RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780372|ref|YP_003064785.1| flagellar biosynthesis protein FliP [Candidatus Liberibacter asiaticus str. psy62] (246 letters) >gnl|CDD|144419 pfam00813, FliP, FliP family. Length = 194 Score = 250 bits (641), Expect = 3e-67 Identities = 100/198 (50%), Positives = 142/198 (71%), Gaps = 4/198 (2%) Query: 45 IFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD 104 + T+LS+AP +LIM+T F R +IV S+LR +G PPN V+I LALF+T +VM+P Sbjct: 1 LLTVLSLAPAILIMMTSFTRIVIVLSLLRQALGTQQTPPNQVLIGLALFLTLFVMAPVFQ 60 Query: 105 RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKN 164 E +QP ++ +IT A+ R AEP FM TREKDL+LF+++A K Sbjct: 61 EIYEDALQPYLDGEITVEEALDRAAEPLREFMLKQTREKDLALFLELAK----EEWPAKP 116 Query: 165 DHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFK 224 + + +LIP+F++SEL+ +F+IGFLI LPFL+ID++VA+++MAMGMMMLPP +ISLPFK Sbjct: 117 EDVPLLVLIPAFVLSELKTAFQIGFLIYLPFLVIDLVVASVLMAMGMMMLPPVTISLPFK 176 Query: 225 VIFFVLIDGWSLLVENLV 242 ++ FVL+DGW+LLV +LV Sbjct: 177 LLLFVLVDGWTLLVGSLV 194 >gnl|CDD|31529 COG1338, FliP, Flagellar biosynthesis pathway, component FliP [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 248 Score = 231 bits (591), Expect = 1e-61 Identities = 114/245 (46%), Positives = 163/245 (66%), Gaps = 5/245 (2%) Query: 2 IRYCFFALFLVTPELVFAKSSLHDVMNI-PADLSISTWIVRTFGIFTILSIAPILLIMVT 60 L A+ S++ +N P D V+ + T+LS+AP +L+M+T Sbjct: 7 FLILICPLICPLMSADAAQPSVNLSLNTAPNDPKQLVTTVQLLALLTVLSLAPSILLMMT 66 Query: 61 CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT 120 F R IIVFS LRT +G PPN V+I LALF+TF++M+PT D+ + I+PL++ +I+ Sbjct: 67 SFTRIIIVFSFLRTALGTQQTPPNQVLIGLALFLTFFIMAPTFDKIYDDAIKPLLDEEIS 126 Query: 121 ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE 180 + A ++ AEP FM TREKDL+LFM +A+ + + R+LIP+FMISE Sbjct: 127 QQEAFEKAAEPLREFMLKQTREKDLALFMRIANLP----PPKTPEDVPLRVLIPAFMISE 182 Query: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVEN 240 L+ +F+IGFLI LPFL+ID++VA+++MAMGMMMLPP ISLPFK++ FVL+DGW+LLV + Sbjct: 183 LKTAFQIGFLIYLPFLVIDLVVASVLMAMGMMMLPPVMISLPFKLLLFVLVDGWNLLVGS 242 Query: 241 LVKSF 245 LV+SF Sbjct: 243 LVQSF 247 >gnl|CDD|34400 COG4790, EscR, Type III secretory pathway, component EscR [Intracellular trafficking and secretion]. Length = 214 Score = 149 bits (377), Expect = 8e-37 Identities = 77/204 (37%), Positives = 124/204 (60%), Gaps = 2/204 (0%) Query: 44 GIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPT- 102 + +LS+ P +++M T F +F +VFS+LR +G+ VPPN+ + +AL ++ +VM+P Sbjct: 9 AVLFLLSLLPFIVVMGTSFLKFSVVFSLLRNALGVQQVPPNMALYGVALILSMFVMAPVG 68 Query: 103 LDRSIEMGIQPLMNNQITETT-AIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDI 161 L + + L I + P+ F++ NT E+++S F A Sbjct: 69 LQIYDRLQNEELSYTNIASVVKFDDKGLSPYRDFLKKNTEEEEVSFFERSAQKKWPEEYA 128 Query: 162 TKNDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISL 221 K IL+P+F +SEL +F+IGFL+ LPF++ID+I++ I++A+GMMM+ P +ISL Sbjct: 129 EKLKPDSLFILLPAFTLSELTSAFKIGFLLYLPFIVIDLIISNILLALGMMMVSPVTISL 188 Query: 222 PFKVIFFVLIDGWSLLVENLVKSF 245 PFK++ FVL+DGWSLL LV S+ Sbjct: 189 PFKLLLFVLMDGWSLLSHGLVLSY 212 >gnl|CDD|145017 pfam01654, Bac_Ubq_Cox, Bacterial Cytochrome Ubiquinol Oxidase. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II. Length = 430 Score = 30.1 bits (69), Expect = 0.50 Identities = 10/31 (32%), Positives = 14/31 (45%) Query: 67 IVFSILRTGMGMGSVPPNLVIISLALFMTFY 97 V+ +LRT + V V+ SL F Y Sbjct: 379 TVYGLLRTADAVSPVSAGQVLFSLIGFTLLY 409 >gnl|CDD|36027 KOG0809, KOG0809, KOG0809, SNARE protein TLG2/Syntaxin 16 [Intracellular trafficking, secretion, and vesicular transport]. Length = 305 Score = 29.9 bits (67), Expect = 0.58 Identities = 8/40 (20%), Positives = 13/40 (32%) Query: 95 TFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWV 134 D IEM + + +T + + P WV Sbjct: 21 QPLGDRSGDDPVIEMATSLVNEAEEGKTVSDEDGLPPAWV 60 >gnl|CDD|112412 pfam03594, BenE, Benzoate membrane transport protein. Length = 378 Score = 29.6 bits (67), Expect = 0.76 Identities = 22/92 (23%), Positives = 39/92 (42%), Gaps = 6/92 (6%) Query: 3 RYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVTCF 62 RY A+ LV +H +P +L+ WI F LS+A + L +V Sbjct: 164 RYAVLAVLLVGVAAAALLGQVHPA-PLPLELARPQWITPEFSWQATLSLA-LPLYLVAMT 221 Query: 63 PRFIIVFSILRTGMGMG-SVPPNLVIISLALF 93 + + ++L+ G PP+ +I++ L Sbjct: 222 SQNLPGIAVLKAA---GYQTPPSPLIVATGLA 250 >gnl|CDD|34564 COG4956, COG4956, Integral membrane protein (PIN domain superfamily) [General function prediction only]. Length = 356 Score = 26.7 bits (59), Expect = 5.5 Identities = 30/152 (19%), Positives = 57/152 (37%), Gaps = 26/152 (17%) Query: 31 ADLSISTWIVRTFGIFTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISL 90 L ++T + T G+ L IA +L P F++ + T ++ + L Sbjct: 74 RKLPVTTILFGTIGLIIGLLIAVLLS-----SPLFLLPIPFIST----------IIPVIL 118 Query: 91 ALFMTFYVMSPTLDRSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMD 150 + + ++ + E L+N E + E + D S+ +D Sbjct: 119 TIILAYFGFQLADKKRDEFLR--LLNPNRREAMKKEEEGE----VKPKKPKILDTSVIID 172 Query: 151 MAHSSHRNTDITKNDHIEYRILIPSFMISELR 182 R DI + +E I+IP F++ EL+ Sbjct: 173 -----GRIADILQTGFLEGTIIIPQFVLLELQ 199 >gnl|CDD|31462 COG1271, CydA, Cytochrome bd-type quinol oxidase, subunit 1 [Energy production and conversion]. Length = 457 Score = 26.7 bits (59), Expect = 6.5 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 2/69 (2%) Query: 32 DLSISTWIVRTFGIFTILSIAPILL-IMVTCFPRFI-IVFSILRTGMGMGSVPPNLVIIS 89 + S W+++ + L I +VT R +V+ +L+T + +V V+ S Sbjct: 354 RIDQSKWLLKALILAIPLPWIAIEAGWIVTEVGRQPWVVYGVLKTDVVSSAVTAGSVLFS 413 Query: 90 LALFMTFYV 98 L LFM Y Sbjct: 414 LILFMVLYT 422 >gnl|CDD|177096 CHL00204, ycf1, Ycf1; Provisional. Length = 1832 Score = 26.2 bits (58), Expect = 8.4 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Query: 161 ITKNDHIEYRILIPS--FMISELRRSFEIGFLIIL 193 I +N+ I +LI S +++SELR S F I+L Sbjct: 188 IQQNNSIRSNVLIRSNKYLVSELRNSMARIFSILL 222 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.333 0.144 0.432 Gapped Lambda K H 0.267 0.0746 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,111,282 Number of extensions: 174039 Number of successful extensions: 989 Number of sequences better than 10.0: 1 Number of HSP's gapped: 977 Number of HSP's successfully gapped: 88 Length of query: 246 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 155 Effective length of database: 4,297,318 Effective search space: 666084290 Effective search space used: 666084290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 56 (25.3 bits)