RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780372|ref|YP_003064785.1| flagellar biosynthesis protein FliP [Candidatus Liberibacter asiaticus str. psy62] (246 letters) >3ix7_A Uncharacterized protein TTHA0540; unknown function, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.15A {Thermus thermophilus HB8} (A:) Length = 134 Score = 28.3 bits (63), Expect = 0.94 Identities = 9/40 (22%), Positives = 19/40 (47%), Gaps = 5/40 (12%) Query: 144 DLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISELRR 183 D S+ +D R ++ +E + +P F++ EL+ Sbjct: 11 DTSVLVD-----GRVAEVAAVGFLEGPLWVPHFVLKELQH 45 >1x87_A Urocanase protein; structural genomics, protein structure initiative, MCSG, PSI, midwest center for structural genomics; HET: MSE NAD; 2.40A {Geobacillus stearothermophilus} (A:122-342) Length = 221 Score = 27.4 bits (61), Expect = 2.0 Identities = 9/29 (31%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Query: 12 VTPELVFAKSSLHDVMN--IPADLSISTW 38 P+++ ++S HD +N IPA L++ Sbjct: 130 FVPDVLTDQTSAHDPLNGYIPAGLTLDEA 158 >2fkn_A Urocanate hydratase; rossman fold, lyase; HET: NAD; 2.20A {Bacillus subtilis} (A:132-347) Length = 216 Score = 26.6 bits (59), Expect = 3.4 Identities = 7/29 (24%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Query: 12 VTPELVFAKSSLHDVMN--IPADLSISTW 38 V ++V ++S HD + +P S+ Sbjct: 121 VKIDIVTDQTSAHDPLIGYVPEGYSLDEA 149 >1uwk_A Urocanate hydratase; hydrolase, urocanase, imidazolonepropionate, histidine metabolism, lyase; HET: NAD URO; 1.19A {Pseudomonas putida} (A:136-351) Length = 216 Score = 25.8 bits (57), Expect = 6.4 Identities = 9/29 (31%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Query: 12 VTPELVFAKSSLHDVMN--IPADLSISTW 38 V P++V ++S HD +N +PA + + Sbjct: 121 VRPDMVTDQTSAHDPLNGYLPAGWTWEQY 149 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.333 0.144 0.432 Gapped Lambda K H 0.267 0.0629 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,814,296 Number of extensions: 77868 Number of successful extensions: 214 Number of sequences better than 10.0: 1 Number of HSP's gapped: 214 Number of HSP's successfully gapped: 16 Length of query: 246 Length of database: 4,956,049 Length adjustment: 86 Effective length of query: 160 Effective length of database: 2,048,819 Effective search space: 327811040 Effective search space used: 327811040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 53 (24.4 bits)