BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780372|ref|YP_003064785.1| flagellar biosynthesis protein
FliP [Candidatus Liberibacter asiaticus str. psy62]
         (246 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780372|ref|YP_003064785.1| flagellar biosynthesis protein FliP [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 246

 Score =  489 bits (1260), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 246/246 (100%), Positives = 246/246 (100%)

Query: 1   MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVT 60
           MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVT
Sbjct: 1   MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGIFTILSIAPILLIMVT 60

Query: 61  CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT 120
           CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT
Sbjct: 61  CFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLDRSIEMGIQPLMNNQIT 120

Query: 121 ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE 180
           ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE
Sbjct: 121 ETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITKNDHIEYRILIPSFMISE 180

Query: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVEN 240
           LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVEN
Sbjct: 181 LRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLPFKVIFFVLIDGWSLLVEN 240

Query: 241 LVKSFI 246
           LVKSFI
Sbjct: 241 LVKSFI 246


>gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 1775

 Score = 23.1 bits (48), Expect = 4.4,   Method: Composition-based stats.
 Identities = 8/25 (32%), Positives = 16/25 (64%)

Query: 34  SISTWIVRTFGIFTILSIAPILLIM 58
           S S W VR +G+  +L+ + +L+ +
Sbjct: 319 SKSHWAVRRYGVLGLLNFSKMLMYL 343


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.333    0.144    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 146,584
Number of Sequences: 1233
Number of extensions: 5626
Number of successful extensions: 21
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 18
Number of HSP's gapped (non-prelim): 8
length of query: 246
length of database: 328,796
effective HSP length: 72
effective length of query: 174
effective length of database: 240,020
effective search space: 41763480
effective search space used: 41763480
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 37 (18.9 bits)