HHsearch alignment for GI: 254780373 and conserved domain: TIGR02837

>TIGR02837 spore_II_R stage II sporulation protein R; InterPro: IPR014202 This entry is designated stage II sporulation protein R. A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species. SpoIIR is a signalling protein that links the activation of sigma E to the transcriptional activity of sigma F during sporulation , ..
Probab=91.84  E-value=0.85  Score=23.84  Aligned_cols=57  Identities=12%  Similarity=0.117  Sum_probs=44.3

Q ss_pred             CCEEEEEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHH
Q ss_conf             833899999985044024542189999999998418988950889999999999999
Q gi|254780373|r   96 PKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER  152 (172)
Q Consensus        96 ~~r~lk~~i~l~~~~~~~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~  152 (172)
T Consensus        40 ~~~lIR~hvlANSDS~~DQ~LKl~vRDaVl~~i~p~l~g~~s~~ea~~~i~~~l~eI   96 (172)
T TIGR02837        40 SEKLIRFHVLANSDSDEDQELKLKVRDAVLKEITPKLKGLKSLEEARRVIKENLPEI   96 (172)
T ss_pred             CCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCH
T ss_conf             577167776524898467777777678888767787517878889999998518127