIGFL+ LPFL+IDM+VA+I+M+MGMMMLPP  I+LPFK++ F+LI
Sbjct: 172 IIPAFVISELKTAFEIGFLLFLPFLVIDMVVASILMSMGMMMLPPVMIALPFKILIFILI 231

Query: 232 DGWSLLVENLVKS 244
           DGW+LL+ NL+ S
Sbjct: 232 DGWNLLIGNLIAS 244


>gi|224826623|ref|ZP_03699724.1| flagellar biosynthetic protein FliP [Lutiella nitroferrum 2002]
 gi|224601224|gb|EEG07406.1| flagellar biosynthetic protein FliP [Lutiella nitroferrum 2002]
          Length = 248

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 93/199 (46%), Positives = 134/199 (67%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T LS  P LL+M+T F R IIV S+LR  MG    PPN V++ LALF+T +VM PT D+ 
Sbjct: 51  TALSFIPALLLMMTSFTRIIIVLSLLRQAMGTMQAPPNQVLVGLALFLTLFVMGPTFDQV 110

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
                 P   ++I     ++  ++P   FM   TREKDL+ F++++ S    T       
Sbjct: 111 YSKAWVPFSEDKIGFAQMLEEGSKPMREFMLKQTREKDLAFFIEVSQSPAPPTP----AE 166

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           +  + LIP+F+ISEL+ +F+IGF++ +PFLIID++VA+I+MAMGMMM+ P  ISLPFK++
Sbjct: 167 VSMKTLIPAFVISELKTAFQIGFMVFIPFLIIDLVVASILMAMGMMMVSPVIISLPFKLM 226

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW+LL+ +LV+SF
Sbjct: 227 LFVLVDGWTLLMGSLVRSF 245


>gi|17548596|ref|NP_521936.1| flagellar biosynthesis protein FliP [Ralstonia solanacearum
           GMI1000]
 gi|17430844|emb|CAD17526.1| probable flagellar biosynthetic flip transmembrane protein
           [Ralstonia solanacearum GMI1000]
          Length = 249

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 134/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L   P +L+M++ F R IIV S+LR  +G  + PPN V+I LALF+TF+VM
Sbjct: 46  VQTLVFLTSLGFLPAILLMMSSFTRIIIVLSLLRHALGTQTTPPNQVLIGLALFLTFFVM 105

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD+       PL +++I+   A+   A P   FM   TRE DL+LF  M +      
Sbjct: 106 SPVLDKVYTDAYLPLRDSKISVEQALDTAATPLRQFMLKQTREPDLALFAKMGNLP---- 161

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            I   D +  R LIP+F+ SEL+ +F+IGF I +PFL+ID++VA ++M+MGMMM+ P+  
Sbjct: 162 PIASPDQVPMRALIPAFVTSELKTAFQIGFAIFIPFLVIDIVVAAVLMSMGMMMVTPSIF 221

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 222 SLPFKIMLFVLVDGWHLLLGSLAQSF 247


>gi|260574384|ref|ZP_05842388.1| flagellar biosynthetic protein FliP [Rhodobacter sp. SW2]
 gi|259023280|gb|EEW26572.1| flagellar biosynthetic protein FliP [Rhodobacter sp. SW2]
          Length = 242

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 94/219 (42%), Positives = 142/219 (64%), Gaps = 5/219 (2%)

Query: 27  MNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLV 86
           +N+    S+S   ++   + T+LS+ P L +M+TCFP  + V SILR  +G+   PPN++
Sbjct: 28  LNLGDQGSLSARSIQLLVLITVLSLVPGLAVMITCFPFIVTVLSILRQAIGLQQSPPNML 87

Query: 87  IISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLS 146
           I+SLALF+T+YVM P    +   G++PL   +    TAI  +  PF VFM   +   D  
Sbjct: 88  IVSLALFLTWYVMDPVFTEAWTTGMEPLTRGETDLQTAIPAILAPFRVFM---SARMDAD 144

Query: 147 LFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIV 206
            F  M   + R  + +        +++PSF++SE++R+FEIGFLI LPFLIID++VA ++
Sbjct: 145 TFAAM--QALRPGESSSVAQAPLSLMVPSFLLSEIQRAFEIGFLIFLPFLIIDLVVAAVL 202

Query: 207 MAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           M+MGMMM+PP+ +SLPFK+ FFV+ DGWSL+   LV+S+
Sbjct: 203 MSMGMMMVPPSIVSLPFKLAFFVVADGWSLVSGALVRSY 241


>gi|238785487|ref|ZP_04629470.1| Flagellar biosynthetic protein fliP [Yersinia bercovieri ATCC
           43970]
 gi|238713589|gb|EEQ05618.1| Flagellar biosynthetic protein fliP [Yersinia bercovieri ATCC
           43970]
          Length = 249

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 96/231 (41%), Positives = 149/231 (64%), Gaps = 8/231 (3%)

Query: 17  VFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRT 74
           VFA+  L  +++ P      +W   V+T    T LS  P  L+M+T F R IIV  +LR 
Sbjct: 23  VFAQ--LPGLISQPLANGGQSWSLPVQTLVFITALSFLPAALLMMTSFTRIIIVLGLLRN 80

Query: 75  GMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWV 134
            +G  S PPN V++ LALF+TF++MSP  D+  +    P   ++I+   A+ + ++P   
Sbjct: 81  ALGTPSAPPNQVMLGLALFLTFFIMSPVFDKVYQDAYLPFSQDKISMEVAMDKGSQPLRE 140

Query: 135 FMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILP 194
           FM   TRE DL+L+  +A+       +   + +  RIL+P+++ SEL+ +F+IGF + +P
Sbjct: 141 FMLRQTRESDLALYARLANLP----PLEGPEVVPMRILLPAYVTSELKTAFQIGFTVFIP 196

Query: 195 FLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           FLIID++VA+++MA+GMMM+PP SISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 197 FLIIDLVVASVLMALGMMMVPPASISLPFKLMLFVLVDGWQLLLGSLAQSF 247


>gi|291532049|emb|CBK97634.1| flagellar biosynthetic protein FliP [Eubacterium siraeum 70/3]
          Length = 307

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 129/208 (62%), Gaps = 9/208 (4%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+LS+AP LL+M+T F R II FS LRT M     PPN+V+  L+LF+T ++M P     
Sbjct: 98  TVLSLAPSLLVMMTSFARIIICFSFLRTAMQTQPTPPNMVLTGLSLFLTIFIMWPVFSEI 157

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            E   QP    ++T   AI    +P   FM   T   D+  F+D+   S  +      D+
Sbjct: 158 NETAYQPYAAGEMTMEQAIDAAGKPLKTFMLKQTTNDDMKFFLDLKGQSMSDVTGGATDN 217

Query: 167 IE---------YRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPT 217
           I          +  +IP+F++SEL+R+F++GFLI +PFL+ID++V++ +MAMGMMMLPP 
Sbjct: 218 ITLENYSEKLGFETVIPAFIVSELKRAFQMGFLIFIPFLVIDLVVSSTLMAMGMMMLPPA 277

Query: 218 SISLPFKVIFFVLIDGWSLLVENLVKSF 245
            ISLPFK+I FVL+DGW L+V  +V S+
Sbjct: 278 MISLPFKIILFVLVDGWQLMVGTIVNSY 305


>gi|269965693|ref|ZP_06179806.1| Flagellar biosynthetic protein fliP [Vibrio alginolyticus 40B]
 gi|269829761|gb|EEZ83997.1| Flagellar biosynthetic protein fliP [Vibrio alginolyticus 40B]
          Length = 289

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 92/214 (42%), Positives = 137/214 (64%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 82  DYSVTLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 138

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+VMSP L+   +  +QP +N Q+T   A      P   FM   TR KDL  F+ M
Sbjct: 139 LFLTFFVMSPVLNEINDKAVQPYLNEQVTAREAFDAAQAPMKAFMLKQTRIKDLETFVTM 198

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           +        +   + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 199 SGE-----QVEDPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 253

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 254 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 287


>gi|87119473|ref|ZP_01075370.1| Flagellar transport protein FliP [Marinomonas sp. MED121]
 gi|86164949|gb|EAQ66217.1| Flagellar transport protein FliP [Marinomonas sp. MED121]
          Length = 249

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 144/214 (67%), Gaps = 6/214 (2%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S+S  I+    I T L++ P  L M+T F R ++V +ILR  +G+   P N +++ +A
Sbjct: 40  DYSVSLQILF---IMTALTLLPAALTMMTAFTRIVVVLAILRQAIGLQQTPSNQIMVGMA 96

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+T ++M+PTLD+   + +QP +  +IT   AI++ + P   FM   TRE D++LF+ +
Sbjct: 97  LFLTLFIMTPTLDKINAVALQPYLEEEITSIQAIEKASVPIRDFMLAQTRESDIALFVKL 156

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           A    +   I   + + + IL+P+F+ SEL+ +F+IGF+I +PFL++DM+VA+++MAMGM
Sbjct: 157 AG---KEGQIESLETLPFTILMPAFVASELKTAFQIGFMIFIPFLVLDMVVASVLMAMGM 213

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  ISLPFK++ FV++DGW++++  L  SF
Sbjct: 214 MMLSPIIISLPFKIMLFVMVDGWAMIMGTLAASF 247


>gi|85711032|ref|ZP_01042092.1| flagellar biosynthesis protein [Idiomarina baltica OS145]
 gi|85694945|gb|EAQ32883.1| flagellar biosynthesis protein [Idiomarina baltica OS145]
          Length = 249

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 145/243 (59%), Gaps = 6/243 (2%)

Query: 5   CFFALFLVTPELVFAKSSLH--DVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCF 62
           CF  L L+ P++  A   +    V   P      +  ++   I T L+  P ++IM+T F
Sbjct: 9   CFVLLALLLPDVANAMQDISAVTVKTNPDGSEEYSVTLQILAIMTALTFIPAMVIMMTSF 68

Query: 63  PRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITET 122
            R I+V +ILR  +G+   P N V+I + LF+TF++MSP L    +  +QP +N ++T  
Sbjct: 69  TRIIVVLAILRQAIGLQQSPSNQVLIGITLFLTFFIMSPVLTEINDKALQPYLNEEVTSM 128

Query: 123 TAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELR 182
            A+ R   P   FM   TR  D+  F D+A      T+I   +     ILIPSF+ SEL+
Sbjct: 129 EAVDRAKAPLKAFMLAQTRVTDIQTFADIAG----ETNIQSPEDTPMSILIPSFITSELK 184

Query: 183 RSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLV 242
            +F+IGF++ +PFLIID++VA+++MAMGMMML P  +SLPFK++ FVL+DGW+L +  L 
Sbjct: 185 TAFQIGFMLFIPFLIIDLVVASVLMAMGMMMLSPMIVSLPFKLMLFVLVDGWNLTMSTLA 244

Query: 243 KSF 245
            SF
Sbjct: 245 GSF 247


>gi|238751771|ref|ZP_04613259.1| Flagellar biosynthetic protein fliP [Yersinia rohdei ATCC 43380]
 gi|238710042|gb|EEQ02272.1| Flagellar biosynthetic protein fliP [Yersinia rohdei ATCC 43380]
          Length = 243

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 93/227 (40%), Positives = 146/227 (64%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  +++ P      +W   V+T    T LS  P  L+M+T F R IIV  +LR  +G 
Sbjct: 19  AQLPGIISQPLANGGQSWSLPVQTLVFITALSFLPAALLMMTSFTRIIIVLGLLRNALGT 78

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            S PPN V++ LALF+TF++MSP  D+  +    P   ++I+   A+ + ++P   FM  
Sbjct: 79  PSAPPNQVMLGLALFLTFFIMSPVFDKVYQDAYLPFSQDKISMEVAMDKGSQPLREFMLR 138

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+L+  +A+       +   + +  RIL+P+++ SEL+ +F+IGF + +PFLII
Sbjct: 139 QTRETDLALYARLANLPP----LEGPEVVPMRILLPAYVTSELKTAFQIGFTVFIPFLII 194

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D++VA+++MA+GMMM+PP SISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 195 DLVVASVLMALGMMMVPPASISLPFKLMLFVLVDGWQLLLGSLAQSF 241


>gi|323491455|ref|ZP_08096639.1| flagellar biosynthesis protein FliP [Vibrio brasiliensis LMG 20546]
 gi|323314324|gb|EGA67404.1| flagellar biosynthesis protein FliP [Vibrio brasiliensis LMG 20546]
          Length = 291

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 140/214 (65%), Gaps = 8/214 (3%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A
Sbjct: 84  DYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIA 140

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           +F+TF++MSP L +  +  IQP +N QIT   A      P   FM   TR KDL  F+++
Sbjct: 141 IFLTFFIMSPVLSKINDDAIQPYINEQITARQAFDLAQTPMKDFMLKQTRVKDLETFVNI 200

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           + S+      T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGM
Sbjct: 201 SGSTA-----TAPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGM 255

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 256 MMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 289


>gi|323700135|ref|ZP_08112047.1| flagellar biosynthetic protein FliP [Desulfovibrio sp. ND132]
 gi|323460067|gb|EGB15932.1| flagellar biosynthetic protein FliP [Desulfovibrio desulfuricans
           ND132]
          Length = 252

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 96/201 (47%), Positives = 132/201 (65%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TILSIAP +L+ +T F R IIVF  +R  MG   +PPN ++ +LA+FMT  +M P   
Sbjct: 55  LLTILSIAPAILLTMTSFTRIIIVFHFIRQAMGTQQMPPNQILAALAIFMTMVIMYPVGK 114

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
              E  +QP MN  I  T A+ R   P   FM  +TREKDLS+F    +S  +       
Sbjct: 115 TINETALQPYMNETINFTEALTRAQVPIRQFMFKHTREKDLSIF----YSITKEPRPENK 170

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           + +   +L+ ++ ISEL+  F IGFLI +PFLI+DM+VA+I++AMGMMMLPP  ISLPFK
Sbjct: 171 EEVPTIMLVAAYTISELKTGFTIGFLIYIPFLILDMVVASILLAMGMMMLPPVMISLPFK 230

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ F+LIDGW+LLV +LV +F
Sbjct: 231 ILLFILIDGWNLLVGSLVNTF 251


>gi|134095087|ref|YP_001100162.1| flagellar biosynthesis protein FliP [Herminiimonas arsenicoxydans]
 gi|133738990|emb|CAL62038.1| Flagellar biosynthetic protein FliP Precursor [Herminiimonas
           arsenicoxydans]
          Length = 252

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 130/193 (67%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +L+M+T F R IIV S+LR  +G  S PPN VII L+LF+T +VMSP LD+      Q
Sbjct: 63  PAVLLMMTSFTRIIIVLSLLRQALGTQSSPPNQVIIGLSLFLTLFVMSPVLDKIYVDAYQ 122

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P   N+I    A+ +   P   FM   TRE DL+L++ M+    +  ++   + I  RIL
Sbjct: 123 PFSANKIQMGEALDKAVAPLKTFMIKQTRESDLALYVKMS----KGPELQGPEDIPLRIL 178

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+F+ SEL+ +F+I F I +PFLIIDM+VA+++M+MGMMM+ P  ++LPFK++ FVL+D
Sbjct: 179 VPAFITSELKTAFQISFAIFIPFLIIDMVVASVLMSMGMMMVSPAIVALPFKLMLFVLVD 238

Query: 233 GWSLLVENLVKSF 245
           GW LL+ +L +SF
Sbjct: 239 GWQLLIGSLAQSF 251


>gi|299534771|ref|ZP_07048101.1| flagellar biosynthesis protein FliP [Lysinibacillus fusiformis ZC1]
 gi|298729859|gb|EFI70404.1| flagellar biosynthesis protein FliP [Lysinibacillus fusiformis ZC1]
          Length = 221

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 135/195 (69%), Gaps = 6/195 (3%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LI++T F R +IV S +RT +    +PPN VII LALF+TF++M+PT     +  +
Sbjct: 32  APSILILMTSFARIVIVLSFVRTALATQQMPPNQVIIGLALFLTFFIMAPTFQEVNKEAL 91

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN-DHIEYR 170
           QPL   +I    A  R + PF  FM  +TR+KDL LF+     ++   D   + + I   
Sbjct: 92  QPLFAEEIGIEEAYDRASVPFKEFMSKHTRQKDLDLFL-----TYNQADKPASVEEIPLT 146

Query: 171 ILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVL 230
           +L+P+F +SE++ +F+IGF+I +PFL+IDMIVA+ +M+MGMMMLPP  ISLPFK++ FVL
Sbjct: 147 MLVPAFALSEIKTAFQIGFMIFIPFLVIDMIVASTLMSMGMMMLPPVMISLPFKILLFVL 206

Query: 231 IDGWSLLVENLVKSF 245
           +DGW L++++L++SF
Sbjct: 207 VDGWYLVMKSLLQSF 221


>gi|119385379|ref|YP_916435.1| flagellar biosynthesis protein FliP [Paracoccus denitrificans
           PD1222]
 gi|119375146|gb|ABL70739.1| flagellar biosynthetic protein FliP [Paracoccus denitrificans
           PD1222]
          Length = 241

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 136/203 (66%), Gaps = 7/203 (3%)

Query: 43  FGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPT 102
             + T LS+AP + IMVTCFP  + V SILR  +G+   PPN++I+SLA+F+T++VM+P 
Sbjct: 45  LAVMTALSLAPGIAIMVTCFPFIVTVLSILRQSLGLQQSPPNMLIVSLAMFLTWFVMNPV 104

Query: 103 LDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDIT 162
           L  + ++   PL + +IT   A +R   PF  FM + T  + L+   ++A       D  
Sbjct: 105 LTEAWDVAGAPLRDGRITVEQAFERGIVPFRGFMEHRTDPEMLATLAEIAPDPEAAPD-- 162

Query: 163 KNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLP 222
                   +LIP+FMISE++R+FEIGFL+ LPFLIID++V+ ++M+MGMMM+PP  ++LP
Sbjct: 163 -----RLSVLIPAFMISEIQRAFEIGFLVALPFLIIDLVVSAVLMSMGMMMVPPVVVALP 217

Query: 223 FKVIFFVLIDGWSLLVENLVKSF 245
           FK+ FFV++DGW ++   LV+S+
Sbjct: 218 FKLAFFVVVDGWGMIAAALVRSY 240


>gi|86146126|ref|ZP_01064452.1| flagellar biosynthesis protein [Vibrio sp. MED222]
 gi|218708833|ref|YP_002416454.1| flagellar biosynthesis protein FliP [Vibrio splendidus LGP32]
 gi|85836073|gb|EAQ54205.1| flagellar biosynthesis protein [Vibrio sp. MED222]
 gi|218321852|emb|CAV17828.1| Flagellar biosynthetic protein fliP [Vibrio splendidus LGP32]
          Length = 309

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 141/218 (64%), Gaps = 8/218 (3%)

Query: 28  NIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVI 87
           N   D SI+  I+    + T+L   P ++I++T F R ++V SILR  MG+   P N VI
Sbjct: 98  NGGEDYSINLQIL---ALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVI 154

Query: 88  ISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSL 147
           I +A+F+TF++MSP + +  E  +QP +N QI+   A      P   FM   TR KDL  
Sbjct: 155 IGIAIFLTFFIMSPVISQVNEQAVQPYLNEQISARQAFDVAQGPIKSFMLKQTRIKDLET 214

Query: 148 FMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVM 207
           F++++ +      +T  + +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++M
Sbjct: 215 FVEISGA-----QVTNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLM 269

Query: 208 AMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           AMGMMML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 270 AMGMMMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 307


>gi|332187877|ref|ZP_08389610.1| flagellar biosynthetic protein FliP [Sphingomonas sp. S17]
 gi|332012038|gb|EGI54110.1| flagellar biosynthetic protein FliP [Sphingomonas sp. S17]
          Length = 293

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 136/201 (67%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I  +L+I P +++M+T F R +IV +ILR  +G+   PPN V+I LA+F++ ++M+PT+ 
Sbjct: 95  IMGLLTILPGIILMMTSFTRIVIVLAILRQALGLQQTPPNQVLIGLAMFLSLFIMAPTIS 154

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +     IQP    ++  T  I+    P   FM   TR KD+++F  MA S    +    N
Sbjct: 155 QMNANAIQPYAEGRLPGTEMIKAAGAPLHAFMAKQTRVKDVTMFAQMAKSGPYAS---PN 211

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D I Y +L+P+F+ SEL+ +F+IGFLI LPF++ID++VAT++MA+GMMML P+ ISLPFK
Sbjct: 212 D-IPYAVLLPAFVTSELKTAFQIGFLIFLPFIVIDLVVATVLMALGMMMLSPSIISLPFK 270

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L + +L  SF
Sbjct: 271 LLLFVLVDGWALTMGSLANSF 291


>gi|291613058|ref|YP_003523215.1| flagellar biosynthetic protein FliP [Sideroxydans lithotrophicus
           ES-1]
 gi|291583170|gb|ADE10828.1| flagellar biosynthetic protein FliP [Sideroxydans lithotrophicus
           ES-1]
          Length = 248

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 150/242 (61%), Gaps = 7/242 (2%)

Query: 7   FALFLVTPELVFAKSSLHDVMN---IPADLSISTWIVRTFGIFTILSIAPILLIMVTCFP 63
           FAL        FA  S    +N    P      T  ++T  + + L+  P +L+M+T F 
Sbjct: 9   FALLFAMSTSAFAAESGLLALNSTPTPGGGQTYTLSLQTLILISSLTFLPAILLMMTGFT 68

Query: 64  RFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETT 123
           R IIV  +LR+ +G  S PPN V++ LALF+TF+VM+P  D+       P   N+I+   
Sbjct: 69  RIIIVLGLLRSAIGTPSSPPNQVLVGLALFLTFFVMAPVFDKIYSDAYLPYSENKISLQQ 128

Query: 124 AIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRR 183
           A ++ + P   FM   TRE DL+LF+ +++S      +   + +  +IL+P+++ SEL+ 
Sbjct: 129 AYEKGSAPLKAFMLRQTRETDLALFVRISNSE----PLQSAEDVPMKILVPAYVTSELKT 184

Query: 184 SFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVK 243
           +F+IGF++ +PFLIIDM+VA+++M+MGMMM+ P   SLPFK++ FVL DGW+LL+ +LV+
Sbjct: 185 AFQIGFVVFIPFLIIDMVVASVLMSMGMMMVSPAVFSLPFKIMLFVLADGWNLLIGSLVQ 244

Query: 244 SF 245
           SF
Sbjct: 245 SF 246


>gi|114777577|ref|ZP_01452558.1| flagellar biosynthetic protein fliP [Mariprofundus ferrooxydans
           PV-1]
 gi|114552048|gb|EAU54565.1| flagellar biosynthetic protein fliP [Mariprofundus ferrooxydans
           PV-1]
          Length = 249

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 136/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + TIL++AP +L+M+T F R +IVF+ LR  +G    PPN ++I L+LF+T ++M
Sbjct: 46  LKILAMLTILTLAPSILVMMTSFTRILIVFAFLRQALGTQQAPPNQILIGLSLFLTLFIM 105

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            P   +     + P +N +I ++ A +R   P   FM   TRE DL LF++ A       
Sbjct: 106 MPVWQKIDTTALTPYLNEEINQSVAFERGIAPLRDFMLKQTREDDLLLFLNAAKLKK--- 162

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
              K + +   +LIPSF+ISELR +FEIGFLI +PF+++D+IVA+++M+MGMMMLPP  I
Sbjct: 163 -PAKAEDMPMHVLIPSFVISELRTAFEIGFLIYIPFIVLDLIVASVLMSMGMMMLPPVMI 221

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLP K+I FVL+DGW L+  NL+ SF
Sbjct: 222 SLPLKIILFVLVDGWHLITANLIASF 247


>gi|300693349|ref|YP_003749322.1| flip: flagellar biosynthesis protein. flip/mopc/spap family
           [Ralstonia solanacearum PSI07]
 gi|299075386|emb|CBJ34681.1| fliP: flagellar biosynthesis protein. fliP/mopC/spaP family
           [Ralstonia solanacearum PSI07]
          Length = 249

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 134/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L   P +L+M++ F R IIV S+LR  +G  + PPN V+I LALF+TF+VM
Sbjct: 46  VQTLVFLTSLGFLPAILLMMSSFTRIIIVLSLLRHALGTQTTPPNQVLIGLALFLTFFVM 105

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD+       PL +++I+   A+   A P   FM   TRE DL+LF  M +      
Sbjct: 106 SPVLDKVYTDAYVPLRDSKISVEQALDTAATPMRQFMLKQTREPDLALFAKMGNLP---- 161

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            I   D +  R LIP+F+ SEL+ +F+IGF I +PFL+ID++VA ++M+MGMMM+ P+  
Sbjct: 162 PIASPDQVPMRALIPAFVTSELKTAFQIGFAIFIPFLVIDIVVAAVLMSMGMMMVTPSIF 221

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 222 SLPFKIMLFVLVDGWHLLLGSLAQSF 247


>gi|163789635|ref|ZP_02184073.1| flagellar biosynthesis protein P [Carnobacterium sp. AT7]
 gi|159875167|gb|EDP69233.1| flagellar biosynthesis protein P [Carnobacterium sp. AT7]
          Length = 254

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 101/248 (40%), Positives = 159/248 (64%), Gaps = 14/248 (5%)

Query: 7   FALFLVT----PELVFAKSSLHDVMNIPADL-----SISTWIVRTFGIFTILSIAPILLI 57
           F+LFL +    P+ V + + L D ++   DL       ++ +V+ F + T LS+AP  L+
Sbjct: 11  FSLFLTSFVLFPQ-VASAAELTDGLDGITDLFGKQSGGTSEVVQLFLLTTALSLAPTFLV 69

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           + TCF R I+V S +R+ +G    PPNLV++ +ALF++ ++M P     ++  I P +N 
Sbjct: 70  LTTCFTRIIVVLSFVRSSLGTQQNPPNLVLMGIALFLSLFIMQPVYTDVMDEAITPYINE 129

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           +I+   A +    P   FM   TR++D+ LF+D++ +  +  D+  ND +   + IP+F+
Sbjct: 130 EISGIEAFELAELPIKEFMYKQTRDEDIQLFLDISKT-EKPADV--ND-LPLTVAIPAFI 185

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
           ISELR +F IGFLI +PFL+ID++VA+I+M+MGM ML P  ISLPFK++ FVL+DGW L+
Sbjct: 186 ISELRTAFTIGFLIFIPFLVIDIVVASILMSMGMFMLSPVMISLPFKLLLFVLVDGWYLV 245

Query: 238 VENLVKSF 245
           VE+LV  F
Sbjct: 246 VESLVTGF 253


>gi|225159018|ref|ZP_03725328.1| Triacylglycerol lipase [Opitutaceae bacterium TAV2]
 gi|224802397|gb|EEG20659.1| Triacylglycerol lipase [Opitutaceae bacterium TAV2]
          Length = 297

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 147/216 (68%), Gaps = 8/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P ++S+   IV    + T+L++AP L++++T F R +IV  ++RT +G+ + P N ++I 
Sbjct: 88  PGEISVGLQIVV---VMTLLTVAPSLILLMTSFTRLVIVLGLVRTALGVPNAPANQIVIG 144

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           L+LF+T ++M P + R+ +  +QP M  ++    A+ + AEP   FM   TR +DL  F+
Sbjct: 145 LSLFLTIFIMGPVIQRANQEALQPYMAGEMRSADALAKAAEPVKEFMLKQTRTRDLEFFL 204

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            +          T+   +  R++IP+F+ISEL+ +F++GFL+ LPFL+ID++V++ +M++
Sbjct: 205 QLGRFPP-----TRVQDLPLRVVIPAFVISELQTAFQMGFLLFLPFLVIDLLVSSTLMSL 259

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMM+PP  +SLPFK++ FVL+DGW L+V++LV+SF
Sbjct: 260 GMMMMPPAIVSLPFKLLLFVLVDGWHLVVKSLVESF 295


>gi|167037653|ref|YP_001665231.1| flagellar biosynthesis protein FliP [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320116068|ref|YP_004186227.1| flagellar biosynthetic protein FliP [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166856487|gb|ABY94895.1| flagellar biosynthetic protein FliP [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319929159|gb|ADV79844.1| flagellar biosynthetic protein FliP [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 221

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 132/194 (68%), Gaps = 5/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIM+T F R +IV S LR  +G+  +PPN V+I LALF+T ++M+P         I
Sbjct: 32  APSILIMMTSFTRIVIVLSFLRNALGLQQMPPNQVLIGLALFLTLFIMAPIGQDINNNAI 91

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           +P    +IT+  A Q   +P   FM   TR+ DL+LF+ +A     N +      +  R+
Sbjct: 92  KPYTEGKITQEEAYQNAIKPLKNFMLKQTRQSDLNLFVSLAKIKVNNAE-----DLPMRV 146

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           +IPSF+ISEL+ +FEIGF+I +PFLIID++VA+++M+MGM MLPP  ISLPFKV+ F+L+
Sbjct: 147 VIPSFIISELKTAFEIGFIIYIPFLIIDIVVASVLMSMGMFMLPPVLISLPFKVLLFILV 206

Query: 232 DGWSLLVENLVKSF 245
           DGW+L+V++L+  F
Sbjct: 207 DGWNLVVKSLILGF 220


>gi|152979946|ref|YP_001353121.1| flagellar biosynthesis protein FliP [Janthinobacterium sp.
           Marseille]
 gi|151280023|gb|ABR88433.1| Flip component of flagellar biosynthesis pathway [Janthinobacterium
           sp. Marseille]
          Length = 252

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 130/193 (67%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +L+M+T F R IIV S+LR  +G  S PPN VII L+LF+T +VMSP LD+      Q
Sbjct: 63  PAVLLMMTSFTRIIIVLSLLRQALGTQSSPPNQVIIGLSLFLTLFVMSPVLDKIYVDAYQ 122

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P   N+I    A+ +   P   FM   TRE DL+L++ ++    +  ++   + I  RIL
Sbjct: 123 PFSQNKIQMQEALDKAVAPLKTFMIKQTRESDLALYVKLS----KGPELQGPEDIPLRIL 178

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+F+ SEL+ +F+I F I +PFLIIDM+VA+++M+MGMMM+ P  ++LPFK++ FVL+D
Sbjct: 179 VPAFVTSELKTAFQISFAIFIPFLIIDMVVASVLMSMGMMMVSPAIVALPFKLMLFVLVD 238

Query: 233 GWSLLVENLVKSF 245
           GW LL+ +L +SF
Sbjct: 239 GWQLLIGSLAQSF 251


>gi|160876167|ref|YP_001555483.1| flagellar biosynthesis protein FliP [Shewanella baltica OS195]
 gi|217972626|ref|YP_002357377.1| flagellar biosynthesis protein FliP [Shewanella baltica OS223]
 gi|160861689|gb|ABX50223.1| flagellar biosynthetic protein FliP [Shewanella baltica OS195]
 gi|217497761|gb|ACK45954.1| flagellar biosynthetic protein FliP [Shewanella baltica OS223]
 gi|315268363|gb|ADT95216.1| flagellar biosynthetic protein FliP [Shewanella baltica OS678]
          Length = 248

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 135/201 (67%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T LS  P +LIM+T F R IIV SILR  +G+   P N V+I ++LFMTF++M+P  D
Sbjct: 51  LMTSLSFLPAMLIMLTSFTRIIIVLSILRQAIGLQQTPSNQVLIGMSLFMTFFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  + G++P +  Q+T   A ++  EP   FM    R  DL  F+++  S ++N  I   
Sbjct: 111 RIYDEGVKPYIEEQLTLQQAFEKGKEPLKGFMLGQVRTTDLKTFIEI--SGYKN--IKSP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           +     +LIP+F+ SEL+ +F+IGF++ +PFL++D++VA+I+MAMGMMML P  +SLPFK
Sbjct: 167 EEAPMSVLIPAFITSELKTAFQIGFMLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGWSL++  L  SF
Sbjct: 227 IMLFVLVDGWSLVLGTLANSF 247


>gi|325981181|ref|YP_004293583.1| flagellar biosynthetic protein FliP [Nitrosomonas sp. AL212]
 gi|325530700|gb|ADZ25421.1| flagellar biosynthetic protein FliP [Nitrosomonas sp. AL212]
          Length = 248

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 86/193 (44%), Positives = 135/193 (69%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P L++M++ F R IIV S+LR  +G  S PPN V++ LALF+TF++MSP +DR       
Sbjct: 58  PALVLMMSSFTRIIIVLSLLRMALGTQSSPPNQVLLGLALFLTFFIMSPVIDRVYSEAYL 117

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P   ++I+   A ++ + P   FM + TRE DL+LF+ ++ S     ++   D +  +IL
Sbjct: 118 PFSEDKISIMEAAEKASVPLKSFMLHQTRETDLALFVQISESE----ELESRDQVPLKIL 173

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+++ SEL+ +F+IGF+I +PFLIID++V++++MAMGMMML P  ISLPFK++ FVL+D
Sbjct: 174 VPAYITSELKTAFQIGFVIFIPFLIIDLVVSSVLMAMGMMMLSPMIISLPFKLMLFVLVD 233

Query: 233 GWSLLVENLVKSF 245
           GW L++ +L +SF
Sbjct: 234 GWHLIIGSLTQSF 246


>gi|167770202|ref|ZP_02442255.1| hypothetical protein ANACOL_01545 [Anaerotruncus colihominis DSM
           17241]
 gi|167667524|gb|EDS11654.1| hypothetical protein ANACOL_01545 [Anaerotruncus colihominis DSM
           17241]
          Length = 270

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 148/240 (61%), Gaps = 10/240 (4%)

Query: 16  LVFAKSSLHDVMNIPADLSISTWIVRTFG------IFTILSIAPILLIMVTCFPRFIIVF 69
           LV    + H    +  DL         FG      + T+L++AP +LIM+T F R IIV 
Sbjct: 30  LVCCTITAHAAPMVTVDLGSGDASGNAFGLIDMLFVVTLLALAPSILIMMTSFTRIIIVL 89

Query: 70  SILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVA 129
           S LR  +G+   PPN V+I LALF+T ++M P +++  E   QP    QIT+  A+ R  
Sbjct: 90  SFLRNALGIQQTPPNQVLIGLALFLTLFIMFPVINQINEEAYQPYRQGQITQEEAVTRGI 149

Query: 130 EPFWVFMRNNTREKDLSLFMDMAHSS---HRNTDITKN-DHIEYRILIPSFMISELRRSF 185
            P   FM   TR  D++LF+ +A+      +   I ++   +   I+IP+F+ SEL+++F
Sbjct: 150 RPLKEFMIRQTRTDDVNLFLSIANDKRPPEQAITIPEDLTELGMEIVIPAFITSELKQAF 209

Query: 186 EIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
            IGFL+ +PFLIIDM+V++ +M+MGM+MLPP+ ISLPFK++ FV++DGW LL+ NLV+ F
Sbjct: 210 MIGFLLFIPFLIIDMVVSSTLMSMGMVMLPPSMISLPFKIMMFVMVDGWGLLLGNLVRGF 269


>gi|55977145|gb|AAV68366.1| FliP [Herminiimonas arsenicoxydans]
          Length = 271

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 130/193 (67%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +L+M+T F R IIV S+LR  +G  S PPN VII L+LF+T +VMSP LD+      Q
Sbjct: 82  PAVLLMMTSFTRIIIVLSLLRQALGTQSSPPNQVIIGLSLFLTLFVMSPVLDKIYVDAYQ 141

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P   N+I    A+ +   P   FM   TRE DL+L++ M+    +  ++   + I  RIL
Sbjct: 142 PFSANKIQMGEALDKAVAPLKTFMIKQTRESDLALYVKMS----KGPELQGPEDIPLRIL 197

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+F+ SEL+ +F+I F I +PFLIIDM+VA+++M+MGMMM+ P  ++LPFK++ FVL+D
Sbjct: 198 VPAFITSELKTAFQISFAIFIPFLIIDMVVASVLMSMGMMMVSPAIVALPFKLMLFVLVD 257

Query: 233 GWSLLVENLVKSF 245
           GW LL+ +L +SF
Sbjct: 258 GWQLLIGSLAQSF 270


>gi|126175118|ref|YP_001051267.1| flagellar biosynthesis protein FliP [Shewanella baltica OS155]
 gi|153001442|ref|YP_001367123.1| flagellar biosynthesis protein FliP [Shewanella baltica OS185]
 gi|125998323|gb|ABN62398.1| flagellar biosynthetic protein FliP [Shewanella baltica OS155]
 gi|151366060|gb|ABS09060.1| flagellar biosynthetic protein FliP [Shewanella baltica OS185]
          Length = 248

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 135/201 (67%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T LS  P +LIM+T F R IIV SILR  +G+   P N V+I ++LFMTF++M+P  D
Sbjct: 51  LMTSLSFLPAMLIMLTSFTRIIIVLSILRQAIGLQQTPSNQVLIGMSLFMTFFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  + G++P +  Q+T   A ++  EP   FM    R  DL  F+++  S ++N  I   
Sbjct: 111 RIYDEGVKPYIEEQLTLQQAFEKGKEPLKGFMLGQVRTTDLKTFIEI--SGYKN--IKSP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           +     +LIP+F+ SEL+ +F+IGF++ +PFL++D++VA+I+MAMGMMML P  +SLPFK
Sbjct: 167 EEAPMSVLIPAFITSELKTAFQIGFMLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGWSL++  L  SF
Sbjct: 227 IMLFVLVDGWSLVLGTLANSF 247


>gi|28211318|ref|NP_782262.1| flagellar biosynthesis protein FliP [Clostridium tetani E88]
 gi|28203758|gb|AAO36199.1| flagellar biosynthetic protein fliP [Clostridium tetani E88]
          Length = 261

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 144/206 (69%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++ F + T LSI P  ++M+T F R  +VF  LR  MG    PPN V++ LALF+T ++M
Sbjct: 59  LKLFLMITALSILPSFIVMMTSFVRISVVFGFLRNAMGTQQSPPNQVLVGLALFLTIFIM 118

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +P      +  IQP + ++I +  A +  ++P   FM   TREKDL LF+++   S+ + 
Sbjct: 119 TPVYQIINKEAIQPFVKSEINQEQAFETGSKPLREFMLKQTREKDLKLFVEI---SNIDK 175

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           +ITK +++   +++PSF+ISEL+ +F+IGFL+ +PFL+ID++VA+++M+MGM MLPP  +
Sbjct: 176 NITK-ENVPLYVVVPSFIISELKTAFQIGFLLYIPFLVIDLVVASVLMSMGMFMLPPVMV 234

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FV++DGW LL+++L+ SF
Sbjct: 235 SLPFKLLLFVMVDGWHLLIKSLIMSF 260


>gi|289578418|ref|YP_003477045.1| flagellar biosynthetic protein FliP [Thermoanaerobacter italicus
           Ab9]
 gi|297544694|ref|YP_003676996.1| flagellar biosynthetic protein FliP [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|289528131|gb|ADD02483.1| flagellar biosynthetic protein FliP [Thermoanaerobacter italicus
           Ab9]
 gi|296842469|gb|ADH60985.1| flagellar biosynthetic protein FliP [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 221

 Score =  181 bits (460), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 134/194 (69%), Gaps = 5/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIM+T F R +IV S LR  +G+  +PPN V+I LALF+T ++M+P         I
Sbjct: 32  APSILIMMTSFTRIVIVLSFLRNALGLQQMPPNQVLIGLALFLTLFIMAPIGQDINNNAI 91

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           +P    +IT+  A Q   +P   FM   TR+ DL+LF+ +A       +++  + +  R+
Sbjct: 92  KPYTEGKITQEEAYQNAIKPLKSFMLKQTRQNDLNLFVSLAK-----INVSNVEDLPMRV 146

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           +IP+F+ISEL+ +FEIGF+I +PFLIID+IVA+++M+MGM MLPP  ISLPFKV+ F+L+
Sbjct: 147 VIPAFIISELKTAFEIGFIIYIPFLIIDIIVASVLMSMGMFMLPPVLISLPFKVLLFILV 206

Query: 232 DGWSLLVENLVKSF 245
           DGW+L+V++L+  F
Sbjct: 207 DGWNLVVKSLILGF 220


>gi|83646770|ref|YP_435205.1| flagellar biosynthesis protein FliP [Hahella chejuensis KCTC 2396]
 gi|83634813|gb|ABC30780.1| flagellar biosynthetic protein FliP [Hahella chejuensis KCTC 2396]
          Length = 243

 Score =  181 bits (460), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 138/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T+LS+AP LLI +T F R +IV S+LR   GM   PPN VII+L+LF+T + M
Sbjct: 41  LQVLAVLTVLSLAPALLIALTSFTRIVIVLSMLRYAFGMQQTPPNTVIIALSLFLTLFTM 100

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +P  ++  +  +QP +  ++  T A+     P   FM   TREKDL+L ++MA      T
Sbjct: 101 APVFNKIDQQAVQPYLAGELVFTEAVNAGLAPMREFMVRQTREKDLALAIEMAGEESPET 160

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
               ND I    LI +FM+SEL+ +F+IGF+I LPFL+ID++ A+++M+MGM+M+PP +I
Sbjct: 161 ---LND-ISNTSLITAFMLSELQTAFQIGFVIFLPFLLIDLVSASVLMSMGMIMVPPLTI 216

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLP K++ FVLI+GW+L+ + LV SF
Sbjct: 217 SLPVKILMFVLIEGWTLVAQALVGSF 242


>gi|168334561|ref|ZP_02692717.1| flagellar biosynthetic protein FliP [Epulopiscium sp. 'N.t.
           morphotype B']
          Length = 243

 Score =  181 bits (460), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 144/232 (62%), Gaps = 4/232 (1%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILR 73
           P  VF+  +L+ +   P      T +   F I T L + P LL++ T F R II    L+
Sbjct: 14  PTRVFSLDALNSITQSP---EFGTSLQLVFFI-TFLGLIPTLLLVSTSFTRIIITLYFLK 69

Query: 74  TGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFW 133
           T MG   +PPN V+I LALF+TF+VMSP +       I P    QI++   +++ A P  
Sbjct: 70  TAMGTQQMPPNQVVIGLALFLTFFVMSPVVSTINTEAIVPYSEGQISQMEFLEQAAAPIK 129

Query: 134 VFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIIL 193
            FM   TR +D+ LFMD+++      +      + Y I++P+F+ISE+R  F IGFL+ L
Sbjct: 130 EFMVMQTRXEDIKLFMDLSNQPAIVDETNILAQLPYHIVVPAFIISEIRAGFVIGFLMYL 189

Query: 194 PFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           PF+IIDM+VA+++MAMGMMMLPP  ISLPFK++ F+++DGW L++  LV++F
Sbjct: 190 PFIIIDMVVASVLMAMGMMMLPPAMISLPFKILIFIIVDGWHLIIGELVETF 241


>gi|149193956|ref|ZP_01871054.1| flagellar biosynthesis protein P [Caminibacter mediatlanticus TB-2]
 gi|149135909|gb|EDM24387.1| flagellar biosynthesis protein P [Caminibacter mediatlanticus TB-2]
          Length = 243

 Score =  181 bits (460), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 136/199 (68%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           TIL +AP ++++ T F R ++VF  LR  +G    PP  +++SL+L +TF++M P    +
Sbjct: 48  TILVLAPSIVLVATSFVRLLVVFGFLRQALGTPQSPPTTLLVSLSLVLTFFIMEPYAKEA 107

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            + GI+P M  +I    A  R  +PF  FM  NTREKDL+LF  + H  +  T     D 
Sbjct: 108 YKSGIKPYMEQKIGYEEAFNRAVKPFKRFMIKNTREKDLALFFRIRHLPNPKTI----DD 163

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           +   IL+P+FMISEL+ +FEIGFLI LPFLIIDM+V++I+M++GMMMLPP  ISLPFK++
Sbjct: 164 VPLSILVPAFMISELKTAFEIGFLIFLPFLIIDMVVSSILMSLGMMMLPPVMISLPFKIL 223

Query: 227 FFVLIDGWSLLVENLVKSF 245
            F+L+DGW+L+V  LV SF
Sbjct: 224 VFILVDGWNLIVMGLVNSF 242


>gi|312884901|ref|ZP_07744591.1| flagellar biosynthesis protein FliP [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367378|gb|EFP94940.1| flagellar biosynthesis protein FliP [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 290

 Score =  181 bits (460), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 136/206 (66%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T+L   P ++I++T F R ++V SILR  MG+   P N VI+ +A+F+TF++M
Sbjct: 88  LQILALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIVGIAIFLTFFIM 147

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP L++  E  IQP +N QIT   A      P   FM   TR KDL  F++++ S+    
Sbjct: 148 SPVLNKINEDAIQPYINEQITARKAFDLAQIPMRDFMLKQTRVKDLETFVNISGSTA--- 204

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
             T    +   +LIP+F+ SEL+ +F+IGF++ LPFLIID++VA+++MAMGMMML P  +
Sbjct: 205 --TATSDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGMMMLSPMIV 262

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 263 SLPFKLMLFVLVDGWNLILSTLAGSF 288


>gi|254785480|ref|YP_003072909.1| flagellar biosynthesis protein FliP [Teredinibacter turnerae T7901]
 gi|237683712|gb|ACR10976.1| flagellar biosynthetic protein FliP [Teredinibacter turnerae T7901]
          Length = 283

 Score =  181 bits (460), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 132/201 (65%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T L+  P +L+M+T F R IIVF+ILR  MG+   P N ++I LALF+T ++M+P LD
Sbjct: 85  LMTALTFLPAILMMMTSFTRIIIVFAILRQAMGLQQSPSNQILIGLALFLTLFIMTPVLD 144

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
                 +QP MN Q++   A+     PF  FM  NTRE DL LF  +   +     +   
Sbjct: 145 EVNRTALQPYMNEQMSARQALDNAKLPFHAFMIANTRESDLDLFFRIGDIAP----VATP 200

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
             + + +L+P+F+ SEL+ +F+IGF+I +PFL+ID++VA+++MAMGMMML P  ISLPFK
Sbjct: 201 QDVPFTVLMPAFVTSELKTAFQIGFIIFIPFLVIDIVVASVLMAMGMMMLSPLIISLPFK 260

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L++  L  SF
Sbjct: 261 IMLFVLVDGWGLIMGTLAASF 281


>gi|146278775|ref|YP_001168934.1| flagellar biosynthesis protein FliP [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557016|gb|ABP71629.1| flagellar biosynthetic protein FliP [Rhodobacter sphaeroides ATCC
           17025]
          Length = 236

 Score =  181 bits (460), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 141/212 (66%), Gaps = 5/212 (2%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALF 93
           S++T  V+   + T+LS+ P L +M+TCFP  + V SILR  +G+   PPN++I+SLALF
Sbjct: 29  SLTTRSVQLIVLITLLSLVPALGMMITCFPFIVTVLSILRQAIGLQQAPPNMLIVSLALF 88

Query: 94  MTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH 153
           +T+Y+M P    +   GI+PL  N+I    A+   + PF  FM       DL  F  +  
Sbjct: 89  LTWYIMDPVFTEAWTRGIEPLTRNEIDIQQALVLASAPFRGFMAARL---DLETFSTL-- 143

Query: 154 SSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMM 213
            + R  +I+      + +L+PSF++SE++R+FEIGFLI LPFLIID++VA ++M+MGMMM
Sbjct: 144 QALRPGEISPPLEAPFSVLVPSFLLSEIQRAFEIGFLIFLPFLIIDLVVAAVLMSMGMMM 203

Query: 214 LPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           +PP  +S+PFK+ FFV+ DGWSL+   LV+S+
Sbjct: 204 VPPAVVSMPFKLAFFVVGDGWSLISGALVRSY 235


>gi|89094445|ref|ZP_01167385.1| flagellar biosynthetic protein FliP [Oceanospirillum sp. MED92]
 gi|89081337|gb|EAR60569.1| flagellar biosynthetic protein FliP [Oceanospirillum sp. MED92]
          Length = 250

 Score =  181 bits (459), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 136/201 (67%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T+L+  P +L+M+T F R IIVF+ILR  +G+   P N +++ +A+F+T ++M+P LD
Sbjct: 52  LMTMLTFLPAMLMMMTSFARIIIVFAILRQALGLQQTPSNQIMVGMAMFLTLFIMTPVLD 111

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +      QP MN ++    A+Q  + PF  FM    RE DL LFM ++ +    T     
Sbjct: 112 QIYIQAAQPYMNEEMNVLEALQAASIPFREFMMLQVRESDLELFMRISGTPAVETP---- 167

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           + I + +L+P+F+ SEL+ +F+IGF++ +PFLIID++VA+++MAMGMMML P  ISLPFK
Sbjct: 168 EQIPFTVLVPAFVTSELKTAFQIGFMLFIPFLIIDLVVASVLMAMGMMMLSPVIISLPFK 227

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L++  L  SF
Sbjct: 228 IMLFVLVDGWALVIGTLAASF 248


>gi|126734123|ref|ZP_01749870.1| flagellar biosynthetic protein FliP [Roseobacter sp. CCS2]
 gi|126716989|gb|EBA13853.1| flagellar biosynthetic protein FliP [Roseobacter sp. CCS2]
          Length = 243

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 135/214 (63%), Gaps = 3/214 (1%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D S++T  ++   + T+LS+ P + IMVTCFP  I VF+ILR  +G+   PPN++I+SLA
Sbjct: 31  DGSLATRSIQLLILITVLSLVPGIAIMVTCFPFIITVFAILRQAIGLQQSPPNMLIVSLA 90

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+T++VM P    +   GI PL+  QI       R  EP  VFM         +   D+
Sbjct: 91  LFLTYFVMEPVFREAWSNGIDPLIQGQIALEEGFVRTIEPLQVFMLTRIDPDTFTALADL 150

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
                 N   +        I++PSF++SE+ R+F++GFLI +PFLIID++VA ++M+MGM
Sbjct: 151 RPDVSGNGPASDA---PLSIVVPSFLLSEMERAFQVGFLIFMPFLIIDLVVAAVLMSMGM 207

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MM+PP  +SLPFK+ FFV+ DGW+L+  +LV+ +
Sbjct: 208 MMVPPAIVSLPFKLAFFVVADGWTLIATSLVQGY 241


>gi|317121829|ref|YP_004101832.1| flagellar biosynthetic protein FliP [Thermaerobacter marianensis
           DSM 12885]
 gi|315591809|gb|ADU51105.1| flagellar biosynthetic protein FliP [Thermaerobacter marianensis
           DSM 12885]
          Length = 227

 Score =  181 bits (459), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 132/194 (68%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIM+T F R ++  S LR+ +G    PPN V++ LALF+T +VM+P   +  +   
Sbjct: 34  APAILIMMTGFTRIVVALSFLRSALGTQQAPPNQVLVGLALFLTVFVMAPVWQQVYQDAW 93

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
            P  + QI +  A+QR  +P   FM   TRE+DL+LF++++        +   D +   +
Sbjct: 94  VPYRDGQIGQVEALQRAQQPVREFMFRYTRERDLALFLELSGRG----PVESRDQVPTYV 149

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           LIP+F ISEL+ +F+IGF++ +PFL+IDM+VA+ +M+MGM+M+PP  +SLPFK++ FVL+
Sbjct: 150 LIPAFAISELKTAFQIGFILYVPFLVIDMVVASTLMSMGMLMVPPMLVSLPFKILLFVLV 209

Query: 232 DGWSLLVENLVKSF 245
           DGW+L+V +L+ SF
Sbjct: 210 DGWNLVVRSLLASF 223


>gi|195953030|ref|YP_002121320.1| flagellar biosynthesis protein FliP [Hydrogenobaculum sp. Y04AAS1]
 gi|195932642|gb|ACG57342.1| flagellar biosynthetic protein FliP [Hydrogenobaculum sp. Y04AAS1]
          Length = 252

 Score =  181 bits (458), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 96/210 (45%), Positives = 144/210 (68%), Gaps = 3/210 (1%)

Query: 37  TWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTF 96
           T  +R   I T+LS+AP ++IM T F R + V S+LR  +G+ +VPPN VI SLALF+TF
Sbjct: 44  TEAIRLILILTVLSLAPSIIIMTTSFIRIVTVLSVLRQAIGLPNVPPNQVITSLALFLTF 103

Query: 97  YVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSH 156
           YVM P +++  +  +QP + ++IT+   IQ   EP   FM  NT+      F+    S+ 
Sbjct: 104 YVMYPVINQINQNALQPYLQHKITDKQFIQNTIEPIKDFMVRNTKVSTERTFL--LASNI 161

Query: 157 RNTDITKN-DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLP 215
            N D  KN + +   ++IP+FM+SEL  +F+I FL+ LPFLIIDM+V+ I++AMG++M+P
Sbjct: 162 PNKDNIKNINDLPLSVVIPAFMVSELSIAFQIIFLLYLPFLIIDMVVSAILLAMGIIMIP 221

Query: 216 PTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           PT ISLPFK++ FVL++GW L++ +LV+S+
Sbjct: 222 PTVISLPFKIMLFVLVNGWELVILSLVRSY 251


>gi|221639477|ref|YP_002525739.1| flagellar biosynthesis protein FliP [Rhodobacter sphaeroides KD131]
 gi|221160258|gb|ACM01238.1| Flagellar biosynthetic protein fliP [Rhodobacter sphaeroides KD131]
          Length = 249

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 135/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T L++ P L++ ++ F R IIV SILR  +G    PPN V+I+LALF+TF+VM
Sbjct: 45  LQILALMTALTVLPSLVLGMSAFTRIIIVLSILRQALGTQQTPPNQVLIALALFLTFFVM 104

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PTL    E  + P ++ QI    AI+R       F+  NTR+ DL +F D+A +     
Sbjct: 105 QPTLGALYEQSLSPFLDGQIEAQPAIERGGAIMKDFLIANTRQNDLLMFSDLAGAGPY-- 162

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
              +   + +  L+P+FM SEL+ +F+IGFL+ LPFL+IDM++A+I+MA+GMMML P  +
Sbjct: 163 --AEPTEVPFSTLLPAFMTSELKTAFQIGFLLFLPFLVIDMVIASILMALGMMMLSPMLV 220

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L V +L  ++
Sbjct: 221 SLPFKLLLFVLVDGWALTVGSLAATY 246


>gi|120598260|ref|YP_962834.1| flagellar biosynthesis protein FliP [Shewanella sp. W3-18-1]
 gi|146293662|ref|YP_001184086.1| flagellar biosynthesis protein FliP [Shewanella putrefaciens CN-32]
 gi|120558353|gb|ABM24280.1| flagellar biosynthetic protein FliP [Shewanella sp. W3-18-1]
 gi|145565352|gb|ABP76287.1| flagellar biosynthetic protein FliP [Shewanella putrefaciens CN-32]
 gi|319427061|gb|ADV55135.1| flagellar biosynthetic protein FliP [Shewanella putrefaciens 200]
          Length = 248

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 133/199 (66%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T LS  P ++IM+T F R I+V SILR  +G+   P N V+I ++LFMTF++M+P  D+ 
Sbjct: 53  TSLSFLPAMVIMLTSFTRIIVVLSILRQAIGLQQTPSNQVLIGMSLFMTFFIMAPVFDKI 112

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            + G++P ++ Q+T   A  +  EP   FM    R  DL  F+D+  S ++N  I   + 
Sbjct: 113 YDQGVKPYIDEQLTLQQAFDKGKEPLRAFMLGQVRTTDLKTFIDI--SGYQN--INSPEE 168

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
               +L+P+F+ SEL+ +F+IGF++ +PFL++D++VA+I+MAMGMMML P  +SLPFK++
Sbjct: 169 APMSVLVPAFITSELKTAFQIGFMLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFKIM 228

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW L++  L  SF
Sbjct: 229 LFVLVDGWGLVLGTLANSF 247


>gi|114332025|ref|YP_748247.1| flagellar biosynthesis protein FliP [Nitrosomonas eutropha C91]
 gi|114309039|gb|ABI60282.1| flagellar biosynthetic protein FliP [Nitrosomonas eutropha C91]
          Length = 261

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/244 (39%), Positives = 155/244 (63%), Gaps = 7/244 (2%)

Query: 5   CFFALFLVTPELVFA-KSSLHDVMNIPADLSISTWIVRTFGIFTILSIA--PILLIMVTC 61
           C   L +V    VFA K+ L  + + PA    +T+ +    +  + S+   P  ++M++ 
Sbjct: 20  CIILLLVVGISPVFAQKAGLPAITSTPAAGGGTTYSLSLQTLLLLTSMTFLPATVLMMSS 79

Query: 62  FPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITE 121
           F R IIV S+LR  +G  S PPN V++ LALF++F++MSP +D+       P   ++I+ 
Sbjct: 80  FTRIIIVLSLLRQALGTQSSPPNQVLVGLALFLSFFIMSPVIDKMYTEAYLPFSEDKISI 139

Query: 122 TTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISEL 181
             A+ + ++P  +FM   TRE D++LF  ++ S     +I   D +  +IL+P+++ SEL
Sbjct: 140 IEAMDKASDPLKIFMLRQTRETDIALFARISGSE----EIESPDQVPMKILVPAYITSEL 195

Query: 182 RRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENL 241
           + +F+IGF++ +PFLIIDM+VA+ +MAMGMMML P  ISLPFK++ FVL+DGW LL+ +L
Sbjct: 196 KTAFQIGFIVFIPFLIIDMVVASTLMAMGMMMLSPMIISLPFKLMLFVLVDGWHLLIGSL 255

Query: 242 VKSF 245
            +SF
Sbjct: 256 TQSF 259


>gi|113969635|ref|YP_733428.1| flagellar biosynthesis protein FliP [Shewanella sp. MR-4]
 gi|113884319|gb|ABI38371.1| flagellar biosynthetic protein FliP [Shewanella sp. MR-4]
          Length = 248

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 134/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T LS  P ++IM+T F R I+V SILR  +G+   P N V+I ++LFMTF++M+P  D
Sbjct: 51  LMTSLSFIPAMVIMLTSFTRIIVVLSILRQAIGLQQTPSNQVLIGMSLFMTFFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  + G++P ++ Q+T   A  +  EP   FM    R  DL  F+D+  S ++N  I   
Sbjct: 111 KIYDQGVKPYIDEQLTLQQAFDKGKEPLRAFMLGQVRTTDLKTFIDI--SGYQN--INSP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           +     +L+P+F+ SEL+ +F+IGF++ +PFL++D++VA+I+MAMGMMML P  +SLPFK
Sbjct: 167 EEAPMSVLVPAFITSELKTAFQIGFMLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L++  L  SF
Sbjct: 227 IMLFVLVDGWGLVMGTLANSF 247


>gi|160939626|ref|ZP_02086974.1| hypothetical protein CLOBOL_04518 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437417|gb|EDP15181.1| hypothetical protein CLOBOL_04518 [Clostridium bolteae ATCC
           BAA-613]
          Length = 258

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 135/203 (66%), Gaps = 2/203 (0%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           +F  L++ P L+IM+T F R +IV S LR  +G    PPN +++ LALF+T ++MSP + 
Sbjct: 55  LFLFLAVVPSLIIMMTSFTRIVIVLSFLRNALGTQQSPPNQILVGLALFLTLFIMSPVIA 114

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
                  QP    QIT   A +R  EP   FM   T +K L LF+ ++ +   +    + 
Sbjct: 115 SVNTQAYQPYREGQITREQAFERAQEPMKEFMLKQTEKKSLDLFLSISKAQPPDISQGQE 174

Query: 165 DHIEYRI--LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLP 222
            +++  +  ++PSF++SEL ++F +GFLI +PFLIID++V++ +M+MGM+MLPPT I+LP
Sbjct: 175 GYMKLGLTTIVPSFILSELNKAFTMGFLIFIPFLIIDLVVSSTLMSMGMVMLPPTMIALP 234

Query: 223 FKVIFFVLIDGWSLLVENLVKSF 245
           FK++ FVL+DGWSL+++ LV+SF
Sbjct: 235 FKIMMFVLVDGWSLVIKTLVQSF 257


>gi|56460298|ref|YP_155579.1| flagellar biosynthesis protein FliP [Idiomarina loihiensis L2TR]
 gi|56179308|gb|AAV82030.1| Flagellar biosynthesis protein FliP [Idiomarina loihiensis L2TR]
          Length = 248

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 94/243 (38%), Positives = 147/243 (60%), Gaps = 6/243 (2%)

Query: 5   CFFALFLVTPELVFAKSSLH--DVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCF 62
           C  A+  + PE  FA   L    V   P      +  ++   I T L+  P ++IM+T F
Sbjct: 8   CILAVLCLLPEQAFAWQDLTAVTVKTNPDGSEEYSVTLQILAIMTALTFIPAMVIMMTSF 67

Query: 63  PRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITET 122
            R IIV +ILR  +G+   P N V++ +ALF++F++M+P L+   +  +QP +N +I   
Sbjct: 68  TRIIIVLAILRQAIGLQQSPSNQVLLGIALFLSFFIMTPVLNEINDKALQPYLNEEIQSM 127

Query: 123 TAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELR 182
            A+ R   P   FM   TR  DL  F++++ +      + + + +   +LIPSF+ SEL+
Sbjct: 128 EAVDRAKAPIKAFMLAQTRLTDLETFVEISGTEG----VQEPEDVPMSVLIPSFITSELK 183

Query: 183 RSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLV 242
            +F+IGF++ +PFLIID++VA+++MAMGMMML P  +SLPFK++ FVL+DGWSL +  L 
Sbjct: 184 TAFQIGFMLFIPFLIIDLVVASVLMAMGMMMLSPMIVSLPFKLMLFVLVDGWSLTMSTLA 243

Query: 243 KSF 245
            SF
Sbjct: 244 GSF 246


>gi|114046865|ref|YP_737415.1| flagellar biosynthesis protein FliP [Shewanella sp. MR-7]
 gi|113888307|gb|ABI42358.1| flagellar biosynthetic protein FliP [Shewanella sp. MR-7]
          Length = 248

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 134/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T LS  P ++IM+T F R I+V SILR  +G+   P N V+I ++LFMTF++M+P  D
Sbjct: 51  LMTSLSFIPAMVIMLTSFTRIIVVLSILRQAIGLQQTPSNQVLIGMSLFMTFFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  + G++P ++ Q+T   A  +  EP   FM    R  DL  F+D+  S ++N  I   
Sbjct: 111 KIYDQGVKPYIDEQLTLQQAFDKGKEPLRAFMLGQVRTTDLKTFIDI--SGYQN--INSP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           +     +L+P+F+ SEL+ +F+IGF++ +PFL++D++VA+I+MAMGMMML P  +SLPFK
Sbjct: 167 EEAPMSVLVPAFITSELKTAFQIGFMLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L++  L  SF
Sbjct: 227 IMLFVLVDGWGLVMGTLANSF 247


>gi|332558490|ref|ZP_08412812.1| flagellar biosynthesis protein FliP [Rhodobacter sphaeroides WS8N]
 gi|332276202|gb|EGJ21517.1| flagellar biosynthesis protein FliP [Rhodobacter sphaeroides WS8N]
          Length = 267

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 135/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T L++ P L++ ++ F R IIV SILR  +G    PPN V+I+LALF+TF+VM
Sbjct: 63  LQILALMTALTVLPSLVLGMSAFTRIIIVLSILRQALGTQQTPPNQVLIALALFLTFFVM 122

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PTL    E  + P ++ QI    AI+R       F+  NTR+ DL +F D+A +     
Sbjct: 123 QPTLGALYEQSLSPFLDGQIEAQPAIERGGAIMKDFLIANTRQNDLLMFSDLAGAG---- 178

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
              +   + +  L+P+FM SEL+ +F+IGFL+ LPFL+IDM++A+I+MA+GMMML P  +
Sbjct: 179 PYAEPTEVPFSTLLPAFMTSELKTAFQIGFLLFLPFLVIDMVIASILMALGMMMLSPMLV 238

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L V +L  S+
Sbjct: 239 SLPFKLLLFVLVDGWALTVGSLAASY 264


>gi|24374730|ref|NP_718773.1| flagellar biosynthesis protein FliP [Shewanella oneidensis MR-1]
 gi|24349390|gb|AAN56217.1|AE015759_9 flagellar biosynthetic protein FliP [Shewanella oneidensis MR-1]
          Length = 247

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 133/199 (66%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T LS  P ++IM+T F R I+V SILR  +G+   P N V+I ++LFMTF++M+P  D+ 
Sbjct: 52  TSLSFIPAMVIMLTSFTRIIVVLSILRQAIGLQQTPSNQVLIGMSLFMTFFIMAPVFDKI 111

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            + G++P ++ Q+T   A  +  EP   FM    R  DL  F+D+  S ++N  I   + 
Sbjct: 112 YDQGVKPYIDEQLTLQQAFDKGKEPLRAFMLGQVRTTDLKTFIDI--SGYQN--INSPEE 167

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
               +L+P+F+ SEL+ +F+IGF++ +PFL++D++VA+I+MAMGMMML P  +SLPFK++
Sbjct: 168 APMSVLVPAFITSELKTAFQIGFMLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFKIM 227

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW L++  L  SF
Sbjct: 228 LFVLVDGWGLVMGTLANSF 246


>gi|157737241|ref|YP_001489924.1| flagellar biosynthesis protein FliP [Arcobacter butzleri RM4018]
 gi|157699095|gb|ABV67255.1| flagellar biosynthetic protein FliP [Arcobacter butzleri RM4018]
          Length = 241

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 128/188 (68%), Gaps = 4/188 (2%)

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           MVT F R IIVFS+LR  MG+   PP+ +IISL+L +T ++M P   ++ +  I P M+ 
Sbjct: 57  MVTSFTRLIIVFSLLRQAMGLQQTPPSQIIISLSLILTIFIMEPYAKKAWDDAIVPYMDE 116

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           +I    A  +   PF  FM  NTRE DL+LF    +   +  +    + +   +L+P+F+
Sbjct: 117 KIGYEVAFDKGVAPFKEFMIKNTREADLALF----YRIKKEPNPKNIEAVPLTLLMPAFI 172

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
           +SELR +FEIGFLI LPFL+ID+IVA+I+M++GMMMLPP  ISLP K+IFF+++DGW L+
Sbjct: 173 VSELRTAFEIGFLIFLPFLVIDIIVASILMSLGMMMLPPVMISLPIKIIFFIVVDGWQLI 232

Query: 238 VENLVKSF 245
           + NL +SF
Sbjct: 233 IGNLAQSF 240


>gi|117919800|ref|YP_868992.1| flagellar biosynthesis protein FliP [Shewanella sp. ANA-3]
 gi|117612132|gb|ABK47586.1| flagellar biosynthetic protein FliP [Shewanella sp. ANA-3]
          Length = 248

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 134/201 (66%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T LS  P ++IM+T F R I+V SILR  +G+   P N V+I ++LFMTF++M+P  D
Sbjct: 51  LMTSLSFIPAMVIMLTSFTRIIVVLSILRQAIGLQQTPSNQVLIGMSLFMTFFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  + G++P ++ Q+T   A  +  EP   FM    R  DL  F+D+  S ++N  I   
Sbjct: 111 KIYDQGVKPYIDEQLTLQQAFDKGKEPLRAFMLGQVRTTDLKTFIDI--SGYQN--INSP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           +     +L+P+F+ SEL+ +F+IGF++ +PFL++D++VA+I+MAMGMMML P  +SLPFK
Sbjct: 167 EEAPMSVLVPAFITSELKTAFQIGFMLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L++  L  SF
Sbjct: 227 IMLFVLVDGWGLVMGTLANSF 247


>gi|225181595|ref|ZP_03735036.1| flagellar biosynthetic protein FliP [Dethiobacter alkaliphilus AHT
           1]
 gi|225167703|gb|EEG76513.1| flagellar biosynthetic protein FliP [Dethiobacter alkaliphilus AHT
           1]
          Length = 257

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/193 (43%), Positives = 133/193 (68%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P  L ++T F R ++V   +R  +     PPN VII LALF+TF++M+P   +  E  IQ
Sbjct: 68  PAFLALMTSFTRIVVVLGFVRNALATQQTPPNQVIIGLALFLTFFIMAPIYTQVNETAIQ 127

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P +  +IT+  A+   A+P   FM + TREKDL+LF+++++     T     D +   +L
Sbjct: 128 PYLEEEITQEEALAIGAQPLREFMFHQTREKDLALFVNISNGERPET----RDDVPMHVL 183

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+F+ISEL+ +F++GF++ +PF+IIDM+VA+ +M+MGM MLPP  +SLPFK++ FV++D
Sbjct: 184 VPAFVISELKTAFQMGFMLFIPFVIIDMVVASTLMSMGMFMLPPVMVSLPFKLLLFVMVD 243

Query: 233 GWSLLVENLVKSF 245
           GW L+V++LV+SF
Sbjct: 244 GWHLVVKSLVESF 256


>gi|242281272|ref|YP_002993401.1| flagellar biosynthesis protein FliP [Desulfovibrio salexigens DSM
           2638]
 gi|242124166|gb|ACS81862.1| flagellar biosynthetic protein FliP [Desulfovibrio salexigens DSM
           2638]
          Length = 252

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 146/239 (61%), Gaps = 8/239 (3%)

Query: 11  LVTPELVFAKSSLHDV-MNIPADLSISTWIVRTFGIF---TILSIAPILLIMVTCFPRFI 66
           L+ P   FA+ ++  + +N+ A       + +   I    TIL +AP +L+ +T F R I
Sbjct: 17  LLIPAAAFAQETVPTLTLNLAAGQEEPEQVAKLLEILFLLTILGMAPSILLTMTSFTRII 76

Query: 67  IVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQ 126
           IVF  LR  MG   +PPN ++ SLA+FMT  +M PT     +  +QP +N +I  + AI 
Sbjct: 77  IVFHFLRQAMGTQQMPPNQILASLAIFMTVVIMMPTGKAINDSALQPYLNEEIGFSEAID 136

Query: 127 RVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFE 186
           R   P   F+  +TREKDLS+F  +       T     + +   +L+ ++ ISEL+  F 
Sbjct: 137 RAQVPIRTFLFKHTREKDLSIFYSITGEKRPET----KEDVNTMLLVAAYTISELKTGFT 192

Query: 187 IGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IGFLI +PFLI+DM++A+I++AMGMMMLPP  +SLPFK++ F+++DGWSLL  ++V +F
Sbjct: 193 IGFLIYVPFLILDMVIASILLAMGMMMLPPAMVSLPFKILLFIMVDGWSLLTGSIVNTF 251


>gi|59712449|ref|YP_205225.1| flagellar biosynthesis protein FliP [Vibrio fischeri ES114]
 gi|197336177|ref|YP_002156668.1| flagellar biosynthesis protein [Vibrio fischeri MJ11]
 gi|59480550|gb|AAW86337.1| flagellar biosynthesis protein FliP [Vibrio fischeri ES114]
 gi|197317667|gb|ACH67114.1| flagellar biosynthesis protein [Vibrio fischeri MJ11]
          Length = 289

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 139/218 (63%), Gaps = 8/218 (3%)

Query: 28  NIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVI 87
           N   D S++  I+   G+ T+L   P ++I++T F R ++V SILR  MG+   P N VI
Sbjct: 78  NGGEDYSVNLQIL---GLMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVI 134

Query: 88  ISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSL 147
           I +A+F+TF++M+P  D+     IQP +N +IT   A      P   FM   TR KDL  
Sbjct: 135 IGIAMFLTFFIMAPVFDKVNNTAIQPYINEEITAREAFDVAQVPMKEFMLAQTRVKDLET 194

Query: 148 FMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVM 207
           F++M+     N +      +   ++IP+F+ SEL+ +F+IGF++ LPFLIID++VA+++M
Sbjct: 195 FVNMSGVEAENPE-----DVPITVVIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLM 249

Query: 208 AMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           AMGMMML P  +SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 250 AMGMMMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSF 287


>gi|315636956|ref|ZP_07892180.1| flagellar biosynthetic protein FliP [Arcobacter butzleri JV22]
 gi|315478786|gb|EFU69495.1| flagellar biosynthetic protein FliP [Arcobacter butzleri JV22]
          Length = 241

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 128/188 (68%), Gaps = 4/188 (2%)

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           MVT F R IIVFS+LR  MG+   PP+ +IISL+L +T ++M P   ++ +  I P M+ 
Sbjct: 57  MVTSFTRLIIVFSLLRQAMGLQQTPPSQIIISLSLILTIFIMEPYAKKAWDDAIVPYMDE 116

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           +I    A  +   PF  FM  NTRE DL+LF    +   +  +    + +   +L+P+F+
Sbjct: 117 KIGYEVAFDKGVAPFKEFMIKNTREADLALF----YRIKKEPNPKNIEAVPLTLLMPAFI 172

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
           +SELR +FEIGFLI LPFL+ID+IVA+I+M++GMMMLPP  ISLP K+IFF+++DGW L+
Sbjct: 173 VSELRTAFEIGFLIFLPFLVIDIIVASILMSLGMMMLPPVMISLPIKIIFFIVVDGWQLI 232

Query: 238 VENLVKSF 245
           + NL +SF
Sbjct: 233 IGNLAQSF 240


>gi|309779459|ref|ZP_07674220.1| flagellar biosynthetic protein FliP [Ralstonia sp. 5_7_47FAA]
 gi|308921700|gb|EFP67336.1| flagellar biosynthetic protein FliP [Ralstonia sp. 5_7_47FAA]
          Length = 249

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 93/207 (44%), Positives = 135/207 (65%), Gaps = 4/207 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L   P +++M++ F R IIV S+LR  +G  + PPN V+I LALF+TF+VM
Sbjct: 46  VQTLVFLTSLGFLPAIILMMSSFTRIIIVLSLLRHALGTQTSPPNQVLIGLALFLTFFVM 105

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD+       PL +++IT   A+   A P   FM   TRE DL+LF+ M +      
Sbjct: 106 SPVLDKVYTDAYVPLRDSKITVEQAMDTAATPLRQFMLKQTREPDLALFVKMGNMPA--- 162

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            I   +    R LIP+F+ SEL+ +F+IGF I +PFL+ID++VA ++M+MGMMM+ P+  
Sbjct: 163 -IASPEQTPMRALIPAFVTSELKSAFQIGFAIFIPFLVIDIVVAAVLMSMGMMMVTPSIF 221

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSFI 246
           SLPFK++ FVL+DGW LL+ +L +SF+
Sbjct: 222 SLPFKIMLFVLVDGWHLLLGSLAQSFV 248


>gi|229918642|ref|YP_002887288.1| flagellar biosynthetic protein FliP [Exiguobacterium sp. AT1b]
 gi|229470071|gb|ACQ71843.1| flagellar biosynthetic protein FliP [Exiguobacterium sp. AT1b]
          Length = 221

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 93/224 (41%), Positives = 147/224 (65%), Gaps = 5/224 (2%)

Query: 21  SSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGS 80
           ++   ++N+    S ST I +   + T+L++AP  LI++TCF R ++V S +R  +G   
Sbjct: 2   TTFEQLINLETPDSTSTSI-KLLILLTLLTLAPSFLILMTCFTRVVVVLSFIRPALGTQQ 60

Query: 81  VPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNT 140
            PPN +I+ LALF+T +VMSP L    E  ++P ++++I++  A    +     FM   T
Sbjct: 61  TPPNQLIVGLALFITLFVMSPVLSDLNENALKPYLDDKISQDEAFDEASGTMKEFMSKYT 120

Query: 141 REKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDM 200
           R++DL LF+   +     T     D +    L+P++ ISEL+ +F+IGF+I LPFLIIDM
Sbjct: 121 RQEDLQLFLKYGNYEQPET----LDDVPLLALVPAYAISELKTAFQIGFMIFLPFLIIDM 176

Query: 201 IVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKS 244
           +VA+++M+MGMMMLPP  I+LPFK++ FVL+DGW L+VE+L++S
Sbjct: 177 VVASVLMSMGMMMLPPVMIALPFKLLLFVLVDGWHLIVESLLRS 220


>gi|268316332|ref|YP_003290051.1| flagellar biosynthetic protein FliP [Rhodothermus marinus DSM 4252]
 gi|262333866|gb|ACY47663.1| flagellar biosynthetic protein FliP [Rhodothermus marinus DSM 4252]
          Length = 269

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 141/195 (72%), Gaps = 4/195 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP ++I+ T F R +++FSILRT +G+   PP  V+I LALF+T ++M P  D+  +  +
Sbjct: 77  APAIIILTTSFTRLVVIFSILRTALGLQQSPPTQVLIGLALFLTLFIMYPVFDQIHDEAL 136

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           +P ++ +IT+  A++R A P   FM   TREKDL LFMD+A+    +    + + + + I
Sbjct: 137 RPYLDGEITQQVALERAAAPLRAFMLRQTREKDLMLFMDLANVEAFD----RPEDVPFYI 192

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P+F+ISELR +F+IGF+I LPFL++D+IVA+++M+MGMMMLPP  ISLP K++ FVL 
Sbjct: 193 LVPAFVISELRIAFQIGFMIFLPFLLVDLIVASVLMSMGMMMLPPVMISLPLKLLLFVLA 252

Query: 232 DGWSLLVENLVKSFI 246
           DGW L+VE++V+ ++
Sbjct: 253 DGWYLVVESVVRGYL 267


>gi|253688962|ref|YP_003018152.1| flagellar biosynthetic protein FliP [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251755540|gb|ACT13616.1| flagellar biosynthetic protein FliP [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 258

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 108/247 (43%), Positives = 158/247 (63%), Gaps = 10/247 (4%)

Query: 2   IRYCF-FALFLVTPELVFAKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIM 58
           +RY    +L L+ P  V+A+  L  ++  P      +W   V+T    T L+  P  L+M
Sbjct: 17  LRYGLAISLLLLAPS-VWAQ--LPGIVTQPLPNGGQSWTLSVQTLVFLTSLTFIPAALLM 73

Query: 59  VTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQ 118
           +T F R IIV S+LR  +G  + PPN V++ L LF+TF+VMSP L+R  E    P   +Q
Sbjct: 74  MTSFTRIIIVLSLLRNALGTPTAPPNQVLLGLTLFLTFFVMSPVLNRVYEEAYLPFSQDQ 133

Query: 119 ITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMI 178
           I+   AI+R AEP   FM   TRE DL+LF  +A       +I   + +  R+L+P+F+ 
Sbjct: 134 ISMEVAIERGAEPVREFMLRQTRETDLALFTRLAEIP----EIQGPEAVPMRVLLPAFVT 189

Query: 179 SELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLV 238
           SEL+ +F+IGF I +PFLIID++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+
Sbjct: 190 SELKTAFQIGFTIFIPFLIIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLL 249

Query: 239 ENLVKSF 245
            +L +SF
Sbjct: 250 GSLAQSF 256


>gi|304409949|ref|ZP_07391568.1| flagellar biosynthetic protein FliP [Shewanella baltica OS183]
 gi|307302338|ref|ZP_07582096.1| flagellar biosynthetic protein FliP [Shewanella baltica BA175]
 gi|304351358|gb|EFM15757.1| flagellar biosynthetic protein FliP [Shewanella baltica OS183]
 gi|306914376|gb|EFN44797.1| flagellar biosynthetic protein FliP [Shewanella baltica BA175]
          Length = 248

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 135/201 (67%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T LS  P +LIM+T F R IIV SILR  +G+   P N V+I ++LFMTF++M+P  +
Sbjct: 51  LMTSLSFLPAMLIMLTSFTRIIIVLSILRQAIGLQQTPSNQVLIGMSLFMTFFIMAPVFE 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           R  + G++P +  Q+T   A ++  EP   FM    R  DL  F+++  S ++N  I   
Sbjct: 111 RIYDEGVKPYIEEQLTLQQAFEKGKEPLKGFMLGQVRTTDLKTFIEI--SGYKN--IKSP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           +     +LIP+F+ SEL+ +F+IGF++ +PFL++D++VA+I+MAMGMMML P  +SLPFK
Sbjct: 167 EEAPMSVLIPAFITSELKTAFQIGFMLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGWSL++  L  SF
Sbjct: 227 IMLFVLVDGWSLVLGTLANSF 247


>gi|149908447|ref|ZP_01897110.1| flagellar biosynthesis protein [Moritella sp. PE36]
 gi|149808610|gb|EDM68545.1| flagellar biosynthesis protein [Moritella sp. PE36]
          Length = 248

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 134/206 (65%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T LS  P  LIM+T F R IIV SILR  +G+   P N V++ + LF++F++M
Sbjct: 46  LQILAMMTALSFLPAALIMMTSFTRIIIVLSILRQALGLQQSPSNQVLVGITLFLSFFIM 105

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP  DR  +  +QP ++ ++T   A ++   P   FM   TR  DL  FM +A       
Sbjct: 106 SPVFDRINDNALQPYLSEELTSMQAFEQAKLPMQQFMLAQTRVTDLDTFMRIAK-----V 160

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           +    + + +R+LIP+F+ SEL+ +F+IGF++ +PFLIID++VA+I+MAMGMMML P  +
Sbjct: 161 EADSPEEVPFRVLIPAFVTSELKTAFQIGFMVFIPFLIIDLVVASILMAMGMMMLSPMIV 220

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGWSL++  L  SF
Sbjct: 221 SLPFKLMLFVLVDGWSLILGTLANSF 246


>gi|307721191|ref|YP_003892331.1| flagellar biosynthetic protein FliP [Sulfurimonas autotrophica DSM
           16294]
 gi|306979284|gb|ADN09319.1| flagellar biosynthetic protein FliP [Sulfurimonas autotrophica DSM
           16294]
          Length = 245

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 132/193 (68%), Gaps = 4/193 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +++++T F RF+IVF  LR  +G   VPP  +++ LA+ +TF+VM P   ++   GI
Sbjct: 55  APAMVLVMTTFTRFVIVFGFLRQALGTQQVPPTQLLVMLAMILTFFVMEPIGTKAYNQGI 114

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           +P +  +I    A  +   PF  FM  NTREKDL+LF+ +    +  +       +   I
Sbjct: 115 KPYVAKEIGYEEAFTKTTLPFKNFMIRNTREKDLALFLRIRKMQNPKSV----ADVPLSI 170

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           +IP+F+ISE++ +FEIGFL+ LPFL+IDM+VA+I+M+MGMMMLPP  ISLPFK++ FVLI
Sbjct: 171 VIPAFIISEMKTAFEIGFLLFLPFLVIDMVVASILMSMGMMMLPPVMISLPFKILVFVLI 230

Query: 232 DGWSLLVENLVKS 244
           DGW+LL+ NL+ S
Sbjct: 231 DGWNLLIGNLIFS 243


>gi|269792928|ref|YP_003317832.1| flagellar biosynthetic protein FliP [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100563|gb|ACZ19550.1| flagellar biosynthetic protein FliP [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 247

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 92/215 (42%), Positives = 142/215 (66%), Gaps = 9/215 (4%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D++++  IV    + T+LS+AP +++M+T F R ++V   +R  MG+  +PPN VI SLA
Sbjct: 40  DVALTLQIV---ALMTVLSMAPAIILMLTSFTRILVVLGFVRNAMGLQQMPPNQVIASLA 96

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF+TF+ MSP  D+  +  + P M  +I+   A   V  P   FM   TRE +LSL + +
Sbjct: 97  LFLTFFTMSPVWDQVYKGALVPYMRGEISAQRAFDGVEGPVRAFMLRQTREPELSLMVRL 156

Query: 152 AHSSHRNTDITKN-DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMG 210
           A          KN   +  R+LIP+F+ISEL+ +F++G +I +PF+++DMIV++++M+MG
Sbjct: 157 AKMKQ-----PKNPSEVPTRVLIPAFVISELKTAFQMGVVIFIPFIVVDMIVSSVLMSMG 211

Query: 211 MMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           M+MLPP  ISLPFKV+ FV+ DGW L++ +LV SF
Sbjct: 212 MIMLPPMMISLPFKVLLFVMADGWDLVIASLVSSF 246


>gi|239909255|ref|YP_002955997.1| flagellar biosynthetic protein FliP [Desulfovibrio magneticus RS-1]
 gi|239799122|dbj|BAH78111.1| flagellar biosynthetic protein FliP [Desulfovibrio magneticus RS-1]
          Length = 253

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 133/199 (66%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+LS+AP  ++ VT F R I+VFS LR  MG+  VPP  ++ SLA+F+T  +M PT    
Sbjct: 56  TVLSLAPSFVLTVTSFTRIIVVFSFLRQAMGVQQVPPTQILASLAIFLTAVIMYPTGKAI 115

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            +  +QP MN +I  T A+++   P   F+  +TREKDLS+F  +     R  D      
Sbjct: 116 NDNALQPYMNEEIGFTEALKKAEAPLREFLFKHTREKDLSVFYTITKM-ERPKD---KGE 171

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           +   +L   FMISEL+ +F IGFLI +PFLI+DM++++I++AMGMMMLPP +I++PFK++
Sbjct: 172 VPTIMLAAGFMISELKTAFTIGFLIYIPFLILDMVISSILLAMGMMMLPPATIAMPFKLL 231

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW L+V +LV SF
Sbjct: 232 LFVLVDGWGLIVASLVNSF 250


>gi|88813211|ref|ZP_01128451.1| flagellar biosynthesis protein [Nitrococcus mobilis Nb-231]
 gi|88789533|gb|EAR20660.1| flagellar biosynthesis protein [Nitrococcus mobilis Nb-231]
          Length = 245

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 150/246 (60%), Gaps = 6/246 (2%)

Query: 2   IRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIV--RTFGIFTILSIAPILLIMV 59
           +R     + L  P +  A+ +  + + + +     TW V  +   + T L++ P  L+M+
Sbjct: 1   MRALLMVVLLWVPGVALAQGTGIEAVTVQSAGDGETWSVSLQILAVMTALTLLPAALLMM 60

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R IIV +ILR  +G  S P N V+I LALF+T +VMSP L +  E+ +QP +N  +
Sbjct: 61  TAFTRIIIVLAILRQAIGTTSTPSNQVLIGLALFLTVFVMSPVLTQINEVALQPYLNEGM 120

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
               A++  A P   FM   TREKD+ LF+++A +      +     + +  L+P+FM S
Sbjct: 121 DAEQAVRAAAGPLRAFMLAQTREKDIGLFLNIADAGP----VASPQEVPFSTLVPAFMTS 176

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL  +F+IGF++ LPFL+ID++VA+ +M+MGM+ML P  ISLPFK++ FVLIDGWSL++ 
Sbjct: 177 ELETAFQIGFIVFLPFLVIDLVVASTLMSMGMLMLSPMLISLPFKIMLFVLIDGWSLIMG 236

Query: 240 NLVKSF 245
            L  SF
Sbjct: 237 TLAGSF 242


>gi|254438171|ref|ZP_05051665.1| flagellar biosynthetic protein FliP [Octadecabacter antarcticus
           307]
 gi|198253617|gb|EDY77931.1| flagellar biosynthetic protein FliP [Octadecabacter antarcticus
           307]
          Length = 258

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/251 (37%), Positives = 151/251 (60%), Gaps = 17/251 (6%)

Query: 5   CFFALFLVTPELVFAKSSLHDVMNIPADLSISTWI---------VRTFGIFTILSIAPIL 55
           C    F + P   F      D   +PA L+IST           ++   + T+L+I P  
Sbjct: 15  CVILAFCIVP---FGSVYAQDGGGLPA-LNISTGADGETTYSLSLQILALMTVLTILPSF 70

Query: 56  LIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLM 115
           L+ VT F R IIV SILR  +G    PPN V++S+ALF+TFYVM+PT +      I P +
Sbjct: 71  LLGVTAFTRIIIVLSILRQALGTQQTPPNQVLLSIALFLTFYVMAPTFEDIYNNAISPYL 130

Query: 116 NNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPS 175
              +    AI+  A     F+  NTRE +L++F +MA     +     N+ + Y +L+P+
Sbjct: 131 AGDLPPVAAIEGAAGILSEFLVVNTREAELAMFAEMAG----DEPYASNEDVPYTVLLPA 186

Query: 176 FMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWS 235
           F+ SEL+ +F+IGFL+ LPFL+ID+++A+I+M++GMMML P  ++LPFK++ FVL+DGW+
Sbjct: 187 FITSELKTAFQIGFLLFLPFLVIDLVIASILMSLGMMMLSPMLVALPFKLLLFVLVDGWA 246

Query: 236 LLVENLVKSFI 246
           + + ++  +++
Sbjct: 247 MTIGSIASTYV 257


>gi|126730033|ref|ZP_01745845.1| flagellar biosynthetic protein FliP [Sagittula stellata E-37]
 gi|126709413|gb|EBA08467.1| flagellar biosynthetic protein FliP [Sagittula stellata E-37]
          Length = 245

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 126/194 (64%), Gaps = 3/194 (1%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP + IMVTCFP  + V +ILR  +G+   PPN++I+SLALF+T++VM P    + + G+
Sbjct: 54  APGIAIMVTCFPFMVTVLAILRQAVGLQQSPPNMLIVSLALFLTYFVMEPVFTEAWDTGV 113

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QPL+  QI    A  R   PF  FM   T         D+     R T +     +   +
Sbjct: 114 QPLIEEQIEVEEAAIRTLAPFRDFMAGRTDPDTYRAMADL-RPDARETVLAPEAPLS--V 170

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+PSFM+SE+ R+F++GFLI LPFLIID++VA ++M+MGMMM+PP  +SLPFK+ FFV+ 
Sbjct: 171 LVPSFMLSEVARAFQVGFLIFLPFLIIDLVVAAVLMSMGMMMVPPAIVSLPFKLAFFVVA 230

Query: 232 DGWSLLVENLVKSF 245
           DGWSLL  +LV+ +
Sbjct: 231 DGWSLLAGSLVRGY 244


>gi|51246523|ref|YP_066407.1| flagellar biosynthesis protein FliP [Desulfotalea psychrophila
           LSv54]
 gi|50877560|emb|CAG37400.1| probable flagellar biosynthetic protein (FliP) [Desulfotalea
           psychrophila LSv54]
          Length = 260

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 139/201 (69%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + TI+S+AP +++M+TCF R +IV   +R  MG  ++PPN ++I  ALF+TF++MSPT++
Sbjct: 63  VLTIISVAPAIVLMMTCFTRIVIVLGFVRQAMGTQNMPPNQIVIGFALFLTFFIMSPTIN 122

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  +  +QP +  +I++  A+         FM +  +E +LS    MA  +       K 
Sbjct: 123 KINDTALQPYLAKEISQGKALDLTVFSMREFMFSQVQESELSF---MAELTIEKEPKDKA 179

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D I    LIP++M+SEL+ +F +GF++ +PFL+IDMIVA+++M+MGMMMLPP  IS+PFK
Sbjct: 180 D-IPTTTLIPAYMLSELKTAFSMGFMVYIPFLVIDMIVASVLMSMGMMMLPPVIISMPFK 238

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ F+L+DGW+L+V +LVKSF
Sbjct: 239 LLLFILVDGWTLIVGSLVKSF 259


>gi|221069288|ref|ZP_03545393.1| flagellar biosynthetic protein FliP [Comamonas testosteroni KF-1]
 gi|220714311|gb|EED69679.1| flagellar biosynthetic protein FliP [Comamonas testosteroni KF-1]
          Length = 249

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 137/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+++T F R +IV S+LR  +G  S PPN V+I L+LF+T +VM
Sbjct: 46  IQTLLFFTALSFLPAILLLMTGFTRIVIVLSLLRQALGTQSAPPNQVVIGLSLFLTMFVM 105

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PTLD+  +    P   N I+   AI++   P   FM   TR+ D +LF  +A     + 
Sbjct: 106 GPTLDKVYQDAYLPYTQNSISFEQAIEKAEAPMRGFMLKQTRQSDFALFKRLAK---LDA 162

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           ++T  +    R+L+P+F+ SEL+ +F+IGF+I +PFLIIDM+V++I+M++GMMML P  +
Sbjct: 163 NVTA-ETAPLRVLVPAFVTSELKTAFQIGFMIFIPFLIIDMVVSSILMSLGMMMLSPVLV 221

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL DGW+L++ +L  SF
Sbjct: 222 ALPFKLMLFVLADGWNLIIGSLAASF 247


>gi|261252332|ref|ZP_05944905.1| flagellar biosynthesis protein FliP [Vibrio orientalis CIP 102891]
 gi|260935723|gb|EEX91712.1| flagellar biosynthesis protein FliP [Vibrio orientalis CIP 102891]
          Length = 275

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/206 (42%), Positives = 137/206 (66%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T+L   P ++I++T F R ++V SILR  MG+   P N VII +A+F+TF++M
Sbjct: 73  LQILALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIAIFLTFFIM 132

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP L++  +  IQP +N QI+   A      P   FM   TR KDL  F++++ S+    
Sbjct: 133 SPVLNKINDDAIQPYINEQISARQAFDLAQIPMKDFMLKQTRVKDLETFVNISGSTA--- 189

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
             T  + +   +LIP+F+ SEL+ +F+IGF++ LPFL+ID++VA+++MAMGMMML P  +
Sbjct: 190 --TAPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLVIDLVVASVLMAMGMMMLSPMIV 247

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 248 SLPFKLMLFVLVDGWNLILSTLAGSF 273


>gi|310816848|ref|YP_003964812.1| flagellar biosynthesis protein FliP [Ketogulonicigenium vulgare
           Y25]
 gi|308755583|gb|ADO43512.1| flagellar biosynthesis protein FliP [Ketogulonicigenium vulgare
           Y25]
          Length = 244

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 148/243 (60%), Gaps = 9/243 (3%)

Query: 8   ALFLVTPELVFAKSSLH--DVMNIPADL---SISTWIVRTFGIFTILSIAPILLIMVTCF 62
           ALF V   L+   +     D+ ++  D    S++   V+   + T++S+ P L IM T F
Sbjct: 5   ALFSVALTLLAGAAGAQGVDIQSLGLDFGEGSVAGRSVQLLVMVTLISLVPALAIMFTSF 64

Query: 63  PRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITET 122
           P  + V SILR G+G    PPN++I++LALF+T+YVM+P  D +   GI PL+ +++   
Sbjct: 65  PFMVTVLSILRQGLGTQQSPPNMLIVTLALFLTWYVMAPVFDEAWANGIAPLLEDRLPVD 124

Query: 123 TAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELR 182
            A++    PF  FM       D + +  MA        +   D      L+PSF++SEL 
Sbjct: 125 AALRAAMAPFQTFMSGRV---DPTTYQTMASLRPDTVGVAVTDA-PLSTLVPSFLLSELS 180

Query: 183 RSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLV 242
           R+F+IGFLI LPFLIID++VA ++M+MGMMM+PP  ++LPFK+ FFV+ DGWSLL  +LV
Sbjct: 181 RAFQIGFLIFLPFLIIDLVVAAVLMSMGMMMVPPAVVALPFKLAFFVVADGWSLLASSLV 240

Query: 243 KSF 245
           +++
Sbjct: 241 RNY 243


>gi|239815267|ref|YP_002944177.1| flagellar biosynthetic protein FliP [Variovorax paradoxus S110]
 gi|239801844|gb|ACS18911.1| flagellar biosynthetic protein FliP [Variovorax paradoxus S110]
          Length = 326

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 135/200 (67%), Gaps = 4/200 (2%)

Query: 46  FTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDR 105
            T+L+I P LL+ +T F R I+V S+LR  +GM   PPN V+I LALF+T + MSP L +
Sbjct: 130 LTVLAILPALLVCLTSFLRIIVVLSMLRHAIGMNETPPNTVLIGLALFLTLFTMSPVLQK 189

Query: 106 SIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKND 165
             +   +P M  +++      +   P   FM   TRE DL+L ++++ +    +     +
Sbjct: 190 VNQDAFEPFMAGKLSMQDGYGKGIAPLREFMVRQTREADLALMVELSKAPTPKS----ME 245

Query: 166 HIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKV 225
            I    LIPSFM+SELR +F+IGF+I LPFL+ID+IV++I+MA+GMMM+PPT+I+LP K+
Sbjct: 246 DISNVQLIPSFMLSELRAAFQIGFVIFLPFLLIDLIVSSILMALGMMMMPPTTIALPLKI 305

Query: 226 IFFVLIDGWSLLVENLVKSF 245
           + F+L+DGWSL+++ LV SF
Sbjct: 306 LMFILVDGWSLVLKALVGSF 325


>gi|332140592|ref|YP_004426330.1| flagellar biosynthesis protein FliP [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327550614|gb|AEA97332.1| flagellar biosynthesis protein FliP [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 251

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 136/209 (65%), Gaps = 3/209 (1%)

Query: 37  TWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTF 96
           T  ++   I T LS+ P  ++M+T F R I+V SILR  +G+   P N ++I ++LF++ 
Sbjct: 42  TMTLQALFIMTALSLIPAFIMMMTSFTRIIVVLSILRQAIGLQQSPSNQILIGVSLFLSM 101

Query: 97  YVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSH 156
           ++M+P  +   E  +QP +N Q+T   A+++   P   FM + TR KDL  F+ +A    
Sbjct: 102 FIMAPVFEEVNERALQPYLNEQLTSLDALEQAKGPMRAFMLSQTRVKDLETFVRIAGDEG 161

Query: 157 RNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPP 216
           +  D    D +   ILIP+F+ SEL+ +F+IGF++ +PFLIID++VA+I+MAMGMMML P
Sbjct: 162 KYAD---TDEVPLTILIPAFVTSELKTAFQIGFMLFIPFLIIDLVVASILMAMGMMMLSP 218

Query: 217 TSISLPFKVIFFVLIDGWSLLVENLVKSF 245
             +SLPFK++ FVL+DGW+L+   L  SF
Sbjct: 219 MIVSLPFKLMLFVLVDGWNLIFGTLATSF 247


>gi|308048762|ref|YP_003912328.1| flagellar biosynthetic protein FliP [Ferrimonas balearica DSM 9799]
 gi|307630952|gb|ADN75254.1| flagellar biosynthetic protein FliP [Ferrimonas balearica DSM 9799]
          Length = 251

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 139/206 (67%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++  G+ T+L+  P ++I++T F R I+V +ILR  +G+   P N V++ +ALF++ ++M
Sbjct: 45  LQILGLMTLLTFLPAMVILMTSFTRIIVVLAILRQALGLQQTPSNQVLLGMALFLSLFIM 104

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +P LDR  E  + P M  QI    A++R   P   FM + TR  D++ F++++      T
Sbjct: 105 TPVLDRVYEDALVPYMGEQIGALEAMERAKAPVKDFMLSQTRITDINTFVEISG----RT 160

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           DI   D +   +LIP+F+ SEL+ +F+IGF++ +PFL+ID++VA+++MAMGMMML P  +
Sbjct: 161 DIASVDEVPMTVLIPAFVTSELKTAFQIGFMLFVPFLVIDLVVASVLMAMGMMMLSPMIV 220

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 221 SLPFKIMLFVLVDGWNLVMGTLATSF 246


>gi|284041537|ref|YP_003391877.1| flagellar biosynthetic protein FliP [Conexibacter woesei DSM 14684]
 gi|283945758|gb|ADB48502.1| flagellar biosynthetic protein FliP [Conexibacter woesei DSM 14684]
          Length = 213

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/202 (45%), Positives = 137/202 (67%), Gaps = 6/202 (2%)

Query: 44  GIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTL 103
           G FT++   P  L  +T F R +IV   +RT +G  + PPN V++ +ALF+T +VM+PT 
Sbjct: 17  GAFTLI---PAGLFCLTGFTRILIVLGFIRTAIGTPTAPPNQVLVGIALFLTLFVMAPTF 73

Query: 104 DRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITK 163
            +  E    PL   +I    A++R  EP   FM   TR KDL+LF+ ++ +  R    T+
Sbjct: 74  TQIKETAWDPLEAGRINTAQAVRRAEEPLRQFMFEQTRTKDLALFVRLSRT--REQPRTR 131

Query: 164 NDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPF 223
            D I   +LIP+F++SEL+ +F+IGF+I LPFL+ID+IVA+ +M+MGM+MLPP  ISLPF
Sbjct: 132 AD-IPTTVLIPAFIVSELKTAFQIGFMIFLPFLVIDLIVASTLMSMGMIMLPPVFISLPF 190

Query: 224 KVIFFVLIDGWSLLVENLVKSF 245
           K++ FVL+DGW+L+ ++LV+SF
Sbjct: 191 KILLFVLVDGWALITDSLVRSF 212


>gi|167040314|ref|YP_001663299.1| flagellar biosynthesis protein FliP [Thermoanaerobacter sp. X514]
 gi|256750756|ref|ZP_05491641.1| flagellar biosynthetic protein FliP [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300914398|ref|ZP_07131714.1| flagellar biosynthetic protein FliP [Thermoanaerobacter sp. X561]
 gi|307724366|ref|YP_003904117.1| flagellar biosynthetic protein FliP [Thermoanaerobacter sp. X513]
 gi|166854554|gb|ABY92963.1| flagellar biosynthetic protein FliP [Thermoanaerobacter sp. X514]
 gi|256750339|gb|EEU63358.1| flagellar biosynthetic protein FliP [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300889333|gb|EFK84479.1| flagellar biosynthetic protein FliP [Thermoanaerobacter sp. X561]
 gi|307581427|gb|ADN54826.1| flagellar biosynthetic protein FliP [Thermoanaerobacter sp. X513]
          Length = 221

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/194 (44%), Positives = 133/194 (68%), Gaps = 5/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIM+T F R +IV S LR  +G+  +PPN V+I LALF+T ++M+P         I
Sbjct: 32  APSILIMMTSFTRIVIVLSFLRNALGLQQMPPNQVLIGLALFLTLFIMAPIGQDINNNAI 91

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           +P    +IT+  A Q   +P   FM   TR+ DL+LF+ +A  +  N +      +  R+
Sbjct: 92  KPYTEGKITQEEAYQNTIKPLKNFMLKQTRQNDLNLFVSLAKININNVE-----ELPMRV 146

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           +IP+F+ISEL+ +F+IGF++ +PFLIID++VA+++M+MGM MLPP  ISLPFKV+ F+L+
Sbjct: 147 VIPAFIISELKTAFQIGFILYIPFLIIDIVVASVLMSMGMFMLPPVLISLPFKVLLFILV 206

Query: 232 DGWSLLVENLVKSF 245
           DGW+L+V++L+  F
Sbjct: 207 DGWNLVVKSLILGF 220


>gi|7387672|sp|O85133|FLIP_RHOSH RecName: Full=Flagellar biosynthetic protein fliP
 gi|3435109|gb|AAC32322.1| flagellar protein FliP [Rhodobacter sphaeroides]
          Length = 301

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 135/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T L++ P L++ ++ F R IIV SILR  +G    PPN V+I+LALF+TF+VM
Sbjct: 97  LQILALMTALTVLPSLVLGMSAFTRIIIVLSILRQALGTQQTPPNQVLIALALFLTFFVM 156

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PTL    E  + P ++ QI    AI+R       F+  NTR+ DL +F D+A +     
Sbjct: 157 QPTLGALYEQSLSPFLDGQIEAQPAIERGGAIMKDFLIANTRQNDLLMFSDLAGAG---- 212

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
              +   + +  L+P+FM SEL+ +F+IGFL+ LPFL+IDM++A+I+MA+GMMML P  +
Sbjct: 213 PYAEPTEVPFSTLLPAFMTSELKTAFQIGFLLFLPFLVIDMVIASILMALGMMMLSPMLV 272

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L V +L  S+
Sbjct: 273 SLPFKLLLFVLVDGWALTVGSLAASY 298


>gi|302387779|ref|YP_003823601.1| flagellar biosynthetic protein FliP [Clostridium saccharolyticum
           WM1]
 gi|302198407|gb|ADL05978.1| flagellar biosynthetic protein FliP [Clostridium saccharolyticum
           WM1]
          Length = 220

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 93/223 (41%), Positives = 145/223 (65%), Gaps = 9/223 (4%)

Query: 27  MNIPADLSISTWIVRTFGIF---TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPP 83
           MN  A ++I+   V T  +F   TI+S+ P +L+M+T F R +I+ S  R  MG+   PP
Sbjct: 1   MNTDALVNINGGRVPTLELFLILTIISLLPSILVMMTSFTRIVIILSFTRNAMGIQQTPP 60

Query: 84  NLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREK 143
           N+V++ +ALF+T ++M P +        QP +  +I++  A++R   P   FM   T + 
Sbjct: 61  NMVLVGIALFLTLFIMDPVIKDVNTNAYQPYIKEEISQGEALKRAQVPMKRFMLKQTEKT 120

Query: 144 DLSLFMDMAHSSHRNTDITKN-DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIV 202
            L+LF DM+     NTD+ +N + +   ++IPSFM SEL+R+F  GF+I LPF+++D++V
Sbjct: 121 TLTLFTDMS-----NTDMPENIEDLPMTVVIPSFMTSELKRAFTAGFMIFLPFMLVDIVV 175

Query: 203 ATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           ++ +M+MGM+MLPP  ISLPFK++ FV ++GW LL  NLVKSF
Sbjct: 176 SSTLMSMGMVMLPPAMISLPFKLLLFVTVNGWELLFTNLVKSF 218


>gi|313901464|ref|ZP_07834920.1| flagellar biosynthetic protein FliP [Thermaerobacter subterraneus
           DSM 13965]
 gi|313468270|gb|EFR63728.1| flagellar biosynthetic protein FliP [Thermaerobacter subterraneus
           DSM 13965]
          Length = 227

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 131/194 (67%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP LL+M+T F R ++  S LR  +G    PPN V++ LALF+T +VM+P   +  +   
Sbjct: 34  APALLVMMTGFTRIVVALSFLRGALGTQQAPPNQVLVGLALFLTVFVMAPVWQQVYQDAW 93

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
            P  + +I +  A+QR  EP   FM   TRE+DL+LF++++        +   D +   +
Sbjct: 94  IPYRDGRIGQVEALQRAQEPVREFMFRYTRERDLALFLELSGRG----PVASPDQVPTYV 149

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           LIP+F ISEL+ +F+IGF++ +PFL+IDM+VA+ +M+MGM+M+PP  +SLPFK++ FVL+
Sbjct: 150 LIPAFAISELKTAFQIGFILYVPFLVIDMVVASTLMSMGMLMVPPMLVSLPFKILLFVLV 209

Query: 232 DGWSLLVENLVKSF 245
           DGW+L+V +L+ SF
Sbjct: 210 DGWNLVVRSLLASF 223


>gi|264676604|ref|YP_003276510.1| flagellar biosynthetic protein FliP [Comamonas testosteroni CNB-2]
 gi|262207116|gb|ACY31214.1| flagellar biosynthetic protein FliP [Comamonas testosteroni CNB-2]
          Length = 249

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 137/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+++T F R +IV S+LR  +G  S PPN V+I L+LF+T +VM
Sbjct: 46  IQTLLFFTALSFLPAILLLMTGFTRIVIVLSLLRQALGTQSAPPNQVVIGLSLFLTMFVM 105

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PTLD+  +    P   N I+   A+++   P   FM   TR+ D +LF  +A     + 
Sbjct: 106 GPTLDKVYQDAYLPYTQNSISFEQAMEKAEAPMRGFMLKQTRQSDFALFKRLAK---LDA 162

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           ++T  +    R+L+P+F+ SEL+ +F+IGF+I +PFL+IDM+V++I+M++GMMML P  +
Sbjct: 163 NVTA-ETAPLRVLVPAFVTSELKTAFQIGFMIFIPFLVIDMVVSSILMSLGMMMLSPVLV 221

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL DGW+L++ +L  SF
Sbjct: 222 ALPFKLMLFVLADGWNLIIGSLAASF 247


>gi|261821163|ref|YP_003259269.1| flagellar biosynthesis protein FliP [Pectobacterium wasabiae
           WPP163]
 gi|261605176|gb|ACX87662.1| flagellar biosynthetic protein FliP [Pectobacterium wasabiae
           WPP163]
          Length = 258

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 147/227 (64%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  ++  P      +W   V+T    T L+  P  L+M+T F R IIV S+LR  +G 
Sbjct: 34  AQLPGIVTQPLPNGGQSWTLPVQTLVFLTSLTFIPAALLMMTSFTRIIIVLSLLRNALGT 93

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            + PPN V++ L LF+TF+VMSP L+R  E    P   +QI+   AI+R AEP   FM  
Sbjct: 94  PTAPPNQVLLGLTLFLTFFVMSPVLNRVYEEAYLPFSQDQISMEVAIERGAEPVREFMLR 153

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+LF  +A       +I   + +  R+L+P+F+ SEL+ +F+IGF + +PFLII
Sbjct: 154 QTRETDLALFTRLAEIP----EIQGPEAVPMRVLLPAFVTSELKTAFQIGFTVFIPFLII 209

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 210 DLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSF 256


>gi|299531251|ref|ZP_07044661.1| flagellar biosynthesis protein FliP [Comamonas testosteroni S44]
 gi|298720658|gb|EFI61605.1| flagellar biosynthesis protein FliP [Comamonas testosteroni S44]
          Length = 249

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 137/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+++T F R +IV S+LR  +G  S PPN V+I L+LF+T +VM
Sbjct: 46  IQTLLFFTALSFLPAILLLMTGFTRIVIVLSLLRQALGTQSAPPNQVVIGLSLFLTMFVM 105

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PTLD+  +    P   N I+   A+++   P   FM   TR+ D +LF  +A     + 
Sbjct: 106 GPTLDKVYQDAYLPYTQNSISFEQAMEKAEAPMRGFMLKQTRQSDFALFKRLAK---LDA 162

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           ++T  +    R+L+P+F+ SEL+ +F+IGF+I +PFL+IDM+V++I+M++GMMML P  +
Sbjct: 163 NVTA-ETAPLRVLVPAFVTSELKTAFQIGFMIFIPFLVIDMVVSSILMSLGMMMLSPVLV 221

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL DGW+L++ +L  SF
Sbjct: 222 ALPFKLMLFVLADGWNLIIGSLAASF 247


>gi|126462466|ref|YP_001043580.1| flagellar biosynthesis protein FliP [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104130|gb|ABN76808.1| flagellar biosynthetic protein FliP [Rhodobacter sphaeroides ATCC
           17029]
          Length = 301

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 133/203 (65%), Gaps = 4/203 (1%)

Query: 43  FGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPT 102
             + T L++ P L++ ++ F R IIV SILR  +G    PPN V+I+LALF+TF+VM PT
Sbjct: 100 LALMTALTVLPSLVLGMSAFTRIIIVLSILRQALGTQQTPPNQVLIALALFLTFFVMQPT 159

Query: 103 LDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDIT 162
           L    E  + P ++ QI    AI+R       F+  NTR+ DL +F D+A +        
Sbjct: 160 LGALYEQSLSPFLDGQIEAQPAIERGGAIMKDFLIANTRQNDLLMFSDLAGAG----PYA 215

Query: 163 KNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLP 222
           +   + +  L+P+FM SEL+ +F+IGFL+ LPFL+IDM++A+I+MA+GMMML P  +SLP
Sbjct: 216 EPTEVPFSTLLPAFMTSELKTAFQIGFLLFLPFLVIDMVIASILMALGMMMLSPMLVSLP 275

Query: 223 FKVIFFVLIDGWSLLVENLVKSF 245
           FK++ FVL+DGW+L V +L  ++
Sbjct: 276 FKLLLFVLVDGWALTVGSLAATY 298


>gi|224370774|ref|YP_002604938.1| FliP [Desulfobacterium autotrophicum HRM2]
 gi|223693491|gb|ACN16774.1| FliP [Desulfobacterium autotrophicum HRM2]
          Length = 258

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/216 (42%), Positives = 141/216 (65%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D+++   ++    + TIL++AP +LI++T F R I+VF  LR  +G  S PPN V++ 
Sbjct: 48  PEDVAV---VLEIIALLTILALAPAILILMTPFTRIIVVFHFLRQAIGTQSSPPNQVVVG 104

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+TF+++ P      +  + P +  QI    A      P   F+  NTRE D++LF+
Sbjct: 105 LALFLTFFIIKPVALDVYQNALNPYLERQIDYNEAFTAAQVPIRNFLLVNTREADIALFV 164

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
             A  +  +T     + +   +LIP+++ISEL+ +F IGF+I +PFL+IDM+VA++++AM
Sbjct: 165 KGAGVAKPDT----REDVSLMLLIPAYVISELKTAFIIGFVIYVPFLVIDMVVASVLLAM 220

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  ISLPFK++ FVL+DGW LL  +L+KSF
Sbjct: 221 GMMMLPPVMISLPFKLMLFVLVDGWHLLTGSLLKSF 256


>gi|221635440|ref|YP_002523316.1| flagellar biosynthetic protein FliP [Thermomicrobium roseum DSM
           5159]
 gi|221158046|gb|ACM07164.1| flagellar biosynthetic protein FliP [Thermomicrobium roseum DSM
           5159]
          Length = 271

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 140/201 (69%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T++S+ P +LI++T F R +IV S +R+ +G+  +PPN V+I LALF+T +VM+PT  
Sbjct: 72  LLTLVSLLPTILIVMTSFTRIVIVLSFVRSAIGVPQLPPNQVLIGLALFLTVFVMAPTWQ 131

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
                 +QP +  +I + TA++R  +P   FM   TRE+D++LFM + +     T     
Sbjct: 132 AVNRDALQPYLRGEINQRTALERGLQPLRTFMFRQTRERDIALFMSLGNLPRPRTP---- 187

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           + +   +L+P+F++SEL+ +F +GF++ +PFL+ID+IV++ +MAMGM+M+PP  ISLPFK
Sbjct: 188 EDVPTWVLVPAFILSELKTAFTMGFVLFIPFLVIDLIVSSTLMAMGMIMVPPVVISLPFK 247

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FV++DGW LLV +LV SF
Sbjct: 248 LLLFVMVDGWDLLVRSLVVSF 268


>gi|117926839|ref|YP_867456.1| flagellar biosynthesis protein FliP [Magnetococcus sp. MC-1]
 gi|117610595|gb|ABK46050.1| flagellar biosynthetic protein FliP [Magnetococcus sp. MC-1]
          Length = 260

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 142/216 (65%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P  +SI+   ++     T+ S+AP +L+MVT F R I+V S +R  MG+   PPN V+I+
Sbjct: 51  PEQVSIA---LQILAFMTLFSLAPGILVMVTSFTRVIVVMSFVRQAMGLQGQPPNQVLIA 107

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+T +VM P +D+  +  + P +N QI    A      P   FM   TRE DL LFM
Sbjct: 108 LALFVTMFVMGPVMDKVWDTALNPYLNKQIGGEQAWDNAVIPVKDFMLRQTRESDLGLFM 167

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            +A        + K D    R++IP+FM+SEL+ +F+IGF++ LPFLI+DM+VA++VM+M
Sbjct: 168 RLAGMEQ----VEKRDEAPLRLVIPAFMVSELKTAFQIGFMVYLPFLIVDMVVASVVMSM 223

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMMLPP  IS+P K+I FVL+DGW L+V +LV+SF
Sbjct: 224 GMMMLPPLVISMPIKLILFVLVDGWVLVVGSLVQSF 259


>gi|325295421|ref|YP_004281935.1| flagellar biosynthetic protein FliP [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065869|gb|ADY73876.1| flagellar biosynthetic protein FliP [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 242

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 165/249 (66%), Gaps = 12/249 (4%)

Query: 1   MIRYCFFALFLVTPELVFAKSSLHDVMN--IP--ADLSISTWIVRTFGIFTILSIAPILL 56
           M +Y   A+  +   L++  +S  + +N  +P   +L I+   ++   + TILS+AP +L
Sbjct: 1   MKKYSQVAIVAIAINLLYISTSYGETVNDFLPQLGNLDIT---LKILFLITILSLAPAIL 57

Query: 57  IMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMN 116
           I VT F R +I+ S+LR  +G    PPN VII+L+LF+T + M+PT  +  E+ IQP +N
Sbjct: 58  ITVTSFTRIVIILSLLRHALGTPQTPPNQVIIALSLFLTLFTMAPTFQQIDELAIQPYIN 117

Query: 117 NQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSF 176
            +I++  AI+R +EP   FM  NTR++DL LF+D+     RN   +    I    LIP+F
Sbjct: 118 KKISDVEAIKRASEPIKNFMLRNTRKEDLKLFLDI-----RNEKPSSPQEISMLTLIPAF 172

Query: 177 MISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSL 236
           M+SE+R + E+ F+I LPF++ID++VA+I+M+MGMMM+PP  +SLPFK+I FVL DGW L
Sbjct: 173 MVSEIRTALEVVFVIFLPFIVIDLLVASILMSMGMMMIPPMMLSLPFKLILFVLSDGWEL 232

Query: 237 LVENLVKSF 245
           L+++++ S+
Sbjct: 233 LIKSIILSY 241


>gi|77463634|ref|YP_353138.1| flagellar biosynthesis protein FliP [Rhodobacter sphaeroides 2.4.1]
 gi|77388052|gb|ABA79237.1| Flagellar transport protein FliP [Rhodobacter sphaeroides 2.4.1]
          Length = 301

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 133/203 (65%), Gaps = 4/203 (1%)

Query: 43  FGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPT 102
             + T L++ P L++ ++ F R IIV SILR  +G    PPN V+I+LALF+TF+VM PT
Sbjct: 100 LALMTALTVLPSLVLGMSAFTRIIIVLSILRQALGTQQTPPNQVLIALALFLTFFVMQPT 159

Query: 103 LDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDIT 162
           L    E  + P ++ QI    AI+R       F+  NTR+ DL +F D+A +        
Sbjct: 160 LGALYEQSLSPFLDGQIEAQPAIERGGAIMKDFLIANTRQNDLLMFSDLAGAG----PYA 215

Query: 163 KNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLP 222
           +   + +  L+P+FM SEL+ +F+IGFL+ LPFL+IDM++A+I+MA+GMMML P  +SLP
Sbjct: 216 EPTEVPFSTLLPAFMTSELKTAFQIGFLLFLPFLVIDMVIASILMALGMMMLSPMLVSLP 275

Query: 223 FKVIFFVLIDGWSLLVENLVKSF 245
           FK++ FVL+DGW+L V +L  ++
Sbjct: 276 FKLLLFVLVDGWALTVGSLAATY 298


>gi|125973002|ref|YP_001036912.1| flagellar biosynthesis protein FliP [Clostridium thermocellum ATCC
           27405]
 gi|256004799|ref|ZP_05429774.1| flagellar biosynthetic protein FliP [Clostridium thermocellum DSM
           2360]
 gi|281417213|ref|ZP_06248233.1| flagellar biosynthetic protein FliP [Clostridium thermocellum JW20]
 gi|125713227|gb|ABN51719.1| flagellar biosynthetic protein FliP [Clostridium thermocellum ATCC
           27405]
 gi|255991249|gb|EEU01356.1| flagellar biosynthetic protein FliP [Clostridium thermocellum DSM
           2360]
 gi|281408615|gb|EFB38873.1| flagellar biosynthetic protein FliP [Clostridium thermocellum JW20]
 gi|316940762|gb|ADU74796.1| flagellar biosynthetic protein FliP [Clostridium thermocellum DSM
           1313]
          Length = 260

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 96/219 (43%), Positives = 143/219 (65%), Gaps = 8/219 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D+S +  I+    + TILS+AP +LIM+T F R IIV S  R  +G   +PPN V+I 
Sbjct: 47  PQDVSTTIQIIV---LLTILSLAPSILIMMTSFVRIIIVLSFFRNAIGTQQMPPNQVLIG 103

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+T ++M P L    E   +P  N +IT+  A++R ++    FM   T + DL LF+
Sbjct: 104 LALFLTLFIMRPVLTEINETAFKPYTNQEITQEVALERSSDIIKRFMLKQTSKNDLGLFV 163

Query: 150 DMAHSSHRNTDITKND--HIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVM 207
            +   S   T I + D   +   I+IP+F+ISEL  +F+IGFLI +PFL+IDM+V++ +M
Sbjct: 164 SL---SGMETPIKEEDIPKLPLTIVIPAFIISELTIAFKIGFLIYIPFLVIDMVVSSTLM 220

Query: 208 AMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSFI 246
           +MGMMMLPP  ISLPFK++ F+++ GW+L+ + +V SF+
Sbjct: 221 SMGMMMLPPVMISLPFKILLFIMVGGWNLMTQMIVNSFV 259


>gi|209695730|ref|YP_002263660.1| flagellar biosynthesis protein FliP [Aliivibrio salmonicida
           LFI1238]
 gi|208009683|emb|CAQ79982.1| polar flagellar assembly protein FliP [Aliivibrio salmonicida
           LFI1238]
          Length = 289

 Score =  178 bits (451), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 86/206 (41%), Positives = 135/206 (65%), Gaps = 5/206 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++  G+ T+L   P ++I++T F R ++V SILR  MG+   P N VII +A+F+TF++M
Sbjct: 87  LQILGLMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIAMFLTFFIM 146

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +P  D+  E  IQP +  +IT   A      P   FM   TR KDL  F++M+       
Sbjct: 147 APVFDKVNETAIQPYIGEEITAREAFDAAQIPMKEFMLAQTRVKDLETFVNMS-----GV 201

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           ++   + +   ++IP+F+ SEL+ +F++GF++ LPFLIID++VA+++MAMGMMML P  +
Sbjct: 202 EVENPEDVPITVVIPAFITSELKTAFQMGFMLFLPFLIIDLVVASVLMAMGMMMLSPMIV 261

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L++  L  SF
Sbjct: 262 SLPFKLMLFVLVDGWNLILSTLAGSF 287


>gi|317151987|ref|YP_004120035.1| flagellar biosynthetic protein FliP [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316942238|gb|ADU61289.1| flagellar biosynthetic protein FliP [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 256

 Score =  178 bits (451), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 146/247 (59%), Gaps = 11/247 (4%)

Query: 5   CFFALFLVTPELVFAKSSL--HDVMNIPADLS----ISTWIVRTFGIFTILSIAPILLIM 58
           C F    + P L  A+  +     M + A  +    +ST +   F + T+LS+AP +++ 
Sbjct: 14  CLFGALALFPALSLAQDPVIPKLTMELAAGQAEPGEVSTLLEILF-LLTVLSMAPAIMLT 72

Query: 59  VTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQ 118
           +T F R IIVF  LR  MG   +PPN ++  LA+FMT  +M P         +QP +  +
Sbjct: 73  MTSFTRIIIVFHFLRQAMGTQQMPPNQILAGLAIFMTVVIMMPVGKAINSTALQPYLAEE 132

Query: 119 ITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMI 178
           I    A++R   P   FM  +TREKDLS+F  +      N      D +   +L+ ++ I
Sbjct: 133 IRFDEALERAQVPIREFMFKHTREKDLSIFYSITKEERPN----NRDEVNTIMLVAAYTI 188

Query: 179 SELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLV 238
           SEL+  F IGFLI +PFLI+DM+VA+I++AMGMMMLPP  ISLPFK++ FVLIDGW+LLV
Sbjct: 189 SELKTGFTIGFLIYIPFLILDMVVASILLAMGMMMLPPVMISLPFKILLFVLIDGWNLLV 248

Query: 239 ENLVKSF 245
            +LV +F
Sbjct: 249 GSLVNTF 255


>gi|152965632|ref|YP_001361416.1| flagellar biosynthesis protein FliP [Kineococcus radiotolerans
           SRS30216]
 gi|151360149|gb|ABS03152.1| flagellar biosynthetic protein FliP [Kineococcus radiotolerans
           SRS30216]
          Length = 287

 Score =  178 bits (451), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 132/200 (66%), Gaps = 4/200 (2%)

Query: 46  FTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDR 105
            TILS+AP LL++ TCF + +IV  + R  +G+   PPN V+  LALF+T +VM+PT   
Sbjct: 90  LTILSVAPALLLLTTCFTKILIVLGLTRNALGLQGTPPNQVLAGLALFLTMFVMAPTFGA 149

Query: 106 SIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKND 165
             +  +QP +  + T T A    ++P   FM   TR ++L+L   M  ++ R+   T+ +
Sbjct: 150 INDTAVQPYLKGEKTATVAFTDGSQPLKEFMLKQTRPEELAL---MTKAAKRDLPATR-E 205

Query: 166 HIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKV 225
                 L+P+F +SELR +F IGF+I +PFL+ID++V+  +M++GMMMLPP ++SLPFK+
Sbjct: 206 ETPLTTLVPAFALSELRSAFIIGFVIFIPFLVIDIVVSGALMSLGMMMLPPVTVSLPFKL 265

Query: 226 IFFVLIDGWSLLVENLVKSF 245
           + FV+IDGW L+++ LV S+
Sbjct: 266 LLFVMIDGWGLIIKALVSSY 285


>gi|32490799|ref|NP_871053.1| flagellar biosynthesis protein FliP [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166005|dbj|BAC24196.1| fliP [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 263

 Score =  178 bits (451), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 138/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L+  P L+++++ F R IIV SILR  +G  + PPN ++I L+L +T ++M
Sbjct: 59  VQTLLFLTSLTFIPALILLMSSFTRIIIVLSILRNALGTPTAPPNQILIGLSLCLTIFIM 118

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP L++       P   N+I    AI    +P   FM + TREKDL+ +  ++ ++  N+
Sbjct: 119 SPVLEKIYYDSYLPFYQNKINLQKAIIYAEQPIKEFMISQTREKDLAFYSKISKTNEINS 178

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                  +  +ILIP+F+ SEL+ +F+IGF + +PFLIIDM+VA+I+MA+GMMMLPPT++
Sbjct: 179 P----KEVPIKILIPAFVTSELKTAFQIGFTLFIPFLIIDMVVASILMALGMMMLPPTTV 234

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FV+ DGW +L+ +LV+SF
Sbjct: 235 SLPFKLMLFVMADGWQILLGSLVQSF 260


>gi|303246798|ref|ZP_07333075.1| flagellar biosynthetic protein FliP [Desulfovibrio fructosovorans
           JJ]
 gi|302491815|gb|EFL51695.1| flagellar biosynthetic protein FliP [Desulfovibrio fructosovorans
           JJ]
          Length = 252

 Score =  178 bits (451), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 91/199 (45%), Positives = 134/199 (67%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+LS+AP  ++ VT F R IIVFS LR  MG+  VPP+ ++ SLA+F+T  +M PT    
Sbjct: 56  TVLSLAPAFVLTVTSFTRIIIVFSFLRQAMGVPQVPPSQILASLAIFLTCVIMYPTGKAI 115

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            +  +QP +N QI  T A+++   P   F+  +TREKDLS+F  +     R  D      
Sbjct: 116 NDDALQPYLNEQIGFTEALKKAETPLREFLFKHTREKDLSVFYTVTKM-ERPKD---KAE 171

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           +   +L   F+ISEL+ +F IGFLI +PFLI+DM++++I++AMGMMMLPP +I++PFK++
Sbjct: 172 VPTTMLAAGFIISELKTAFTIGFLIYIPFLILDMVISSILLAMGMMMLPPATIAMPFKLL 231

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW L+V ++V SF
Sbjct: 232 LFVLVDGWGLMVGSIVNSF 250


>gi|227112531|ref|ZP_03826187.1| flagellar biosynthesis protein FliP [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
 gi|227328348|ref|ZP_03832372.1| flagellar biosynthesis protein FliP [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 258

 Score =  177 bits (450), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 99/227 (43%), Positives = 148/227 (65%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  ++  P      +W   V+T  + T L+  P  L+M+T F R IIV S+LR  +G 
Sbjct: 34  AQLPGIVTQPLPNGGQSWTLSVQTLVLLTSLTFIPAALLMMTSFTRIIIVLSLLRNALGT 93

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            + PPN V++ L LF+TF+VMSP L+R  +    P   +QI+   AI+R AEP   FM  
Sbjct: 94  PTAPPNQVLLGLTLFLTFFVMSPVLNRVYDEAYLPFSQDQISMEVAIERGAEPVREFMLR 153

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+LF  +A       +I   + +  R+L+P+F+ SEL+ +F+IGF + +PFLII
Sbjct: 154 QTRETDLALFTRLAEIP----EIQGPEAVPMRVLLPAFVTSELKTAFQIGFTVFIPFLII 209

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 210 DLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSF 256


>gi|239628946|ref|ZP_04671977.1| flagellar biosynthesis protein FliP [Clostridiales bacterium
           1_7_47_FAA]
 gi|239519092|gb|EEQ58958.1| flagellar biosynthesis protein FliP [Clostridiales bacterium
           1_7_47FAA]
          Length = 255

 Score =  177 bits (450), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 133/203 (65%), Gaps = 2/203 (0%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           +F  L++ P L+IM+T F R +IV S LR  +G    PPN +++ LALF+T ++M+P   
Sbjct: 52  LFLFLAVVPSLIIMMTSFTRIVIVLSFLRNALGTQQSPPNQILVGLALFLTLFIMAPVFT 111

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
                  QP  +  IT   A  R  EP   FM   T +K L LF+ ++ +   +T     
Sbjct: 112 SVNVQAYQPYKSGTITREEAFDRAQEPMKEFMLKQTEKKSLDLFLSISKTDPPDTSKGPE 171

Query: 165 DHIEYRI--LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLP 222
            ++E  +  ++PSF++SEL ++F +GFLI +PFLIID++V++ +M+MGM+MLPPT I+LP
Sbjct: 172 GYMELGLTTIVPSFILSELNKAFTMGFLIFIPFLIIDLVVSSTLMSMGMVMLPPTMIALP 231

Query: 223 FKVIFFVLIDGWSLLVENLVKSF 245
           FK++ FVL+DGWSL+++ LV+SF
Sbjct: 232 FKIMMFVLVDGWSLVIKTLVQSF 254


>gi|462610|sp|P34200|FLIP_PECCC RecName: Full=Flagellar biosynthetic protein fliP; AltName:
           Full=Flagellar biosynthetic protein mopC
 gi|296055|emb|CAA51476.1| mopC [Pectobacterium carotovorum]
          Length = 258

 Score =  177 bits (450), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 99/227 (43%), Positives = 148/227 (65%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  ++  P      +W   V+T  + T L+  P  L+M+T F R IIV S+LR  +G 
Sbjct: 34  AQLPGIVTQPLPNGGQSWTLSVQTLVLLTSLTFLPAALLMMTSFTRIIIVLSLLRNALGT 93

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            + PPN V++ L LF+TF+VMSP L+R  +    P   +QI+   AI+R AEP   FM  
Sbjct: 94  PTAPPNQVLLGLTLFLTFFVMSPVLNRVYDEAYLPFSQDQISMEVAIERGAEPVREFMLR 153

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+LF  +A       +I   + +  R+L+P+F+ SEL+ +F+IGF + +PFLII
Sbjct: 154 QTRETDLALFTRLAEIP----EIQGPEAVPMRVLLPAFVTSELKTAFQIGFTVFIPFLII 209

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 210 DLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSF 256


>gi|121533746|ref|ZP_01665573.1| flagellar biosynthetic protein FliP [Thermosinus carboxydivorans
           Nor1]
 gi|121307737|gb|EAX48652.1| flagellar biosynthetic protein FliP [Thermosinus carboxydivorans
           Nor1]
          Length = 253

 Score =  177 bits (450), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 147/216 (68%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P D+++S  ++ T    T+LS+AP +LIM+T F R IIV S LR+ +     PPN V+I 
Sbjct: 44  PKDVALSLQVLFT---LTVLSLAPSILIMMTSFTRIIIVLSFLRSALATQQTPPNQVLIG 100

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+TFY MSP  D+  +  +QP +   I++ TA+    +P   FM   TRE DL+LF+
Sbjct: 101 LALFLTFYTMSPYWDQINQNALQPYLAGTISQDTAMSEAMKPLRQFMLKQTRENDLALFV 160

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
           +++     N+     + I    LIP+F+ISEL+ +F+IGFLI +PF++IDM+VA+ +M+M
Sbjct: 161 NLSEGPRPNSP----EDITTSTLIPAFIISELKTAFQIGFLIYIPFIVIDMVVASTLMSM 216

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GMMM+PP  ISLPFK++ F+L+DGW L++ +L+ SF
Sbjct: 217 GMMMVPPVMISLPFKLLLFILVDGWHLIIRSLITSF 252


>gi|289548901|ref|YP_003473889.1| flagellar biosynthetic protein FliP [Thermocrinis albus DSM 14484]
 gi|289182518|gb|ADC89762.1| flagellar biosynthetic protein FliP [Thermocrinis albus DSM 14484]
          Length = 236

 Score =  177 bits (450), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 137/194 (70%), Gaps = 4/194 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +LIM T F R +IV S+LR  +G+ +VPPN VI+SLA+F+TF+VM PT D+  +  +
Sbjct: 46  APSILIMTTAFVRIVIVLSLLRQAIGVPTVPPNQVIVSLAMFLTFFVMKPTWDKINQQAL 105

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QPL+N QIT+   ++R +     FM  NT+ + L  F+  A +  R  ++     +   +
Sbjct: 106 QPLLNKQITDVEFLERTSSIMKEFMLRNTKRETLQAFLK-ASTVQRGEEV---RDVPMHV 161

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           LIP+FM+SE+  +F+I FL+ LPFLI+DM+VA+I+++MG++M+PP  ISLPFK++ FVL 
Sbjct: 162 LIPAFMVSEISVAFQIVFLLYLPFLIVDMVVASILISMGVLMVPPQIISLPFKLMLFVLA 221

Query: 232 DGWSLLVENLVKSF 245
           +GW L++ +LV+S+
Sbjct: 222 NGWELVILSLVRSY 235


>gi|239997094|ref|ZP_04717618.1| flagellar biosynthesis protein FliP [Alteromonas macleodii ATCC
           27126]
          Length = 251

 Score =  177 bits (450), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 133/201 (66%), Gaps = 3/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS+ P  ++M+T F R I+V SILR  +G+   P N ++I ++LF++ ++M+P  +
Sbjct: 50  IMTALSLIPAFIMMMTSFTRIIVVLSILRQAIGLQQSPSNQILIGVSLFLSMFIMAPVFE 109

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
              E  +QP +N Q+T   A+++   P   FM + TR KDL  F+ +A    +  D    
Sbjct: 110 EVNERALQPYLNEQLTSLDALEQAKGPMRAFMLSQTRVKDLETFVRIAGDEGKYAD---T 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           + +   ILIP+F+ SEL+ +F+IGF++ +PFLIID++VA+I+MAMGMMML P  +SLPFK
Sbjct: 167 NEVPLTILIPAFVTSELKTAFQIGFMLFIPFLIIDLVVASILMAMGMMMLSPMIVSLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L+   L  SF
Sbjct: 227 LMLFVLVDGWNLIFGTLATSF 247


>gi|300311365|ref|YP_003775457.1| flagellar biosynthetic protein FliP [Herbaspirillum seropedicae
           SmR1]
 gi|300074150|gb|ADJ63549.1| flagellar biosynthetic protein FliP precursor protein
           [Herbaspirillum seropedicae SmR1]
          Length = 244

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 143/221 (64%), Gaps = 4/221 (1%)

Query: 25  DVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPN 84
           + M  P   +  +  ++T  + T LS  P  L+M+TCF R +IV S+LR  +G  S PP 
Sbjct: 27  NSMPAPGGGTNYSLPIQTMLLLTSLSFLPAALLMMTCFTRIVIVLSLLRQALGTQSTPPT 86

Query: 85  LVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKD 144
            V++ L+LF+TF+VMSP  DR      QP   N+I    A+ + A+P   FM   TRE D
Sbjct: 87  QVLVGLSLFLTFFVMSPVFDRIYTDAYQPFAENKIQMMEALDKGAQPLKEFMLKQTRESD 146

Query: 145 LSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVAT 204
           L+L++ ++    R   +   + +  R+L+P+F+ SEL+ +F+IGF I LPFLIIDM+VA+
Sbjct: 147 LALYVKLS----RGPALQGPEDVPLRLLVPAFVTSELKTAFQIGFAIFLPFLIIDMVVAS 202

Query: 205 IVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           I+M+MGMMM+ P  +SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 203 ILMSMGMMMMSPALVSLPFKLMLFVLVDGWQLLIGSLAQSF 243


>gi|50120649|ref|YP_049816.1| flagellar biosynthesis protein FliP [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611175|emb|CAG74621.1| flagellar biosynthetic protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 258

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/227 (43%), Positives = 147/227 (64%), Gaps = 6/227 (2%)

Query: 21  SSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGM 78
           + L  ++  P      +W   V+T    T L+  P  L+M+T F R IIV S+LR  +G 
Sbjct: 34  AQLPGIVTQPLPNGGQSWTLSVQTLVFLTSLTFLPAALLMMTSFTRIIIVLSLLRNALGT 93

Query: 79  GSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRN 138
            + PPN V++ L LF+TF+VMSP L+R  +    P   +QI+   AI+R AEP   FM  
Sbjct: 94  PTAPPNQVLLGLTLFLTFFVMSPVLNRVYDEAYLPFSQDQISMEVAIERGAEPLREFMLR 153

Query: 139 NTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLII 198
            TRE DL+LF  +A       +I   + +  R+L+P+F+ SEL+ +F+IGF + +PFLII
Sbjct: 154 QTRETDLALFTRLAEIP----EIQGPEAVPMRVLLPAFVTSELKTAFQIGFTVFIPFLII 209

Query: 199 DMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           D++VA+++MA+GMMM+PP +ISLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 210 DLVVASVLMALGMMMVPPATISLPFKLMLFVLVDGWQLLLGSLAQSF 256


>gi|325288789|ref|YP_004264970.1| flagellar biosynthetic protein FliP [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324964190|gb|ADY54969.1| flagellar biosynthetic protein FliP [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 250

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 106/232 (45%), Positives = 151/232 (65%), Gaps = 6/232 (2%)

Query: 14  PELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILR 73
           P+ V A     D+ N P + + S   ++ F I T+LS+ P +L+++T F R I+V S +R
Sbjct: 24  PQGVRAAGINLDLGNTPVEQTSSA--IQIFLIMTVLSLVPAILVLMTSFTRIIVVLSFVR 81

Query: 74  TGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFW 133
             MG   +PPN VII LAL +TF+VM+PT  +     I+P + NQI+   A+ R   P  
Sbjct: 82  NAMGTQQLPPNQVIIGLALILTFFVMAPTFSQVNTNAIKPYIENQISREEALTRAEAPLR 141

Query: 134 VFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIIL 193
            FM   TREKDL+LF+ ++      T       I   +L+PSF+ISEL+ +F+IGF I +
Sbjct: 142 EFMIKQTREKDLALFVGLSQIPQPKT----YRDIPTYVLVPSFVISELKTAFQIGFAIFI 197

Query: 194 PFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           PF+IIDMIVA+ +M+MGMMMLPP  ISLPFK++ FV++DGW L+V++LV SF
Sbjct: 198 PFMIIDMIVASTLMSMGMMMLPPMMISLPFKILLFVIVDGWYLIVQSLVASF 249


>gi|332994111|gb|AEF04166.1| flagellar biosynthesis protein FliP [Alteromonas sp. SN2]
          Length = 252

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 133/201 (66%), Gaps = 3/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T LS+ P  ++M+T F R I+V SILR  +G+   P N +++ ++LF++ ++M+P  +
Sbjct: 51  IMTALSLIPAFIMMMTSFTRIIVVLSILRQAIGLQQSPSNQILVGVSLFLSMFIMAPVFE 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
              E  +QP ++ Q+T   AI++   P   FM + TR KDL  F+ +A    +  D    
Sbjct: 111 EINERALQPYLSEQMTSLDAIEQAKGPMRAFMLSQTRVKDLETFVRIAGDEGKYAD---T 167

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D +   ILIP+F+ SEL+ +F+IGF++ +PFLIID++VA+I+MAMGMMML P  +SLPFK
Sbjct: 168 DEVPLTILIPAFVTSELKTAFQIGFMLFIPFLIIDLVVASILMAMGMMMLSPMIVSLPFK 227

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L+   L  SF
Sbjct: 228 LMLFVLVDGWNLIFGTLATSF 248


>gi|283853451|ref|ZP_06370695.1| flagellar biosynthetic protein FliP [Desulfovibrio sp. FW1012B]
 gi|283571171|gb|EFC19187.1| flagellar biosynthetic protein FliP [Desulfovibrio sp. FW1012B]
          Length = 262

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/199 (45%), Positives = 134/199 (67%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+LS+AP  ++ VT F R IIVFS LR  MG+  VPP  ++ SLA+F+T  +M PT  + 
Sbjct: 66  TVLSLAPSFILTVTSFTRIIIVFSFLRQAMGVPQVPPTQILASLAIFLTCVIMYPTGKQI 125

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            +  +QP +  +I  T A+++   P   F+  +TREKDLS+F  +     R  D      
Sbjct: 126 NDDALQPYLEERIGFTEALKKAEAPLREFLFKHTREKDLSVFYTVTKM-ERPKD---KAE 181

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           +   +L   FMISEL+ +F IGFLI +PFLI+DM++++I++AMGMMMLPP +I++PFK++
Sbjct: 182 VPTMMLAAGFMISELKTAFTIGFLIYIPFLILDMVISSILLAMGMMMLPPATIAMPFKLL 241

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW+L+V +LV SF
Sbjct: 242 LFVLVDGWALMVGSLVNSF 260


>gi|94495439|ref|ZP_01302019.1| flagellar transport protein [Sphingomonas sp. SKA58]
 gi|94424827|gb|EAT09848.1| flagellar transport protein [Sphingomonas sp. SKA58]
          Length = 255

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 89/199 (44%), Positives = 131/199 (65%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           ++L++ P L++M+T F R IIV S+LR  +G+   PPN V++ LALF++ +VM P +D  
Sbjct: 59  SLLTVLPSLVLMMTSFTRIIIVLSLLRQALGLQQTPPNQVLVGLALFLSLFVMRPAIDTI 118

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
                 P    QI+   A+ R A+    FM   TRE DL LF ++A +    T       
Sbjct: 119 NAQAFDPYGKGQISIEEAVGRSAKVLHGFMSKQTRESDLKLFANLAQAPAFRTPA----D 174

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           I + IL+P+F+ SEL+ +F+IGF+I LPFLIID++VA+ +MA+GMMML PT IS+PFK++
Sbjct: 175 IPFSILLPAFVTSELKTAFQIGFMIFLPFLIIDLVVASTLMALGMMMLSPTIISMPFKLL 234

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW+L + +L  SF
Sbjct: 235 LFVLVDGWALTMGSLAGSF 253


>gi|88800467|ref|ZP_01116031.1| flagellar biosynthetic protein FliP [Reinekea sp. MED297]
 gi|88776797|gb|EAR08008.1| flagellar biosynthetic protein FliP [Reinekea sp. MED297]
          Length = 221

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 132/206 (64%), Gaps = 3/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   I T L+  P  L+M+T F R I+VF+ILR  +G+   P N ++I LALF+TF++M
Sbjct: 17  IQILAIMTALTFIPAALMMMTSFTRIIVVFAILRQAIGLQQTPSNQMLIGLALFLTFFIM 76

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +P  +      IQP +   I    A+ R  EP   FM   TRE DL LF+ +A       
Sbjct: 77  APVFNEVNANAIQPYIAEDILPLEAVDRAVEPMKRFMLAQTRESDLGLFIRLADEEGNFD 136

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           D      +   IL+P+F+ SEL+ +F+IGFL+ +PFLIID+++A+I+MAMGMMML P  I
Sbjct: 137 D---PQQVPLNILMPAFVTSELKTAFQIGFLLFIPFLIIDLVIASILMAMGMMMLSPIII 193

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW++++ ++  SF
Sbjct: 194 SLPFKIMLFVLVDGWAMVMGSVAASF 219


>gi|127512307|ref|YP_001093504.1| flagellar biosynthesis protein FliP [Shewanella loihica PV-4]
 gi|126637602|gb|ABO23245.1| flagellar biosynthetic protein FliP [Shewanella loihica PV-4]
          Length = 255

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 144/236 (61%), Gaps = 7/236 (2%)

Query: 13  TPELVFAKSSLHDVMNIPADLSISTWIVRTFGIF---TILSIAPILLIMVTCFPRFIIVF 69
            P+L  A+  +   + +      ST    T  I    T LS  P ++IM+T F R I+V 
Sbjct: 22  APQLALAQDGILPAVTVTTGADGSTQYSVTMQILLLMTALSFLPAMVIMLTSFTRIIVVL 81

Query: 70  SILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVA 129
           SILR  +G+   P N V+I ++LFMTF++M+P  D+  +  ++P ++  +T   A  +  
Sbjct: 82  SILRQAIGLQQTPSNQVLIGMSLFMTFFIMAPVFDKIYDQAVKPYIDETMTIEQAYDKGK 141

Query: 130 EPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGF 189
           EP   FM   TR  DL  F+ +  S ++N  I   +     +LIP+F+ SEL+ +F+IGF
Sbjct: 142 EPLRAFMLAQTRLTDLETFVQI--SGYQN--IQSPEDAPMSVLIPAFITSELKTAFQIGF 197

Query: 190 LIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           ++ +PFL++D++VA+I+MAMGMMML P  +SLPFK++ FVL+DGWSL++  L  SF
Sbjct: 198 MLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFKIMLFVLVDGWSLVMGTLANSF 253


>gi|289523556|ref|ZP_06440410.1| flagellar biosynthetic protein FliP [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
 gi|289503248|gb|EFD24412.1| flagellar biosynthetic protein FliP [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
          Length = 252

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/216 (39%), Positives = 143/216 (66%), Gaps = 7/216 (3%)

Query: 30  PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIIS 89
           P+D++++  I+    + TILS+AP +++MVT F R I+V   +R  +G+  +PPN V+++
Sbjct: 43  PSDVALTLQII---ALITILSLAPAIVLMVTSFTRIIVVLGFVRQSIGLQQLPPNQVLVT 99

Query: 90  LALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFM 149
           LALF+TF+ MSP   +     I P M  +I    A  +   P   FM +  ++++LSL +
Sbjct: 100 LALFLTFFTMSPVWQKIYSESINPYMAGEIATQEAYAKAIGPIRDFMFSQVKDEELSLMV 159

Query: 150 DMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAM 209
            ++           +D +  R+LIP+FMI EL+++F++G LI +PF+++DMIVA+++++M
Sbjct: 160 SLSDLPQPQ----NHDDVPTRVLIPAFMIGELKKAFQMGILIFIPFIVVDMIVASVLLSM 215

Query: 210 GMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           GM+MLPP  ISLPFKV+ FV+ DGW L++ ++V SF
Sbjct: 216 GMIMLPPMLISLPFKVLLFVVADGWDLVIYSVVSSF 251


>gi|332702322|ref|ZP_08422410.1| flagellar biosynthetic protein FliP [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332552471|gb|EGJ49515.1| flagellar biosynthetic protein FliP [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 263

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 146/236 (61%), Gaps = 9/236 (3%)

Query: 14  PELVFAKSSLHDVMNI----PADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVF 69
           P L +A+   H  M+I    P    +S  +   F + T+LS+AP +++ +T F R IIVF
Sbjct: 31  PGLAWAQDIPHFSMSISGGQPEPEQVSLLLEIIF-LLTVLSLAPAIIMTMTSFTRIIIVF 89

Query: 70  SILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVA 129
             LR  +G   +PP+ ++ISLA+FMTF +M PT        +QP M  +I    A+    
Sbjct: 90  HFLRQALGTQQMPPSQILISLAIFMTFVIMMPTAMAINNTALQPYMEERIGFKEALDNAQ 149

Query: 130 EPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGF 189
           +P   FM  +TREKDLS+F  +A     +      + +   +L  +F+ISEL+  F IGF
Sbjct: 150 KPLREFMFKHTREKDLSVFYSIAKIERPD----NREQVPTMLLTAAFVISELKTGFIIGF 205

Query: 190 LIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           LI +PFLI+DM+VA+I++AMGMMMLPP  ISLPFKV+ FV++DGW+LL  +LV SF
Sbjct: 206 LIYIPFLILDMVVASILLAMGMMMLPPVMISLPFKVLLFVMVDGWNLLTASLVNSF 261


>gi|219670147|ref|YP_002460582.1| flagellar biosynthesis protein FliP [Desulfitobacterium hafniense
           DCB-2]
 gi|219540407|gb|ACL22146.1| flagellar biosynthetic protein FliP [Desulfitobacterium hafniense
           DCB-2]
          Length = 259

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 105/235 (44%), Positives = 155/235 (65%), Gaps = 6/235 (2%)

Query: 11  LVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFS 70
           LV  + V A     D     A+ + ST  ++   + T++SIAP +L+++T F R IIV S
Sbjct: 30  LVNTDSVLAAGLTLDFGTTTAEQTSST--LQILLLLTVISIAPAILVLMTSFTRTIIVLS 87

Query: 71  ILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAE 130
            +R  +G   +PPN V+I L+LF+TF+VM+PT +      +QP M NQIT+  A+Q+   
Sbjct: 88  FVRNALGTQQLPPNQVLIGLSLFLTFFVMAPTWNEINTQALQPYMQNQITQAEALQQAEA 147

Query: 131 PFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFL 190
           P   FM   TREKDL+LF+ +A      T       I   +LIP+F+ISEL+ +F++GF 
Sbjct: 148 PLRQFMFEQTREKDLTLFVGLARMEQPQT----YGDIPTYVLIPAFVISELKTAFQMGFA 203

Query: 191 IILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           I +PF++IDM+VA+++M+MGMMMLPP  +SLPFK++ FVL+DGW L+V++LV SF
Sbjct: 204 IFIPFMVIDMLVASVLMSMGMMMLPPMMVSLPFKILLFVLVDGWHLVVQSLVTSF 258


>gi|319764505|ref|YP_004128442.1| flagellar biosynthetic protein flip [Alicycliphilus denitrificans
           BC]
 gi|317119066|gb|ADV01555.1| flagellar biosynthetic protein FliP [Alicycliphilus denitrificans
           BC]
          Length = 251

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 132/206 (64%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+M+T F R +IV S+LR  +G    PPN V++ L+LF+T +VM
Sbjct: 48  IQTLLFFTALSFLPAVLLMMTGFTRIVIVLSLLRQAIGTQQAPPNQVVVGLSLFLTLFVM 107

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PTLD+  +    P   N ++   A+ +   P   FM   TR+ D +LF  +A      T
Sbjct: 108 GPTLDKVYQEAYVPYTTNALSFEQALAKAEAPMRGFMLKQTRQSDFTLFARLAKLDEGVT 167

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                +    R+L+P+F+ SEL+ +F+IGF++ +PFLIIDM+V++++M++GMMML P  +
Sbjct: 168 ----AETAPLRVLVPAFVTSELKTAFQIGFMVFIPFLIIDMVVSSVLMSLGMMMLSPVLV 223

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL DGW+LL+ +L  SF
Sbjct: 224 ALPFKLMLFVLADGWNLLIGSLAASF 249


>gi|255264563|ref|ZP_05343905.1| flagellar biosynthetic protein FliP [Thalassiobium sp. R2A62]
 gi|255106898|gb|EET49572.1| flagellar biosynthetic protein FliP [Thalassiobium sp. R2A62]
          Length = 243

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 140/234 (59%), Gaps = 6/234 (2%)

Query: 1   MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVT 60
           +IR+ F AL L +   V A+      ++   D S++   ++   + TILSI P L IM+T
Sbjct: 4   LIRFSFLALALFSATSVTAQ---EISLSFGDDASLAGRSIQLLALVTILSIVPGLAIMIT 60

Query: 61  CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT 120
           CFP  + V +ILR  +G+   PPN++I+SLALF+T++VM P    S  +GI PL   ++ 
Sbjct: 61  CFPFIVTVLAILRQAIGLQQSPPNMLIVSLALFLTYFVMEPVFIESWTLGIGPLSTGELE 120

Query: 121 ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE 180
              A+     PF  FM             D+   S  + DI         ++IPSF++SE
Sbjct: 121 IEPALANAISPFRDFMALRIDPNTFQTLTDIRPQSSTSEDIASA---PLSLMIPSFLLSE 177

Query: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGW 234
           + R+F++GFLI LPFLIID++VA I+M+MGMMM+PP  +SLPFK+ FFV+ DGW
Sbjct: 178 IERAFQVGFLIFLPFLIIDLVVAAILMSMGMMMVPPAIVSLPFKLAFFVIADGW 231


>gi|330826721|ref|YP_004390024.1| flagellar biosynthetic protein FliP [Alicycliphilus denitrificans
           K601]
 gi|329312093|gb|AEB86508.1| flagellar biosynthetic protein FliP [Alicycliphilus denitrificans
           K601]
          Length = 251

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/206 (41%), Positives = 132/206 (64%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T   FT LS  P +L+M+T F R +IV S+LR  +G    PPN V++ L+LF+T +VM
Sbjct: 48  IQTLLFFTALSFLPAVLLMMTGFTRIVIVLSLLRQAIGTQQAPPNQVVVGLSLFLTLFVM 107

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PTLD+  +    P   N ++   A+ +   P   FM   TR+ D +LF  +A      T
Sbjct: 108 GPTLDKVYQEAYVPYTTNALSFEQALAKAEAPMRGFMLKQTRQSDFALFARLAKLDEGVT 167

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
             T       R+L+P+F+ SEL+ +F+IGF++ +PFLIIDM+V++++M++GMMML P  +
Sbjct: 168 AETA----PLRVLVPAFVTSELKTAFQIGFMVFIPFLIIDMVVSSVLMSLGMMMLSPVLV 223

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           +LPFK++ FVL DGW+LL+ +L  SF
Sbjct: 224 ALPFKLMLFVLADGWNLLIGSLAASF 249


>gi|73532546|dbj|BAE19831.1| flagellar biosynthesis protein [Edwardsiella tarda]
          Length = 231

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 132/194 (68%), Gaps = 5/194 (2%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T LS  P  L+++T F R IIV  +LRT  G  S PPN V++ LALF+TF++M
Sbjct: 43  VQTLVFLTSLSFLPAALLLMTSFTRIIIVLGLLRTP-GHPSAPPNQVLLGLALFLTFFIM 101

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP LD+  +   QP    +I+  TA+ R A+P   FM   TRE DL+LF  +A    +  
Sbjct: 102 SPVLDKIYQDAYQPFSEQKISMETALDRGAKPLRAFMLRQTRETDLALFSRLA----KQP 157

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           ++   + +  RIL+P+++ SEL+ +F+IGF + +PFLIID++VA+++MA+GMMM+PP +I
Sbjct: 158 EMQGPEDVPMRILLPAYVTSELKTAFQIGFTVFIPFLIIDLVVASVLMALGMMMVPPATI 217

Query: 220 SLPFKVIFFVLIDG 233
           SLPFK++ FVL+DG
Sbjct: 218 SLPFKLMLFVLVDG 231


>gi|291617858|ref|YP_003520600.1| FliP [Pantoea ananatis LMG 20103]
 gi|291152888|gb|ADD77472.1| FliP [Pantoea ananatis LMG 20103]
 gi|327394275|dbj|BAK11697.1| flagellar biosynthetic protein FliP precursor [Pantoea ananatis
           AJ13355]
          Length = 244

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/229 (41%), Positives = 151/229 (65%), Gaps = 6/229 (2%)

Query: 19  AKSSLHDVMNIPADLSISTWI--VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGM 76
           A + L  +++ P      +W   V+T    T L+  P +L+M+T F R IIVF +LR  +
Sbjct: 18  AHAQLPGLVSQPLANGGQSWSLPVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNAL 77

Query: 77  GMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFM 136
           G  S PPN V++ L LF+TF++M+PT D+  +    P   ++I+   AI + A+P   FM
Sbjct: 78  GTPSAPPNQVLLGLTLFLTFFIMAPTFDKIYQDAYLPFSQDKISMDVAIDKGAQPLREFM 137

Query: 137 RNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFL 196
              TRE DL+LF  +A+++     I   + +  RIL+P+++ SEL+ +F+IGF + +PFL
Sbjct: 138 LRQTREADLALFARLANTA----PIAGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFL 193

Query: 197 IIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           IID++VA+++MA+GMMM+PP +I+LPFK++ FVL+DGW LLV +L +SF
Sbjct: 194 IIDLVVASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSF 242


>gi|317133473|ref|YP_004092787.1| flagellar biosynthetic protein FliP [Ethanoligenens harbinense
           YUAN-3]
 gi|315471452|gb|ADU28056.1| flagellar biosynthetic protein FliP [Ethanoligenens harbinense
           YUAN-3]
          Length = 267

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 124/193 (64%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +LIM+T F R II  S LR  +G    PPN V++ +ALF++ ++MSP +++      Q
Sbjct: 78  PSILIMMTSFTRIIIFLSFLRNALGTQQTPPNQVLVGIALFLSLFIMSPVINQINTTAYQ 137

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           PL+N QIT   A     +P   FM   T    L  F+ MA +      +   D+I   +L
Sbjct: 138 PLVNGQITTEQAEVNAMKPLRQFMFKQTENASLKTFLSMAGTP----TVKSLDNIPNSVL 193

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           IP+F+ISEL+R+F +GFLI LPFLIID+IV T +M+MGMMMLPPT ISLP K+  FVL+D
Sbjct: 194 IPAFVISELKRAFMMGFLIYLPFLIIDVIVGTTLMSMGMMMLPPTMISLPLKLALFVLVD 253

Query: 233 GWSLLVENLVKSF 245
           GW L V++LV SF
Sbjct: 254 GWGLTVQSLVYSF 266


>gi|226313054|ref|YP_002772948.1| flagellar biosynthetic protein FliP precursor [Brevibacillus brevis
           NBRC 100599]
 gi|226096002|dbj|BAH44444.1| flagellar biosynthetic protein FliP precursor [Brevibacillus brevis
           NBRC 100599]
          Length = 253

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/201 (46%), Positives = 139/201 (69%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           I T+LS+AP +L+++T F R IIV S +R  +    +PPN V+I+LALFMTF++M+PTL 
Sbjct: 57  ILTVLSVAPAILLLMTSFARIIIVLSFVRNALATQQMPPNQVLIALALFMTFFIMAPTLG 116

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  E  +QP M  ++T+  A      PF  FM   TREKDL+LF++   +    T     
Sbjct: 117 QVNETAVQPFMQGKLTQQQAFDAAVIPFKQFMAKQTREKDLALFLEYTKAERPKT----I 172

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
             I    L+P++ ISEL+ +F+IGF+I +PFL+IDMI+++I+M MGMMMLPP  ISLPFK
Sbjct: 173 QDIPLNALVPAYAISELKTAFQIGFMIFIPFLVIDMIISSILMGMGMMMLPPVMISLPFK 232

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ F+++DGW L+V++L+ SF
Sbjct: 233 ILLFIMVDGWYLIVKSLLTSF 253


>gi|296135631|ref|YP_003642873.1| flagellar biosynthetic protein FliP [Thiomonas intermedia K12]
 gi|295795753|gb|ADG30543.1| flagellar biosynthetic protein FliP [Thiomonas intermedia K12]
          Length = 255

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 146/207 (70%), Gaps = 4/207 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L   P +L+M+T F R IIV S+L+  +G  +VPP+ VI+ L+LF+TF+VM
Sbjct: 52  VQTLLFMTALVFLPAMLLMMTAFTRIIIVLSLLKQALGTTTVPPSQVIVGLSLFLTFFVM 111

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP L++  ++ I+PLM+NQIT   A+Q  A P   FM   TR++DL+LF+ +  S H+  
Sbjct: 112 SPVLNQVNDVAIKPLMDNQITMQQALQTGAAPLRTFMLGQTRQEDLALFVKL--SGHKAL 169

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           D  K +     +LIP+F+ SEL+ +F+IGF+I +PFLIIDM+VA ++M+MGMMML P ++
Sbjct: 170 D--KPEDTPMTLLIPAFVTSELKTAFQIGFVIFIPFLIIDMVVAAVLMSMGMMMLSPVTV 227

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSFI 246
           S P K++ FVL+ GW L++ +L++SF+
Sbjct: 228 SFPLKLMLFVLVGGWELVIGSLMQSFV 254


>gi|121997286|ref|YP_001002073.1| flagellar biosynthesis protein FliP [Halorhodospira halophila SL1]
 gi|121588691|gb|ABM61271.1| flagellar biosynthetic protein FliP [Halorhodospira halophila SL1]
          Length = 246

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/193 (44%), Positives = 128/193 (66%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +++M+T F R I+V +ILR  +G  S P N V+I LALF+T +VM P  D   E  +Q
Sbjct: 56  PAMVLMMTAFTRIIVVLAILRQALGTASTPSNQVLIGLALFLTLFVMMPVFDEINETALQ 115

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P M  ++    A+++ +EP   FM   TRE D++LF+ +A       ++   D +   +L
Sbjct: 116 PYMAEEMGAEEALEQASEPMREFMIRQTREDDIALFLRIADYG----EVDSPDDVPMSVL 171

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           IP+FM SEL+ +F IGF++ LPFL+ID++VA+ +M+MGM+ML P  ISLPFK++ FVL+D
Sbjct: 172 IPAFMTSELKTAFIIGFVLYLPFLVIDLVVASTLMSMGMLMLSPMIISLPFKIMLFVLVD 231

Query: 233 GWSLLVENLVKSF 245
           GWSL++  L  SF
Sbjct: 232 GWSLIMGTLASSF 244


>gi|297617154|ref|YP_003702313.1| flagellar biosynthetic protein FliP [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297144991|gb|ADI01748.1| flagellar biosynthetic protein FliP [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 259

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 141/206 (68%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + TILS+AP +LI++T F R I+V S +R+ +    +PPN +++ LALF+TF+VM
Sbjct: 57  LQILALLTILSLAPAILILLTSFTRIIVVLSFVRSALATQQMPPNQILVGLALFLTFFVM 116

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +PT     E  +QP    +IT+  A  R   P   FM   TREKDL+LF+ MA      T
Sbjct: 117 APTWKEVNEKALQPYFQGEITQDQAFTRGMAPLRTFMFKQTREKDLALFVKMAKIQRPRT 176

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                D   Y +LIP+F+ISEL+ +FEIGF+I +PFL+IDM+V++ +M+MGM+MLPP  I
Sbjct: 177 ---YGDVPNY-VLIPAFVISELKTAFEIGFIIFVPFLVIDMVVSSALMSMGMLMLPPMMI 232

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L+V +L+ SF
Sbjct: 233 SLPFKILLFVLVDGWNLVVNSLLMSF 258


>gi|229827384|ref|ZP_04453453.1| hypothetical protein GCWU000182_02772 [Abiotrophia defectiva ATCC
           49176]
 gi|229788322|gb|EEP24436.1| hypothetical protein GCWU000182_02772 [Abiotrophia defectiva ATCC
           49176]
          Length = 283

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 85/200 (42%), Positives = 136/200 (68%), Gaps = 4/200 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+L +AP +LI++T F R I+V   +R+ +   + PPN V++ LALF+T+++M+P   + 
Sbjct: 87  TVLGLAPSILILLTSFTRIIVVLHFVRSALTTQTTPPNQVLVGLALFLTWFIMAPIFMQI 146

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
               ++PL + +I    A +   +P   FM   T  KD+ LF+D+A       ++   + 
Sbjct: 147 NTEALKPLTDGKINFEQAYEVGIKPLRTFMYKQTNTKDIRLFLDIAGID----EVKDMEE 202

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           I   +LIP+F+ISELR +F IGF I +PFL+IDM+V++ +M+MGMMMLPPT+IS+PFK++
Sbjct: 203 IPTNVLIPAFIISELRAAFIIGFCIYIPFLVIDMVVSSTLMSMGMMMLPPTTISMPFKIL 262

Query: 227 FFVLIDGWSLLVENLVKSFI 246
            F+++DGW L++ NLVKSF+
Sbjct: 263 LFIMVDGWDLVIGNLVKSFV 282


>gi|255022051|ref|ZP_05294057.1| Flagellar biosynthesis pathway, component FliP [Acidithiobacillus
           caldus ATCC 51756]
 gi|254968537|gb|EET26093.1| Flagellar biosynthesis pathway, component FliP [Acidithiobacillus
           caldus ATCC 51756]
          Length = 231

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 138/206 (66%), Gaps = 3/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T  + T+L+  P +++M+T F R IIV S+LR G+G+ ++PPN+V+I LALF+TF+VM
Sbjct: 25  VQTVILMTVLTFLPAIVLMMTGFTRIIIVLSLLRQGLGLSTMPPNIVLIGLALFLTFFVM 84

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PT        + PL   +++ T A+    +P  +FMRNNT +  ++ F+ M     + T
Sbjct: 85  QPTWSSINHQALIPLEQGKVSVTRALAIAEKPLRIFMRNNTTKDSVAQFLRM--DGIKKT 142

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
             ++ D I  R+LIP+F +S+L   FE+GFL+ LPFLIID++VA ++MAMGMMM+ P +I
Sbjct: 143 LRSEKD-IPMRVLIPAFAVSQLESGFELGFLVYLPFLIIDLLVAAVLMAMGMMMVSPQTI 201

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           S+P K++ F L  GW L+   LV+SF
Sbjct: 202 SIPIKLLLFALGGGWLLVTGTLVRSF 227


>gi|288870652|ref|ZP_06114850.2| flagellar biosynthetic protein FliP [Clostridium hathewayi DSM
           13479]
 gi|288866388|gb|EFC98686.1| flagellar biosynthetic protein FliP [Clostridium hathewayi DSM
           13479]
          Length = 259

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 130/203 (64%), Gaps = 2/203 (0%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           +F  L++ P LLIM+T F R +IV S LR  +G    PPN V+I LALF+T ++MSP   
Sbjct: 56  LFLFLAVVPSLLIMMTSFTRIVIVLSFLRNALGTQQSPPNQVMIGLALFLTLFIMSPVFA 115

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +      +P     IT   A  R  EP   FM   T +K L LF+ ++ +   +      
Sbjct: 116 KVNTQAYEPYKAGAITREEAFTRAQEPMKEFMLKQTEKKSLDLFLSISKTEVPDVSGGPE 175

Query: 165 DHIEYR--ILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLP 222
            +++    +L+PSF++SEL ++F +GFLI +PFLIID++V++ +M+MGM+MLPPT I+LP
Sbjct: 176 GYMKLGLTVLVPSFILSELNKAFTMGFLIYIPFLIIDLVVSSTLMSMGMVMLPPTMIALP 235

Query: 223 FKVIFFVLIDGWSLLVENLVKSF 245
           FK++ FVL+DGWSL+++ LV  F
Sbjct: 236 FKIMMFVLVDGWSLVIKTLVTGF 258


>gi|119775422|ref|YP_928162.1| flagellar biosynthesis protein FliP [Shewanella amazonensis SB2B]
 gi|119767922|gb|ABM00493.1| flagellar biosynthetic protein FliP [Shewanella amazonensis SB2B]
          Length = 249

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 131/201 (65%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T LS  P ++IM+T F R I+  S+LR  +G+   P N V+I L+LFMTF++M+P  D
Sbjct: 51  LMTALSFLPAMVIMLTSFTRIIVTLSLLRQAIGLQQAPSNQVLIGLSLFMTFFIMAPVFD 110

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  E G++P M   +    A +R  EP   FM +  R  DL  F+++A   +    I   
Sbjct: 111 KIYEQGVKPYMEETLPIDQAFERGKEPLKAFMLSQVRITDLETFVNIAGYDN----IKSP 166

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           +     ++IP+F+ SEL+ +F+IGF++ +PFL+ID++VA+I+MAMGMMML P  +SLPFK
Sbjct: 167 EEAPMTVIIPAFITSELKTAFQIGFMLFVPFLVIDLVVASILMAMGMMMLSPMIVSLPFK 226

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGWSL++  L  SF
Sbjct: 227 IMLFVLVDGWSLVMGTLANSF 247


>gi|254519408|ref|ZP_05131464.1| flagellar biosynthetic protein FliP [Clostridium sp. 7_2_43FAA]
 gi|226913157|gb|EEH98358.1| flagellar biosynthetic protein FliP [Clostridium sp. 7_2_43FAA]
          Length = 257

 Score =  175 bits (443), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 86/193 (44%), Positives = 133/193 (68%), Gaps = 3/193 (1%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P ++IM+T F R I+VFS L++ +G     PN ++I LALF+T ++M P          +
Sbjct: 66  PSIIIMMTSFTRIIVVFSFLKSALGAQQSIPNQILIGLALFLTIFIMQPVYSEINNNAFK 125

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P M N IT+  A++  ++P   FM   TR+KDL LF++   S     +IT+ D+I   ++
Sbjct: 126 PFMENTITQDEAMEAGSKPLREFMLKQTRQKDLELFIE--TSKLDKEEITR-DNIPLTVV 182

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           IP+F ISEL+ +F+IGFL+ LPFLIIDM+VA+++M+MGM M+PP  ++LPFK++ FV++D
Sbjct: 183 IPAFAISELKTAFQIGFLLFLPFLIIDMVVASVLMSMGMFMVPPVMVALPFKLLLFVMVD 242

Query: 233 GWSLLVENLVKSF 245
           GW L+V++L+ SF
Sbjct: 243 GWYLMVKSLIMSF 255


>gi|146277690|ref|YP_001167849.1| flagellar biosynthesis protein FliP [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555931|gb|ABP70544.1| flagellar biosynthetic protein FliP [Rhodobacter sphaeroides ATCC
           17025]
          Length = 246

 Score =  175 bits (443), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 86/206 (41%), Positives = 133/206 (64%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T L++ P L++ ++ F R IIV SILR  +G    PPN V+I+LALF+TF+VM
Sbjct: 42  LQILALMTALTVLPSLVLGMSAFTRIIIVLSILRQALGTQQTPPNQVLIALALFLTFFVM 101

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PTL       + P ++ ++    AI+R       F+  NTR+ DL +F D+A +     
Sbjct: 102 QPTLGTLYAEALSPFLDGRLAAEPAIERGGAIMKEFLIANTRQNDLLMFSDLAGAGPYE- 160

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                  + +  L+P+FM SEL+ +F+IGFL+ LPFL+IDM++A+I+MA+GMMML P  +
Sbjct: 161 ---DPRDVPFSTLLPAFMTSELKTAFQIGFLLFLPFLVIDMVIASILMALGMMMLSPMLV 217

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L V +L  ++
Sbjct: 218 SLPFKLLLFVLVDGWALTVGSLAATY 243


>gi|157376188|ref|YP_001474788.1| flagellar biosynthesis protein FliP [Shewanella sediminis HAW-EB3]
 gi|157318562|gb|ABV37660.1| Triacylglycerol lipase [Shewanella sediminis HAW-EB3]
          Length = 248

 Score =  175 bits (443), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 148/245 (60%), Gaps = 8/245 (3%)

Query: 4   YCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIF---TILSIAPILLIMVT 60
           +  F+L L++PE  F++  +   + +       T    T  I    T LS  P ++IM+T
Sbjct: 7   FIAFSLLLISPE-AFSQGGVLPAVTVTTGPQGETQYSVTMQILLLMTSLSFLPAMVIMLT 65

Query: 61  CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT 120
            F R I+V SILR  +G+   P N V+I ++LF+TF++MSP  D+  +  ++P M   + 
Sbjct: 66  SFTRIIVVLSILRQAIGLQQAPSNQVLIGMSLFLTFFIMSPVFDKVYDDAVKPYMEESMG 125

Query: 121 ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE 180
              A  +  EP   FM   TR  DL  F+ +  S ++N  I   +     ++IPSF+ SE
Sbjct: 126 IEEAFNKGKEPIKTFMLAQTRVTDLDTFIQI--SGYQN--INSPEEAPMSVIIPSFITSE 181

Query: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVEN 240
           L+ +F+IGF++ +PFL++D++VA+I+MAMGMMML P  +SLPFK++ FVL+DGWSL++  
Sbjct: 182 LKTAFQIGFMLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFKIMLFVLVDGWSLVMGT 241

Query: 241 LVKSF 245
           L  SF
Sbjct: 242 LANSF 246


>gi|307293814|ref|ZP_07573658.1| flagellar biosynthetic protein FliP [Sphingobium chlorophenolicum
           L-1]
 gi|306879965|gb|EFN11182.1| flagellar biosynthetic protein FliP [Sphingobium chlorophenolicum
           L-1]
          Length = 273

 Score =  174 bits (442), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 131/199 (65%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           ++L++ P L++M+T F R IIV S+LR  +G+   PPN V++ L+LF++ +VM P +D+ 
Sbjct: 77  SLLTVLPSLILMMTSFTRIIIVLSLLRQALGLQQTPPNQVLVGLSLFLSLFVMRPAIDQI 136

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
                 P    QI    A+ R A+    FM   TRE DL LF ++A +    T       
Sbjct: 137 NAQAFDPYGKGQIPIEEAVGRSAKVLHGFMTKQTRETDLKLFQNLAEAPAFRTPA----D 192

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           I + IL+P+F+ SEL+ +F+IGF+I LPFLIID++VA+ +MA+GMMML PT IS+PFK++
Sbjct: 193 IPFSILLPAFVTSELKTAFQIGFMIFLPFLIIDLVVASTLMALGMMMLSPTIISMPFKLL 252

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW+L + +L  SF
Sbjct: 253 LFVLVDGWALTMGSLAGSF 271


>gi|15606937|ref|NP_214318.1| flagellar biosynthesis protein FliP [Aquifex aeolicus VF5]
 gi|6225367|sp|O67750|FLIP_AQUAE RecName: Full=Flagellar biosynthetic protein fliP
 gi|2984179|gb|AAC07711.1| flagellar biosynthetic protein FliP [Aquifex aeolicus VF5]
          Length = 239

 Score =  174 bits (442), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 140/207 (67%), Gaps = 4/207 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           +R     TILS+ P +LIM T F R ++V S+LR  +G    PPN VII+L+LF+TF++M
Sbjct: 35  IRLLIFLTILSLVPSILIMFTSFTRLVVVLSLLRQAIGTPQAPPNQVIIALSLFLTFFIM 94

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            PT+D+     +QP +  +I++    +RV      FM  +TR++ L  F+ +A       
Sbjct: 95  KPTIDKINSEALQPYIREEISDEEFFKRVEFYAKDFMLKHTRKETLEAFLSIAKIPK--- 151

Query: 160 DITKNDH-IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTS 218
           D  K  H I  R++IP+FM+SEL+ +FEI FL+ +PFLI+D++VA+I+++MG++M+PP  
Sbjct: 152 DSVKEPHEIPLRVVIPAFMVSELKTAFEIVFLLYIPFLIVDLVVASILISMGIIMIPPQL 211

Query: 219 ISLPFKVIFFVLIDGWSLLVENLVKSF 245
           ISLPFK++ FVL +GW L+V +LV+S+
Sbjct: 212 ISLPFKIMLFVLANGWELVVLSLVRSY 238


>gi|294013059|ref|YP_003546519.1| flagellar biosynthetic protein FliP [Sphingobium japonicum UT26S]
 gi|292676389|dbj|BAI97907.1| flagellar biosynthetic protein FliP [Sphingobium japonicum UT26S]
          Length = 288

 Score =  174 bits (442), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 87/199 (43%), Positives = 131/199 (65%), Gaps = 4/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           ++L++ P L++M+T F R IIV S+LR  +G+   PPN V++ L+LF++ +VM P +D+ 
Sbjct: 92  SLLTVLPSLILMMTSFTRIIIVLSLLRQALGLQQTPPNQVLVGLSLFLSLFVMRPAIDQI 151

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
                 P    QI+   A+ R  +    FM   TRE DL LF ++A +    T       
Sbjct: 152 NGQAFDPYGKGQISIEEAVGRSGKVLHGFMTKQTRETDLKLFQNLAEAPAFRTPA----D 207

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           I + IL+P+F+ SEL+ +F+IGF+I LPFLIID++VA+ +MA+GMMML PT IS+PFK++
Sbjct: 208 IPFSILLPAFVTSELKTAFQIGFMIFLPFLIIDLVVASTLMALGMMMLSPTIISMPFKLL 267

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FVL+DGW+L + +L  SF
Sbjct: 268 LFVLVDGWALTMGSLAGSF 286


>gi|294339800|emb|CAZ88163.1| Flagellar biosynthetic protein FliP [Thiomonas sp. 3As]
          Length = 255

 Score =  174 bits (441), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 145/207 (70%), Gaps = 4/207 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           V+T    T L   P +L+M+T F R IIV S+L+  +G  +VPP+ VI+ L+LF+TF+VM
Sbjct: 52  VQTLLFMTALVFLPAMLLMMTAFTRIIIVLSLLKQALGTTTVPPSQVIVGLSLFLTFFVM 111

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           SP L++  ++ I+PLM+NQIT   A+Q  A P   FM   TR++DL+LF+ +  S H+  
Sbjct: 112 SPVLNQVNDVAIKPLMDNQITMQQALQMGAAPLRTFMLGQTRQEDLALFVKL--SGHKAL 169

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           D  K       +L+P+F+ SEL+ +F+IGF+I +PFLIIDM+VA ++M+MGMMML P ++
Sbjct: 170 D--KPADTPMSLLVPAFVTSELKTAFQIGFVIFIPFLIIDMVVAAVLMSMGMMMLSPVTV 227

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSFI 246
           S P K++ FVL+ GW L++ +L++SFI
Sbjct: 228 SFPLKLMLFVLVGGWELVIGSLMQSFI 254


>gi|170725983|ref|YP_001760009.1| flagellar biosynthesis protein FliP [Shewanella woodyi ATCC 51908]
 gi|169811330|gb|ACA85914.1| flagellar biosynthetic protein FliP [Shewanella woodyi ATCC 51908]
          Length = 248

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 132/201 (65%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T LS  P +LIM+T F R IIV SILR  +G+   P N V+I +++F+TF++MSP  D
Sbjct: 50  LMTALSFLPAMLIMLTSFTRIIIVLSILRQAIGLQQTPSNQVLIGMSMFLTFFIMSPVFD 109

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +  +  ++P MN  +    A     EP   FM   TR  DL  F+++  S ++N  I   
Sbjct: 110 KVYDSAVKPYMNESMNIEQAFHVGKEPIKEFMLAQTRVTDLETFVEI--SGYQN--INSV 165

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           D     ++IP+F+ SEL+ +F+IGF++ +PFL++D++VA+I+MAMGMMML P  +SLPFK
Sbjct: 166 DEAPMSVIIPAFITSELKTAFQIGFMLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFK 225

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGWSL++  L  SF
Sbjct: 226 IMLFVLVDGWSLVMGTLANSF 246


>gi|323341374|ref|ZP_08081618.1| flagellar biosynthetic protein FliP [Lactobacillus ruminis ATCC
           25644]
 gi|323091251|gb|EFZ33879.1| flagellar biosynthetic protein FliP [Lactobacillus ruminis ATCC
           25644]
          Length = 268

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 106/255 (41%), Positives = 152/255 (59%), Gaps = 11/255 (4%)

Query: 1   MIRYCFFALFLVT---PELVFAKSSLHDVMNI------PADLSISTWIVRTFGIFTILSI 51
           ++ +   A FL+    P+ V A S+  DV N         D   S+ IV TF I T+LSI
Sbjct: 14  LVLFGMMACFLIAVRLPDHVAAVST-SDVTNTVNKLINGNDQGSSSKIVDTFVIMTLLSI 72

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
            P++LIM T F R I+V S +R+ +G    PPN V+I LALF+T + M P  +      I
Sbjct: 73  IPLILIMTTSFTRIIVVLSFVRSSLGTQQNPPNQVLIGLALFLTLFTMRPVYNDIYHNAI 132

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT-DITKNDHIEYR 170
           QP   N+IT+     R       FM     +KD+ LF D+   + R          I + 
Sbjct: 133 QPYNENKITQQEVFDRSENRMKEFMYKQANKKDVKLFKDLDQKNERKKIKYRTYKDIPFT 192

Query: 171 ILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVL 230
           ++ P+F++SEL+ +F IGFL+ +PF+IID++VA+I+M+MGM+ML P  ISLPFK++ FVL
Sbjct: 193 VMAPAFILSELKTAFSIGFLLFIPFMIIDLVVASILMSMGMIMLSPIMISLPFKILLFVL 252

Query: 231 IDGWSLLVENLVKSF 245
           +DGW LLVE+LV+SF
Sbjct: 253 VDGWYLLVESLVQSF 267


>gi|149200773|ref|ZP_01877748.1| Flagellar transport protein FliP [Roseovarius sp. TM1035]
 gi|149145106|gb|EDM33132.1| Flagellar transport protein FliP [Roseovarius sp. TM1035]
          Length = 246

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/206 (40%), Positives = 135/206 (65%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   + T L++ P L++ +T F R IIV SILR  MG    PPN V+I++ALF++F+VM
Sbjct: 41  LQILALMTALTVLPSLVLGMTAFTRIIIVLSILRQAMGTMQTPPNQVLIAIALFLSFFVM 100

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
            P L    +  + P ++ Q+    A++   +    FM  NTR+ DL +F ++A  +   +
Sbjct: 101 QPVLTEVYDTALSPYLDGQMAPDVAVRLAWDKLSGFMLANTRQNDLLMFAELAGDAPYAS 160

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           D      +   +L+P+++ SEL+ +F+IGFL+ LPFL+IDM++A+I+MA+GMMML P  +
Sbjct: 161 DA----EVPVAVLLPAYITSELKTAFQIGFLLFLPFLVIDMVIASILMALGMMMLSPMIV 216

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW+L + +L  SF
Sbjct: 217 SLPFKLLLFVLVDGWALTMGSLASSF 242


>gi|302874603|ref|YP_003843236.1| flagellar biosynthetic protein FliP [Clostridium cellulovorans
           743B]
 gi|307690786|ref|ZP_07633232.1| flagellar biosynthesis protein FliP [Clostridium cellulovorans
           743B]
 gi|302577460|gb|ADL51472.1| flagellar biosynthetic protein FliP [Clostridium cellulovorans
           743B]
          Length = 257

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 130/193 (67%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +L+ +T F R  IV S L+  +G    PP+ V+I L+LF+TF+VMSPT+ +     +Q
Sbjct: 68  PSILLTMTSFTRISIVLSFLKNAIGTQQTPPSQVLIGLSLFLTFFVMSPTISKVNTNALQ 127

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P +NNQI++  AI         FM   TR+KDL LF D+   +      TK + ++  ++
Sbjct: 128 PYLNNQISQQQAIDIGTTEMKTFMLKQTRKKDLKLFRDIRGVAEE----TKPEDLKMEVV 183

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           IPSF+ISEL+ +F IGF I +PFLIID +VA+++M+MGM M+ P  +S+PFK++ F+++D
Sbjct: 184 IPSFIISELKTAFTIGFFIYIPFLIIDFVVASVLMSMGMFMISPMMVSIPFKILLFIMVD 243

Query: 233 GWSLLVENLVKSF 245
           GW+L+V++LV SF
Sbjct: 244 GWNLIVKSLVLSF 256


>gi|255021382|ref|ZP_05293430.1| Flagellar biosynthesis protein fliP [Acidithiobacillus caldus ATCC
           51756]
 gi|254969245|gb|EET26759.1| Flagellar biosynthesis protein fliP [Acidithiobacillus caldus ATCC
           51756]
          Length = 223

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/207 (41%), Positives = 137/207 (66%), Gaps = 4/207 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T    T+L   P LL+M+T F R IIV S+L+  +G   +PP+ V++ LALF+TF+VM
Sbjct: 20  IQTLLFMTVLVFLPALLLMMTAFTRIIIVLSLLKQALGSTQMPPSQVMVGLALFLTFFVM 79

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +P   +     +QPL +N+I    A+ +   P   FM + TR  DL+LF+ +  S H+  
Sbjct: 80  APVFQQINTEALQPLNDNKIDLVQAMAKAEGPLRNFMLSQTRPDDLALFVKL--SGHKAL 137

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
           +  K       +L+P+F+ SEL+  F+IGFLI +PF+IID++VA ++M++GMMML P ++
Sbjct: 138 E--KPSDTPLSLLVPAFITSELKTGFQIGFLIFIPFVIIDLVVAAVLMSLGMMMLSPVTV 195

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSFI 246
           S P K++ FVL+DGW L++ +LV+SF+
Sbjct: 196 SFPLKLMLFVLVDGWDLVIGSLVQSFV 222


>gi|172057873|ref|YP_001814333.1| flagellar biosynthetic protein FliP [Exiguobacterium sibiricum
           255-15]
 gi|171990394|gb|ACB61316.1| flagellar biosynthetic protein FliP [Exiguobacterium sibiricum
           255-15]
          Length = 222

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 127/193 (65%), Gaps = 4/193 (2%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP LLI++TCF R I+V S +R+ +G    PPN +++ LALF+T +VM+P L       +
Sbjct: 32  APSLLILMTCFTRVIVVLSFVRSALGTQQTPPNQLLVGLALFITLFVMAPVLTELNTTAL 91

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
           QP M+ +I++  A  +       FM   TR  DL LF+   +         K + I    
Sbjct: 92  QPYMDEKISQDEAFDQAGGTMKRFMSQYTRSNDLELFLKYGNYEKPE----KVEDIPLVA 147

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+P++ ISEL+ +F+IGF+I +PFL+IDM+V++++M+MGMMMLPP  I+LPFK++ F+L+
Sbjct: 148 LVPAYAISELKTAFQIGFMIFIPFLVIDMVVSSVLMSMGMMMLPPVMIALPFKLLLFILV 207

Query: 232 DGWSLLVENLVKS 244
           DGW L+VE+L+ S
Sbjct: 208 DGWHLIVESLLVS 220


>gi|83589638|ref|YP_429647.1| flagellar biosynthesis protein FliP [Moorella thermoacetica ATCC
           39073]
 gi|83572552|gb|ABC19104.1| flagellar biosynthetic protein FliP [Moorella thermoacetica ATCC
           39073]
          Length = 317

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 127/186 (68%), Gaps = 4/186 (2%)

Query: 60  TCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQI 119
           T F R I+V S +R+ +     PPN ++I LALF+TF++M+P  ++     I P +  +I
Sbjct: 136 TSFTRIIVVLSFVRSALATQQTPPNQILIGLALFLTFFIMAPVYNQVKTQAIDPYLAGRI 195

Query: 120 TETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMIS 179
           T+  A+   A P   FM   TREKDL+LF+ M+  +   T     D +   +LIP+F+IS
Sbjct: 196 TQEQALAAGARPVREFMYRQTREKDLALFVHMSGMAQPRT----RDDVPLHVLIPAFIIS 251

Query: 180 ELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVE 239
           EL+ +F++GFLI +PFLIID+++A+ +MAMGM M+PP  ISLPFK++ FVL+DGW L+V+
Sbjct: 252 ELKTAFQMGFLIYIPFLIIDLVIASTLMAMGMFMVPPVMISLPFKLMLFVLVDGWYLVVK 311

Query: 240 NLVKSF 245
           +L++SF
Sbjct: 312 SLLESF 317


>gi|114562370|ref|YP_749883.1| flagellar biosynthesis protein FliP [Shewanella frigidimarina NCIMB
           400]
 gi|114333663|gb|ABI71045.1| flagellar biosynthetic protein FliP [Shewanella frigidimarina NCIMB
           400]
          Length = 253

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 132/201 (65%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T +S  P ++IM+T F R I+V SILR  +G+   P N V+I ++LFMTF++M+P  D
Sbjct: 55  LMTAMSFIPAMVIMLTSFTRIIVVLSILRQALGLQQTPSNQVLIGISLFMTFFIMAPVFD 114

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +     ++P +N  +T T A     EP   FM +  R  DL  F+++  S ++  DI   
Sbjct: 115 KIYAEAVEPYINETMTLTQAYDVGKEPIKTFMLSQVRTTDLQTFIEI--SGYK--DIQSP 170

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
           +     ++IP+F+ SEL+ +F+IGF++ +PFL++D++VA+I+MAMGMMML P  +SLPFK
Sbjct: 171 EQAPMSVVIPAFITSELKTAFQIGFMLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFK 230

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW L++  L  SF
Sbjct: 231 IMLFVLVDGWGLVMGTLANSF 251


>gi|332305669|ref|YP_004433520.1| flagellar biosynthetic protein FliP [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172998|gb|AEE22252.1| flagellar biosynthetic protein FliP [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 251

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 134/209 (64%), Gaps = 3/209 (1%)

Query: 37  TWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTF 96
           T  ++   I T LS+ P  ++M+T F R IIV SILR  +G+   P N ++I ++LF++ 
Sbjct: 42  TMTLQVVAIMTALSLLPAFIMMMTSFTRIIIVLSILRQAIGLQQSPSNQILIGVSLFLSM 101

Query: 97  YVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSH 156
           ++M+P  ++  E  +QP +N QIT   A +   EP   FM   TR KDL  F+++     
Sbjct: 102 FIMAPVFEKINETALQPYLNEQITSIQAYELAKEPLRGFMLAQTRVKDLETFVEIGGYED 161

Query: 157 RNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPP 216
           +     +   +   ILIP+F+ SEL+ +F+IGF++ +PFLI+D++VA+I+MAMGMMML P
Sbjct: 162 Q---FQEPADVPMNILIPAFVTSELKTAFQIGFMLFIPFLILDLVVASILMAMGMMMLSP 218

Query: 217 TSISLPFKVIFFVLIDGWSLLVENLVKSF 245
             +SLPFK++ FVL+DGW+L+   L  SF
Sbjct: 219 MIVSLPFKLMLFVLVDGWNLIFGTLANSF 247


>gi|220934504|ref|YP_002513403.1| flagellar biosynthetic protein FliP [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995814|gb|ACL72416.1| flagellar biosynthetic protein FliP [Thioalkalivibrio sp. HL-EbGR7]
          Length = 247

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 129/193 (66%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P  LIM+T F R IIV +ILR G+G    P N ++I LALF+T +VM+P  DR     IQ
Sbjct: 57  PSALIMMTSFTRIIIVLAILRQGLGTTQTPSNQILIGLALFLTLFVMTPVFDRIHVEAIQ 116

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P M   ++   A+Q  ++P   FM   TRE DL++F   A  S R    +  D + + +L
Sbjct: 117 PYMEESLSMEEAVQTASQPIRQFMLAQTRESDLAMF---ARISGREGFESPED-VPFTLL 172

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           + SF+ SEL+ +F+IGF++++PFLIID++VA+++M+MGM+ML P  ISLPFK++ FVL+D
Sbjct: 173 MASFLTSELKTAFQIGFMLLIPFLIIDLVVASVLMSMGMVMLSPLIISLPFKIMLFVLVD 232

Query: 233 GWSLLVENLVKSF 245
           GW+L++  L  SF
Sbjct: 233 GWALIMGTLAASF 245


>gi|188586035|ref|YP_001917580.1| flagellar biosynthetic protein FliP [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350722|gb|ACB84992.1| flagellar biosynthetic protein FliP [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 255

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 127/193 (65%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P LLI+ T F R +IV S +R  +    +PPN V+I LALF+TF++MSP      +   +
Sbjct: 66  PALLILTTSFTRVVIVLSFIRNALATQQMPPNQVLIGLALFLTFFIMSPVWGDVYQEAWE 125

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P     IT+  AI+   EP   FM   TRE DL+LF++ +   +  T     + +   ++
Sbjct: 126 PYREGDITQEEAIENGLEPVREFMYQQTREDDLALFVEYSDIENPAT----IEDVPTHVI 181

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           IP+F+ISEL+ +F+IGF+I +PFLIIDMIVA+ +M+MGM+MLPP  ISLPFKV+ FVL+D
Sbjct: 182 IPAFVISELKTAFQIGFMIFVPFLIIDMIVASTLMSMGMLMLPPVMISLPFKVLLFVLVD 241

Query: 233 GWSLLVENLVKSF 245
           GW L+  +L+ SF
Sbjct: 242 GWFLITRSLLISF 254


>gi|304321125|ref|YP_003854768.1| flagellar biosynthetic protein FliP [Parvularcula bermudensis
           HTCC2503]
 gi|303300027|gb|ADM09626.1| flagellar biosynthetic protein FliP [Parvularcula bermudensis
           HTCC2503]
          Length = 246

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/194 (41%), Positives = 125/194 (64%), Gaps = 3/194 (1%)

Query: 52  APILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGI 111
           AP +L+M+TC P  +IVFS LR  +G+   PP+++I++LALF+TF+VM P   ++ E GI
Sbjct: 54  APGILMMITCLPLMVIVFSFLRQALGIPQSPPSMMIMALALFLTFFVMEPVFQQAWEAGI 113

Query: 112 QPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRI 171
            P    +I E TA +    PF VFM     +  ++    ++ S     D    + +   +
Sbjct: 114 APYQEGEIDEQTAFREAIAPFRVFMEARVHDSTIA---ALSESLPERWDEDVMETVPLSL 170

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           L+PSFM+SE++ +F+IGF + LPFL ID++ A ++MAMGMMM+PP  +SLPFK+ FFV+ 
Sbjct: 171 LVPSFMLSEIKTAFQIGFAVFLPFLAIDLVTAAVLMAMGMMMVPPAVVSLPFKLAFFVMA 230

Query: 232 DGWSLLVENLVKSF 245
           DGW+ L   L++ +
Sbjct: 231 DGWTKLSAALLRGY 244


>gi|114320138|ref|YP_741821.1| flagellar biosynthesis protein FliP [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226532|gb|ABI56331.1| flagellar biosynthetic protein FliP [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 250

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 121/188 (64%), Gaps = 4/188 (2%)

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           M+T F R IIV +ILR  MG  S P N V+I LALF+T +VM+P      +  + P +  
Sbjct: 65  MMTSFTRIIIVLAILRQAMGTASTPSNQVLIGLALFLTLFVMAPVFQEVHDTALAPYLAE 124

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
           ++    A++  +EP   FM   TRE DL LF+ +A        +   D + + +L+P+FM
Sbjct: 125 EMAPDEALEAASEPMRGFMIAQTRESDLGLFLRIAGYDQ----VDSPDDVPFTVLVPAFM 180

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
            SEL+ +F IGF+I LPFL+ID++VA+ +M+MGM+ML P  ISLPFK++ FVL+DGWSLL
Sbjct: 181 TSELKTAFTIGFIIYLPFLVIDLVVASTLMSMGMLMLSPMIISLPFKILLFVLVDGWSLL 240

Query: 238 VENLVKSF 245
           +  L  SF
Sbjct: 241 MGTLASSF 248


>gi|163750540|ref|ZP_02157778.1| flagellar biosynthesis protein [Shewanella benthica KT99]
 gi|161329695|gb|EDQ00684.1| flagellar biosynthesis protein [Shewanella benthica KT99]
          Length = 248

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 96/248 (38%), Positives = 148/248 (59%), Gaps = 9/248 (3%)

Query: 2   IRYCF-FALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIF---TILSIAPILLI 57
           + YCF  +L L++P   FA   +   + +       T    T  I    T +S  P ++I
Sbjct: 4   LSYCFILSLLLISPG-AFALDGVLPALIVTTTADGGTQYSVTMQILLLMTAMSFLPAMII 62

Query: 58  MVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNN 117
           M+T F R I+V SILR  +G+   P N V+I +++FMTF++M+P  D+     +QP +  
Sbjct: 63  MLTSFTRIIVVLSILRQAIGLQQTPSNQVLIGISMFMTFFIMAPVFDKIYAEAVQPYIAE 122

Query: 118 QITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFM 177
            +    A     EP   FM   TR  DL  F+++  S ++N  I   + +   +LIPSF+
Sbjct: 123 TMNIEQAFNIGKEPIKTFMLAQTRVTDLDTFIEI--SGYQN--INSPEDVPMSVLIPSFI 178

Query: 178 ISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLL 237
            SEL+ +F+IGF++ +PFL++D++VA+I+MAMGMMML P  +SLPFK++ FVL+DGWSL+
Sbjct: 179 TSELKTAFQIGFMLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFKIMLFVLVDGWSLV 238

Query: 238 VENLVKSF 245
           +  L  SF
Sbjct: 239 MGTLANSF 246


>gi|163781853|ref|ZP_02176853.1| flagellar biosynthetic protein FliP [Hydrogenivirga sp. 128-5-R1-1]
 gi|159883073|gb|EDP76577.1| flagellar biosynthetic protein FliP [Hydrogenivirga sp. 128-5-R1-1]
          Length = 225

 Score =  171 bits (434), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 87/194 (44%), Positives = 128/194 (65%), Gaps = 1/194 (0%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +LIM T F R ++V S+LR  +G+  VPPN VI+SLALF+TF++M P  +      +Q
Sbjct: 31  PSILIMTTSFIRIVVVLSVLRQALGVPQVPPNQVIVSLALFLTFFIMKPVFENINTNALQ 90

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAH-SSHRNTDITKNDHIEYRI 171
           P M  QI++     RV      FM   TR+  + +FM++A         I K   I   I
Sbjct: 91  PYMKEQISDQEFFNRVTGSLKGFMLKQTRKDTVEVFMEVAKLKKEEREKIRKPSDIPLSI 150

Query: 172 LIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLI 231
           LIP+FM+SEL  +FEI FL+ +PFLI+D++VA+I+++MG++M+PP  ISLPFK++ FVL 
Sbjct: 151 LIPAFMVSELTTAFEIVFLLYIPFLIVDIVVASILISMGIIMIPPQIISLPFKIMLFVLA 210

Query: 232 DGWSLLVENLVKSF 245
           +GW L+V +LV+S+
Sbjct: 211 NGWELVVLSLVRSY 224


>gi|332533116|ref|ZP_08408985.1| flagellar biosynthetic protein FliP [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037398|gb|EGI73852.1| flagellar biosynthetic protein FliP [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 246

 Score =  171 bits (434), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 130/206 (63%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   I T LS  P  +IM+T F R I+V +ILR  +G+   P N V++ ++LF++ ++M
Sbjct: 41  LQVLAIMTALSFIPAAIIMMTSFTRIIVVLAILRQAIGLQQTPSNQVLLGMSLFLSIFIM 100

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +P   +  E  I+P +N Q+T   A++   EP   FM +  R KDL  F  +A     N+
Sbjct: 101 APIYQQVNERAIEPYLNEQVTSVEALELAKEPMKAFMLSQVRLKDLETFAKIAGYDQLNS 160

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                      +LIP+F+ SEL+ +F IGF+  +PFLI+D++VA+++MAMGMMML P  +
Sbjct: 161 P----QDTPLIVLIPAFVTSELQTAFIIGFMFFIPFLIVDLVVASVLMAMGMMMLSPMIV 216

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGWSL++  L KSF
Sbjct: 217 SLPFKIMLFVLVDGWSLVMGTLAKSF 242


>gi|307546958|ref|YP_003899437.1| flagellar biosynthesis protein FliP [Halomonas elongata DSM 2581]
 gi|307218982|emb|CBV44252.1| flagellar biosynthesis protein FliP [Halomonas elongata DSM 2581]
          Length = 273

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 126/193 (65%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P  L+M+T F R IIV S+LRT MG  + PPN V++ LALF+TF++M+P           
Sbjct: 83  PAALLMMTSFTRIIIVLSLLRTAMGTQATPPNQVLLGLALFLTFFIMAPVFGEVHAQAWV 142

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           PL N  I     +++   P   FM   TRE DL+LF  +A       ++     +  RIL
Sbjct: 143 PLSNGDINFPEFLRQAQGPLREFMMAQTREPDLALFARLADIG----ELQGPADVPMRIL 198

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +PSF+ SEL+ +F+IGF I +PFLIID++VA+ +M++GMMM+PP +ISLPFK++ FVL+D
Sbjct: 199 VPSFVTSELKTAFQIGFTIFIPFLIIDLVVASTLMSLGMMMVPPITISLPFKLMLFVLVD 258

Query: 233 GWSLLVENLVKSF 245
           GW LL+ +L +SF
Sbjct: 259 GWQLLIGSLAESF 271


>gi|322833206|ref|YP_004213233.1| flagellar biosynthetic protein FliP [Rahnella sp. Y9602]
 gi|321168407|gb|ADW74106.1| flagellar biosynthetic protein FliP [Rahnella sp. Y9602]
          Length = 260

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 138/206 (66%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++T    T L++ P +L+M T F R IIV  +LR  +G  S PPN V++ L LF+TF+VM
Sbjct: 57  IQTLVFITTLTLLPAMLLMCTSFTRIIIVLGLLRNALGTPSAPPNQVLLGLGLFLTFFVM 116

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +P  D+      QP   N+IT   A+ + A+P   FM   TRE DL+L+  +A+      
Sbjct: 117 APVFDKIYSDAYQPFSENKITMQEAMDKGAQPLRQFMLRQTRESDLALYARLANIP---- 172

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
            +   + +  RIL+P+++ SEL+ +F+IGF + +PF+IID++VA+++MA+GMMM+PP +I
Sbjct: 173 PLAGPEAVPMRILLPAYVTSELKTAFQIGFTVFIPFMIIDLVVASVLMALGMMMVPPATI 232

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 233 SLPFKLMLFVLVDGWQLLLGSLAQSF 258


>gi|226944502|ref|YP_002799575.1| flagellar biosynthetic protein [Azotobacter vinelandii DJ]
 gi|226719429|gb|ACO78600.1| flagellar biosynthetic protein [Azotobacter vinelandii DJ]
          Length = 252

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 135/193 (69%), Gaps = 4/193 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P LL+M+T F R IIV  +LRT +G  + PPN V++ LALF+T ++MSP LDR+ +    
Sbjct: 62  PALLLMMTAFTRIIIVLGLLRTAIGTPAAPPNQVLLGLALFLTLFIMSPVLDRTYQSAWL 121

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P   ++I     ++  ++PF  FM   TRE DL+LF  +A    R  ++   + +  R+L
Sbjct: 122 PFSRDEIGFEQFLETGSQPFREFMLAQTRESDLALFARLA----RLGELEGPEQVPLRVL 177

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +P+F+ SEL+ +F+IGF I +PFLIID++VA+++MA+GMMM+PP +ISLPFK++ FVL+D
Sbjct: 178 MPAFVTSELKTAFQIGFTIFIPFLIIDLVVASVLMALGMMMVPPATISLPFKLMLFVLVD 237

Query: 233 GWSLLVENLVKSF 245
           GW LL+ +L +SF
Sbjct: 238 GWQLLIGSLAQSF 250


>gi|220913717|ref|YP_002489026.1| flagellar biosynthetic protein FliP [Arthrobacter chlorophenolicus
           A6]
 gi|219860595|gb|ACL40937.1| flagellar biosynthetic protein FliP [Arthrobacter chlorophenolicus
           A6]
          Length = 262

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 136/214 (63%), Gaps = 5/214 (2%)

Query: 32  DLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLA 91
           D   ST +V   GI T+LS+AP LL+M+T F +  +V ++ R  + + S+PPN V+  LA
Sbjct: 53  DGQPSTAVVTLIGI-TLLSVAPALLLMMTSFTKIFVVLAMTRNALSLPSIPPNQVLAGLA 111

Query: 92  LFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDM 151
           LF++ +VM P L       +QP +N  +    A    A P   FM  +TRE+D++L    
Sbjct: 112 LFLSLFVMWPVLTEINTDAVQPYLNGNLDFNGAFSAGAGPLQQFMLGHTREEDIALMTRA 171

Query: 152 AHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGM 211
           A    R  +      +  + LIP+FMISELR +F IGF+I +PFL+ID++V+  +M+MGM
Sbjct: 172 A----RMPNPENPGAVPLQTLIPAFMISELRAAFIIGFVIFIPFLVIDLVVSAALMSMGM 227

Query: 212 MMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           MMLPP  ISLPFK++ F+L+DGW L++ +L++S+
Sbjct: 228 MMLPPVMISLPFKILLFILVDGWGLVITSLIQSY 261


>gi|291562035|emb|CBL40851.1| flagellar biosynthetic protein FliP [butyrate-producing bacterium
           SS3/4]
          Length = 218

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 83/203 (40%), Positives = 132/203 (65%), Gaps = 8/203 (3%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + T  ++ P +++M++ F R II+ S  R  MG+   PPN+V+  +ALF++ Y+MSP + 
Sbjct: 21  LLTFAALLPSIVVMMSSFMRIIIILSFTRNAMGVQQTPPNMVLTGMALFLSLYIMSPVIG 80

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +   +  +P  N +IT+  A+ R+A+P   FM  NT +  L  F+ M+          K 
Sbjct: 81  QINTVAYEPYKNGEITQQEAVSRMADPLKQFMLRNTEKDTLDHFVQMSKQE------VKK 134

Query: 165 DHIEY--RILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLP 222
           D  EY   +++P+FM SEL++ F  GFLI LPFL+ID++V+T +M+MGM+MLPPT +SLP
Sbjct: 135 DVKEYPLTVVVPAFMTSELKKGFLAGFLIYLPFLLIDIVVSTTLMSMGMVMLPPTMVSLP 194

Query: 223 FKVIFFVLIDGWSLLVENLVKSF 245
           FK++ F+ ++GW LL  +LV+SF
Sbjct: 195 FKLLLFITVNGWELLFSSLVQSF 217


>gi|148553144|ref|YP_001260726.1| flagellar biosynthesis protein FliP [Sphingomonas wittichii RW1]
 gi|148498334|gb|ABQ66588.1| flagellar biosynthetic protein FliP [Sphingomonas wittichii RW1]
          Length = 278

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 132/201 (65%), Gaps = 4/201 (1%)

Query: 45  IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104
           + ++L++ P L++M++ F R IIV S+LR  +G+   PPN V++ LA+F++ +VM P++D
Sbjct: 80  LMSLLTVLPSLVLMMSSFTRIIIVLSLLRQALGLQQTPPNQVLVGLAMFLSLFVMRPSID 139

Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164
           +      +P    QIT   AI R       FM   TR+ DL LF D+A +        + 
Sbjct: 140 QINADAFKPYGAGQITIEEAITRSGAVLHRFMVLQTRQTDLKLFADLAKAPK----FARP 195

Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224
             I + IL+P+F+ SEL+ +F+IGFLI LPFLIID++VA+ +M++GMMML P  IS+PFK
Sbjct: 196 ADIPFSILLPAFVTSELKTAFQIGFLIFLPFLIIDLVVASTLMSLGMMMLSPAIISMPFK 255

Query: 225 VIFFVLIDGWSLLVENLVKSF 245
           ++ FVL+DGW+L + +L  SF
Sbjct: 256 LLLFVLVDGWALTMGSLAASF 276


>gi|89895724|ref|YP_519211.1| flagellar biosynthesis protein FliP [Desulfitobacterium hafniense
           Y51]
 gi|89335172|dbj|BAE84767.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 236

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 106/235 (45%), Positives = 154/235 (65%), Gaps = 6/235 (2%)

Query: 11  LVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFS 70
           LV  + V A     D     A+ + ST  +    + T+LSIAP +L+++T F R IIV S
Sbjct: 7   LVNTDAVLAAGLTLDFGTTTAEQTSSTLQILL--LLTVLSIAPAILVLMTSFTRTIIVLS 64

Query: 71  ILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAE 130
            +R  +G   +PPN V+I L+LF+TF+VM+PT +      +QP M NQIT+  A+Q+   
Sbjct: 65  FVRNALGTQQLPPNQVLIGLSLFLTFFVMAPTWNEINTQALQPYMQNQITQAEALQQAEA 124

Query: 131 PFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGFL 190
           P   FM   TREKDL+LF+ +A      T       I   +LIP+F+ISEL+ +F++GF 
Sbjct: 125 PLRQFMFEQTREKDLTLFVGLARMEQPQT----YGDIPTYVLIPAFVISELKTAFQMGFA 180

Query: 191 IILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
           I +PF++IDM+VA+++M+MGMMMLPP  +SLPFK++ FVL+DGW L+V++LV SF
Sbjct: 181 IFIPFMVIDMLVASVLMSMGMMMLPPMMVSLPFKILLFVLVDGWHLVVQSLVTSF 235


>gi|53724243|ref|YP_104210.1| flagellar biosynthesis protein FliP [Burkholderia mallei ATCC
           23344]
 gi|67641568|ref|ZP_00440344.1| flagellar biosynthetic protein FliP [Burkholderia mallei GB8 horse
           4]
 gi|167001619|ref|ZP_02267413.1| flagellar biosynthetic protein FliP [Burkholderia mallei PRL-20]
 gi|254201283|ref|ZP_04907647.1| flagellar biosynthetic protein FliP [Burkholderia mallei FMH]
 gi|254206625|ref|ZP_04912976.1| flagellar biosynthetic protein FliP [Burkholderia mallei JHU]
 gi|254357358|ref|ZP_04973632.1| flagellar biosynthetic protein FliP [Burkholderia mallei
           2002721280]
 gi|52427666|gb|AAU48259.1| flagellar biosynthetic protein FliP, interruption-C [Burkholderia
           mallei ATCC 23344]
 gi|147747177|gb|EDK54253.1| flagellar biosynthetic protein FliP [Burkholderia mallei FMH]
 gi|147752167|gb|EDK59233.1| flagellar biosynthetic protein FliP [Burkholderia mallei JHU]
 gi|148026422|gb|EDK84507.1| flagellar biosynthetic protein FliP [Burkholderia mallei
           2002721280]
 gi|238522521|gb|EEP85965.1| flagellar biosynthetic protein FliP [Burkholderia mallei GB8 horse
           4]
 gi|243062629|gb|EES44815.1| flagellar biosynthetic protein FliP [Burkholderia mallei PRL-20]
          Length = 175

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 79/176 (44%), Positives = 118/176 (67%), Gaps = 4/176 (2%)

Query: 70  SILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVA 129
           S+LR  +G  S PPN V++ LALF+T +VMSP LDR+     +P     +    A+QR  
Sbjct: 3   SLLRQAIGTASTPPNQVLVGLALFLTLFVMSPVLDRAYNDAYKPFSEGTLQMDQAVQRGT 62

Query: 130 EPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRRSFEIGF 189
            PF  FM   TRE DL+LF  ++ ++     +   + +   +L+P+F+ SEL+  F+IGF
Sbjct: 63  APFKAFMLKQTRETDLALFAKISKAAP----MQGPEDVPLSLLVPAFVTSELKTGFQIGF 118

Query: 190 LIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVENLVKSF 245
            I +PFLIIDM+VA+++M+MGMMM+ P ++SLPFK++ FVL+DGW LL+ +L +SF
Sbjct: 119 TIFIPFLIIDMVVASVLMSMGMMMVSPATVSLPFKLMLFVLVDGWQLLIGSLAQSF 174


>gi|54294676|ref|YP_127091.1| flagellar biosynthesis protein FliP [Legionella pneumophila str.
           Lens]
 gi|53754508|emb|CAH15992.1| Flagellar biosynthetic protein FliP [Legionella pneumophila str.
           Lens]
          Length = 249

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 95/199 (47%), Positives = 137/199 (68%), Gaps = 5/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+L++ P LL+ +T F R IIV SILR  +GM   P N ++I +ALFMT++VMSP  ++ 
Sbjct: 53  TLLTVLPGLLMAMTSFTRIIIVLSILRQAIGMAQTPTNQILIGIALFMTYFVMSPVFNKI 112

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166
            E  IQP MN +I  + A+    +P   FM N TR+ DLSLF   AH+  +  D      
Sbjct: 113 NETAIQPYMNERIDFSLALSNAQKPLRQFMLNQTRKNDLSLFEKFAHNVPKTLD-----E 167

Query: 167 IEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVI 226
           I   +LIP+F+ SEL+ +F+IGF++ LPFLIID++V++++MAMGMMML P  ISLPFK++
Sbjct: 168 IPMSVLIPAFITSELKTAFQIGFILFLPFLIIDLVVSSLLMAMGMMMLSPLIISLPFKIM 227

Query: 227 FFVLIDGWSLLVENLVKSF 245
            FV++DGW+L++ +L  SF
Sbjct: 228 LFVMVDGWTLVLGSLASSF 246


>gi|119469996|ref|ZP_01612801.1| flagellar biosynthesis protein P [Alteromonadales bacterium TW-7]
 gi|119446706|gb|EAW27979.1| flagellar biosynthesis protein P [Alteromonadales bacterium TW-7]
          Length = 246

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 131/206 (63%), Gaps = 4/206 (1%)

Query: 40  VRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVM 99
           ++   I T LS  P  +IM+T F R I+V +ILR  +G+   P N V++ ++LF++ ++M
Sbjct: 41  LQVLAIMTALSFIPAAIIMMTSFTRIIVVLAILRQAIGLQQTPSNQVLLGMSLFLSIFIM 100

Query: 100 SPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNT 159
           +P   +  ++ I+P +N Q+T   A++   EP   FM +  R KDL  F  +A      +
Sbjct: 101 APIYQKVNDVAIEPYLNEQVTSVQALELAKEPMKAFMLSQVRLKDLETFAKIAGYDKLES 160

Query: 160 DITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSI 219
                +     +LIP+F+ SEL+ +F IGF+  +PFLI+D++VA+++MAMGMMML P  +
Sbjct: 161 P----EETPLIVLIPAFVTSELQTAFIIGFMFFIPFLIVDLVVASVLMAMGMMMLSPMIV 216

Query: 220 SLPFKVIFFVLIDGWSLLVENLVKSF 245
           SLPFK++ FVL+DGWSL++  L KSF
Sbjct: 217 SLPFKIMLFVLVDGWSLVMGTLAKSF 242


>gi|88858098|ref|ZP_01132740.1| flagellar biosynthesis [Pseudoalteromonas tunicata D2]
 gi|88819715|gb|EAR29528.1| flagellar biosynthesis [Pseudoalteromonas tunicata D2]
          Length = 247

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 151/251 (60%), Gaps = 14/251 (5%)

Query: 1   MIRYCFF-ALFLVTPELVFAKSSLHDV-----MNIPADLSISTWIVRTFGIFTILSIAPI 54
           MI++    ALF ++P L  A+  L  +      +   D S+S   ++   I T LS  P 
Sbjct: 1   MIKWIILIALFTLSPSLS-AEQGLQALTVTTNADGTQDYSVS---LQVLAIMTALSFIPA 56

Query: 55  LLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPL 114
            +IM+T F R I+V +ILR  +G+ S P N V++ +++FM+ ++M+P   +  E  I P 
Sbjct: 57  AVIMMTSFTRIIVVLAILRQAIGLQSTPSNQVLVGMSVFMSIFIMAPIYQQIHEAAIDPY 116

Query: 115 MNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIP 174
           +  ++T   A+++  +P   FM   TR  DL  F  +A     +    K +   + ++IP
Sbjct: 117 LKEELTSIQALEKAKDPLKTFMLRQTRISDLETFAQIAGLEKLD----KPEDAPFIVVIP 172

Query: 175 SFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGW 234
           +F+ SEL+ +F IGF+  +PFLI+D++VA+++MAMGMMML P  +SLPFK++ FVL+DGW
Sbjct: 173 AFITSELQTAFIIGFMFFIPFLIVDLVVASVLMAMGMMMLSPMIVSLPFKIMLFVLVDGW 232

Query: 235 SLLVENLVKSF 245
           SL++  L KSF
Sbjct: 233 SLVMGTLAKSF 243


>gi|254497497|ref|ZP_05110290.1| truncated flagellar biosynthesis protein FliP [Legionella
           drancourtii LLAP12]
 gi|254353312|gb|EET12054.1| truncated flagellar biosynthesis protein FliP [Legionella
           drancourtii LLAP12]
          Length = 189

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 129/191 (67%), Gaps = 5/191 (2%)

Query: 55  LLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPL 114
           +L+ +T F R IIV SILR  +G+   P N V+I +ALFMT++VM+PT ++  +  +QP 
Sbjct: 1   MLMAMTAFTRIIIVLSILRQAIGLAQAPTNQVLIGIALFMTYFVMAPTFNKINDTALQPY 60

Query: 115 MNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIP 174
           +   I    A+    EP   FM N TR+ DL+LF   A+    +     ND +   ++IP
Sbjct: 61  LAETIKFPQAMANAQEPLRDFMLNQTRKNDLALFEKFANKQPASL----ND-VPMSVIIP 115

Query: 175 SFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGW 234
           +F+ SEL+ +F+IGF++ LPFLIID++V++++MAMGMMML P  ISLPFK++ FV++DGW
Sbjct: 116 AFITSELKTAFQIGFILFLPFLIIDLVVSSVLMAMGMMMLSPLIISLPFKIMLFVMVDGW 175

Query: 235 SLLVENLVKSF 245
           +L++ +L  SF
Sbjct: 176 TLILGSLASSF 186


>gi|260752858|ref|YP_003225751.1| flagellar biosynthesis protein FliP [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258552221|gb|ACV75167.1| flagellar biosynthetic protein FliP [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 316

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 87/194 (44%), Positives = 122/194 (62%), Gaps = 4/194 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +++M+T F R IIV S+LR  +G+   PPN V+I LALF++ +VM P LD+       
Sbjct: 126 PSIILMMTSFTRIIIVLSLLRQAIGLQQTPPNQVLIGLALFLSLFVMRPVLDQINTTAFS 185

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P    +I    AI R       FM   TR+ DL LF D+AH    +      + I + +L
Sbjct: 186 PYGRGEIQIEEAIMRSGTALHGFMTKQTRKNDLQLFTDLAH----HPRYENAESIPFTVL 241

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +PSF+ SEL+ +FEIGFLI LPF+IID++VA  + A+GMMML P  IS PFK++ F+++D
Sbjct: 242 VPSFVTSELKTAFEIGFLIFLPFIIIDIVVACTLTALGMMMLSPQIISAPFKLLLFIMVD 301

Query: 233 GWSLLVENLVKSFI 246
           GW+L V +L  SFI
Sbjct: 302 GWALTVGSLAGSFI 315


>gi|241761180|ref|ZP_04759269.1| flagellar biosynthetic protein FliP [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241374799|gb|EER64260.1| flagellar biosynthetic protein FliP [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 316

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/194 (44%), Positives = 122/194 (62%), Gaps = 4/194 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +++M+T F R IIV S+LR  +G+   PPN V+I LALF++ +VM P LD+       
Sbjct: 126 PSIILMMTSFTRIIIVLSLLRQAIGLQQTPPNQVLIGLALFLSLFVMRPVLDQINTTAFS 185

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P    +I    AI R       FM   TR+ DL LF D+AH    +      + I + +L
Sbjct: 186 PYGRGEIQIEEAIMRSGTALHGFMTKQTRKNDLQLFTDLAH----HPRYENAESIPFTVL 241

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +PSF+ SEL+ +FEIGFLI LPF+IID++VA  + A+GMMML P  IS PFK++ F+++D
Sbjct: 242 VPSFVTSELKTAFEIGFLIFLPFIIIDIVVACTLTALGMMMLSPQIISAPFKLLLFIMVD 301

Query: 233 GWSLLVENLVKSFI 246
           GW+L V +L  SFI
Sbjct: 302 GWALTVGSLAGSFI 315


>gi|56551543|ref|YP_162382.1| flagellar biosynthesis protein FliP [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56543117|gb|AAV89271.1| flagellar biosynthetic protein FliP [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 316

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/194 (44%), Positives = 122/194 (62%), Gaps = 4/194 (2%)

Query: 53  PILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQ 112
           P +++M+T F R IIV S+LR  +G+   PPN V+I LALF++ +VM P LD+       
Sbjct: 126 PSIILMMTSFTRIIIVLSLLRQAIGLQQTPPNQVLIGLALFLSLFVMRPVLDQINTTAFS 185

Query: 113 PLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRIL 172
           P    +I    AI R       FM   TR+ DL LF D+AH    +      + I + +L
Sbjct: 186 PYGRGEIQIEEAIMRSGTALHGFMTKQTRKNDLQLFTDLAH----HPRYENAESIPFTVL 241

Query: 173 IPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLID 232
           +PSF+ SEL+ +FEIGFLI LPF+IID++VA  + A+GMMML P  IS PFK++ F+++D
Sbjct: 242 VPSFVTSELKTAFEIGFLIFLPFIIIDIVVACTLTALGMMMLSPQIISAPFKLLLFIMVD 301

Query: 233 GWSLLVENLVKSFI 246
           GW+L V +L  SFI
Sbjct: 302 GWALTVGSLAGSFI 315


>gi|109899342|ref|YP_662597.1| flagellar biosynthesis protein FliP [Pseudoalteromonas atlantica
           T6c]
 gi|109701623|gb|ABG41543.1| flagellar biosynthetic protein FliP [Pseudoalteromonas atlantica
           T6c]
          Length = 251

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 134/209 (64%), Gaps = 3/209 (1%)

Query: 37  TWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTF 96
           T  ++   I T LS+ P  ++M+T F R IIV SILR  +G+   P N ++I ++LF++ 
Sbjct: 42  TMTLQVVAIMTALSLLPAFIMMMTSFTRIIIVLSILRQAIGLQQSPSNQILIGVSLFLSM 101

Query: 97  YVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSH 156
           ++M+P  ++  E  +QP ++ QIT   A +   EP   FM   TR KDL  F+++     
Sbjct: 102 FIMAPVFEKINETALQPYLSEQITSIQAYELAKEPLRGFMLAQTRIKDLETFVEIGGYED 161

Query: 157 RNTDITKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPP 216
           +     +   +   +LIP+F+ SEL+ +F+IGF++ +PFLI+D++VA+I+MAMGMMML P
Sbjct: 162 Q---FQEPADVPMNVLIPAFVTSELKTAFQIGFMLFIPFLILDLVVASILMAMGMMMLSP 218

Query: 217 TSISLPFKVIFFVLIDGWSLLVENLVKSF 245
             +SLPFK++ FVL+DGW+L+   L  SF
Sbjct: 219 MIVSLPFKLMLFVLVDGWNLIFGTLANSF 247


>gi|54297702|ref|YP_124071.1| flagellar biosynthesis protein FliP [Legionella pneumophila str.
           Paris]
 gi|53751487|emb|CAH12905.1| Flagellar biosynthetic protein FliP [Legionella pneumophila str.
           Paris]
          Length = 249

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 95/199 (47%), Positives = 137/199 (68%), Gaps = 5/199 (2%)

Query: 47  TILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRS 106
           T+L++ P LL+ +T F R IIV SILR  +GM   P N ++I +ALFMT++VMSP  ++ 
Sbjct: 53  TLLTVLPGLLMAMTSFTRIIIVLSILRQAIGMAQTPTNQILIGIALFMTYFVMSPVFNKI 112

Query: 107 IEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDH 166