HHsearch alignment for GI: 254780373 and conserved domain: PRK07021

>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed.
Probab=94.62  E-value=0.039  Score=31.12  Aligned_cols=51  Identities=10%  Similarity=-0.019  Sum_probs=38.6

Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHH
Q ss_conf             9854355323467632059999999999999999999999706787652012
Q gi|254780373|r    1 MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEK   52 (172)
Q Consensus         1 ma~~~~~~~~~kG~~~kl~Iii~~vv~ll~~g~g~~~~~~~~~~~~~~~~~~   52 (172)
T Consensus         1 ma~~-~~~~~~kkkl~iii~~~~lll~~~g~g~~~~~~~~~~~~~~~~~~~~   51 (159)
T PRK07021          1 MADK-AASKKKKKSIWLILLILITLAAAAGAGYSYWLSKQGAAHAAAKAEPA   51 (159)
T ss_pred             CCCC-CCCCCCCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             9988-77788876040589999999999999999995477666666666677