HHsearch alignment for GI: 254780373 and conserved domain: PRK07718

>PRK07718 fliL flagellar basal body-associated protein FliL; Reviewed.
Probab=99.97  E-value=3.3e-31  Score=189.37  Aligned_cols=90  Identities=19%  Similarity=0.339  Sum_probs=82.9

Q ss_pred             CEEECCCCEEEEECCCCCEEEEEEEEEEECCCH----HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHH-
Q ss_conf             302103320242058983389999998504402----454218999999999841898895088999999999999985-
Q gi|254780373|r   80 LQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-  154 (172)
Q Consensus        80 ~~~~~l~~fvvNL~~~~~r~lk~~i~l~~~~~~----~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in-  154 (172)
T Consensus        47 ~~~~~~~e~~tNL~~--~rylkv~i~le~~~~~~~~El~~r~pqIrD~Ii~~Ls~kt~~dl~~~~Gk~~Lk~ei~~~iN~  124 (142)
T PRK07718         47 ESSVEVPEITTNLKS--GNFIRISFKIETDSKKAKEELEKRDFQVKDIIISELAEMNAEDLEGKKGLEKLKEQLKEKINN  124 (142)
T ss_pred             CCCCCCCCEEEECCC--CCEEEEEEEEEECCHHHHHHHHHCCHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             554015851687599--967999999998898899776651425699999999749997945977899999999999986


Q ss_pred             HHCCCCEEEEEEEEEEC
Q ss_conf             42356312576432201
Q gi|254780373|r  155 LRSQGFVSSVIFRTFII  171 (172)
Q Consensus       155 ~~~~g~V~~V~Ft~fVv  171 (172)
T Consensus       125 ~l~~G~V~~VyfT~fVi  141 (142)
T PRK07718        125 LMQEGKVKKVYITSFIL  141 (142)
T ss_pred             HCCCCCEEEEEEEEEEE
T ss_conf             46789469999887661