HHsearch alignment for GI: 254780373 and conserved domain: PRK05697

>PRK05697 flagellar basal body-associated protein FliL-like protein; Validated.
Probab=99.92  E-value=6.5e-24  Score=149.68  Aligned_cols=92  Identities=16%  Similarity=0.353  Sum_probs=80.4

Q ss_pred             CEEECC-CCEEEEECCCC-C-EEEEEEEEEEECCCH----HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHH
Q ss_conf             302103-32024205898-3-389999998504402----4542189999999998418988950889999999999999
Q gi|254780373|r   80 LQIFSL-QPIITNFDSSP-K-DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER  152 (172)
Q Consensus        80 ~~~~~l-~~fvvNL~~~~-~-r~lk~~i~l~~~~~~----~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~  152 (172)
T Consensus        31 ~~Y~~l~P~fV~N~~~~g~rlrylqv~v~Lmv~d~~~~~~le~H~PlIR~~li~lls~qt~~~l~t~eGre~Lr~e~l~~  110 (135)
T PRK05697         31 YAYYGLEPDIVTNYISDGKKLGYVKIDVELMVKDPDDLAAVEHHDPLIRNALVELLGQQTEDKVKSLTGREEIRQECLKQ  110 (135)
T ss_pred             EEEEECCCCEEEECCCCCCCEEEEEEEEEEEECCHHHHHHHHHHCHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHH
T ss_conf             58996589979965789860469999999998787568999970768999999998549987965987899999999999


Q ss_pred             HH-HH----CCCCEEEEEEEEEEC
Q ss_conf             85-42----356312576432201
Q gi|254780373|r  153 VK-LR----SQGFVSSVIFRTFII  171 (172)
Q Consensus       153 in-~~----~~g~V~~V~Ft~fVv  171 (172)
T Consensus       111 vn~~l~~etG~~~Ve~VlFT~fV~  134 (135)
T PRK05697        111 VNELLEQETGKPLVVDLLFTKYLY  134 (135)
T ss_pred             HHHHHHHHHCCCCEEEEEEECCEE
T ss_conf             999998631866434675000344