Query gi|254780373|ref|YP_003064786.1| flagellar basal body-associated protein FliL [Candidatus Liberibacter asiaticus str. psy62] Match_columns 172 No_of_seqs 118 out of 496 Neff 7.8 Searched_HMMs 39220 Date Sun May 29 16:49:08 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780373.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK08455 fliL flagellar basal 100.0 1.9E-40 4.2E-45 239.7 15.0 170 1-171 1-179 (180) 2 PRK05696 fliL flagellar basal 100.0 1E-37 2.6E-42 224.8 14.6 155 2-171 2-167 (168) 3 PRK12785 fliL flagellar basal 100.0 3.7E-38 9.4E-43 227.2 11.7 144 7-171 15-166 (167) 4 PRK07021 fliL flagellar basal 100.0 9.8E-37 2.5E-41 219.5 15.1 143 9-171 5-158 (159) 5 PRK07718 fliL flagellar basal 100.0 3.3E-31 8.4E-36 189.4 13.4 90 80-171 47-141 (142) 6 COG1580 FliL Flagellar basal b 100.0 8.5E-30 2.2E-34 181.7 14.7 97 76-172 56-159 (159) 7 pfam03748 FliL Flagellar basal 100.0 6.8E-30 1.7E-34 182.2 13.7 92 80-171 47-144 (145) 8 PRK05697 flagellar basal body- 99.9 6.5E-24 1.6E-28 149.7 13.3 92 80-171 31-134 (135) 9 PRK06654 fliL flagellar basal 99.5 1E-13 2.7E-18 94.1 11.4 88 80-171 79-174 (177) 10 PRK08455 fliL flagellar basal 96.9 0.00056 1.4E-08 41.2 2.2 43 3-45 7-49 (180) 11 PRK12785 fliL flagellar basal 95.4 0.004 1E-07 36.5 0.2 35 1-35 1-40 (167) 12 PRK07021 fliL flagellar basal 94.6 0.039 9.9E-07 31.1 3.5 51 1-52 1-51 (159) 13 PRK10920 putative uroporphyrin 94.4 0.074 1.9E-06 29.6 4.5 33 7-39 26-58 (389) 14 TIGR02837 spore_II_R stage II 91.8 0.85 2.2E-05 23.8 6.7 57 96-152 40-96 (172) 15 PRK05696 fliL flagellar basal 90.7 0.21 5.4E-06 27.1 2.8 42 3-44 6-47 (168) 16 PRK10270 hypothetical protein; 88.7 0.72 1.8E-05 24.2 4.2 27 16-42 2-28 (340) 17 pfam04375 HemX HemX. This fami 87.1 1.1 2.8E-05 23.2 4.3 17 10-26 24-40 (372) 18 pfam12072 DUF3552 Domain of un 83.9 1.3 3.2E-05 22.9 3.4 25 18-42 1-25 (201) 19 PRK09379 membrane-bound transc 82.9 1.3 3.3E-05 22.9 3.1 23 15-37 2-24 (303) 20 PRK03598 hypothetical protein; 82.3 1.3 3.4E-05 22.8 3.0 18 17-34 3-20 (331) 21 cd03400 Band_7_1 A subgroup of 79.3 4.7 0.00012 19.8 9.8 82 88-172 14-113 (124) 22 COG5353 Uncharacterized protei 78.0 2.8 7.1E-05 21.0 3.4 42 15-56 4-45 (161) 23 PRK06770 hypothetical protein; 74.3 4.9 0.00013 19.7 3.9 25 16-40 4-28 (185) 24 TIGR01495 ETRAMP early transcr 74.2 3.7 9.5E-05 20.3 3.2 38 8-45 53-93 (99) 25 pfam09716 ETRAMP Malarial earl 72.9 2.8 7.2E-05 21.0 2.4 34 8-41 44-77 (84) 26 PRK01844 hypothetical protein; 71.6 6.4 0.00016 19.1 4.0 23 18-40 5-27 (72) 27 pfam07423 DUF1510 Protein of u 70.4 4 0.0001 20.2 2.7 12 20-31 18-29 (214) 28 PRK11636 mrcA peptidoglycan sy 66.2 5.1 0.00013 19.6 2.5 25 17-41 5-29 (850) 29 COG2959 HemX Uncharacterized e 63.9 8.5 0.00022 18.4 3.3 27 12-38 28-54 (391) 30 COG3167 PilO Tfp pilus assembl 62.9 6.6 0.00017 19.0 2.6 26 16-45 23-48 (211) 31 pfam09551 Spore_II_R Stage II 62.7 12 0.0003 17.6 4.5 33 99-131 5-37 (132) 32 pfam12245 DUF3607 Protein of u 62.3 12 0.0003 17.6 4.1 27 80-106 43-69 (721) 33 PRK10927 essential cell divisi 61.6 4.5 0.00012 19.9 1.6 12 39-50 51-62 (319) 34 TIGR00247 TIGR00247 conserved 61.5 11 0.00029 17.7 3.5 21 20-40 16-36 (373) 35 PRK10559 p-hydroxybenzoic acid 61.0 13 0.00032 17.5 4.0 24 18-41 9-32 (310) 36 COG5294 Uncharacterized protei 58.7 8.8 0.00022 18.3 2.6 19 88-106 72-90 (113) 37 COG3197 FixS Uncharacterized p 53.6 14 0.00035 17.2 2.9 34 19-52 5-38 (58) 38 PRK01294 lipase chaperone; Pro 51.0 19 0.00048 16.5 4.6 15 33-47 19-33 (339) 39 PRK10361 DNA recombination pro 49.4 20 0.00051 16.4 4.4 31 18-48 3-33 (475) 40 PRK13481 glycosyltransferase; 49.3 20 0.00051 16.4 4.6 17 10-26 34-50 (269) 41 cd03401 Band_7_prohibitin Band 46.3 22 0.00057 16.1 5.9 53 116-170 94-149 (196) 42 pfam06365 CD34_antigen CD34/Po 45.5 15 0.00039 17.0 2.1 22 16-37 99-122 (202) 43 TIGR00847 ccoS cytochrome oxid 44.9 24 0.0006 16.0 4.3 33 21-53 5-39 (53) 44 TIGR00998 8a0101 efflux pump m 43.1 25 0.00064 15.8 3.8 23 128-150 115-137 (379) 45 PRK11556 multidrug efflux syst 42.1 26 0.00066 15.7 6.7 14 12-25 2-15 (415) 46 PRK10930 FtsH protease regulat 40.8 27 0.0007 15.6 9.5 70 98-168 155-240 (419) 47 pfam08229 SHR3_chaperone ER me 39.7 29 0.00073 15.5 3.0 14 81-94 98-111 (196) 48 PRK09783 copper/silver efflux 38.8 28 0.00072 15.6 2.6 29 117-146 155-186 (407) 49 PRK10833 putative assembly pro 38.6 30 0.00076 15.4 3.4 22 16-37 2-23 (617) 50 smart00786 SHR3_chaperone ER m 38.2 30 0.00077 15.4 3.0 13 82-94 99-111 (196) 51 PRK10381 ferric enterobactin t 38.1 30 0.00077 15.4 3.4 11 100-110 170-180 (379) 52 pfam03264 Cytochrom_NNT NapC/N 37.8 31 0.00078 15.4 3.7 35 119-155 87-122 (174) 53 COG3763 Uncharacterized protei 37.8 31 0.00078 15.4 4.0 21 18-38 5-25 (71) 54 PRK00059 prsA peptidylprolyl i 36.6 21 0.00055 16.2 1.7 18 17-34 5-22 (336) 55 PRK12705 hypothetical protein; 36.5 32 0.00082 15.2 2.7 26 17-42 8-33 (485) 56 pfam10410 DnaB_bind DnaB-helic 36.2 11 0.00029 17.7 0.3 41 124-166 5-45 (59) 57 PRK00720 tatA twin arginine tr 36.1 33 0.00083 15.2 3.7 12 19-30 9-20 (71) 58 PRK09859 multidrug efflux syst 35.7 20 0.00052 16.3 1.5 20 14-33 2-21 (385) 59 pfam03645 Tctex-1 Tctex-1 fami 34.4 35 0.00089 15.1 6.0 53 115-167 3-58 (101) 60 TIGR02223 ftsN cell division p 32.4 38 0.00097 14.9 3.2 48 15-63 33-89 (354) 61 pfam03896 TRAP_alpha Transloco 31.3 40 0.001 14.8 5.5 25 88-112 99-124 (281) 62 COG3322 Predicted periplasmic 29.5 43 0.0011 14.6 3.8 30 16-45 10-39 (295) 63 TIGR02898 spore_YhcN_YlaJ spor 28.2 34 0.00088 15.1 1.6 17 18-34 2-18 (185) 64 TIGR03007 pepcterm_ChnLen poly 28.2 45 0.0011 14.5 3.3 40 121-160 80-120 (510) 65 PRK06287 cobalt transport prot 28.2 45 0.0011 14.5 2.8 17 16-32 3-19 (105) 66 PRK00523 hypothetical protein; 27.9 46 0.0012 14.4 3.5 21 18-38 5-26 (73) 67 pfam09624 DUF2393 Protein of u 27.7 46 0.0012 14.4 3.6 29 79-110 46-75 (119) 68 pfam08999 SP_C-Propep Surfacta 27.6 46 0.0012 14.4 2.8 20 16-35 34-53 (93) 69 cd03403 Band_7_stomatin_like B 27.1 47 0.0012 14.3 8.7 71 98-170 57-141 (215) 70 pfam06796 NapE Periplasmic nit 27.0 47 0.0012 14.3 4.2 23 1-23 1-24 (55) 71 KOG0860 consensus 26.4 49 0.0012 14.3 2.5 21 117-137 42-63 (116) 72 PRK11677 cytochrome d ubiquino 26.3 49 0.0012 14.3 3.3 22 22-43 5-26 (134) 73 cd03404 Band_7_HflK Band_7_Hfl 26.3 49 0.0012 14.3 6.0 70 99-169 87-172 (266) 74 PRK11901 hypothetical protein; 26.2 49 0.0012 14.3 2.7 18 18-35 39-56 (329) 75 TIGR03319 YmdA_YtgF conserved 26.1 33 0.00083 15.2 1.2 22 20-41 1-22 (514) 76 COG1566 EmrA Multidrug resista 25.6 50 0.0013 14.2 4.1 30 12-41 9-38 (352) 77 TIGR01215 minE cell division t 25.6 50 0.0013 14.2 3.7 40 116-155 15-54 (89) 78 pfam01145 Band_7 SPFH domain / 25.3 51 0.0013 14.2 6.7 53 116-170 91-146 (177) 79 pfam09576 COX9 Cytochrome c ox 24.9 52 0.0013 14.1 2.6 36 9-44 4-39 (57) 80 smart00019 SF_P Pulmonary surf 24.2 15 0.00039 17.0 -0.8 23 14-36 32-54 (191) 81 COG4640 Predicted membrane pro 24.0 54 0.0014 14.0 2.4 28 14-41 48-75 (465) 82 pfam03597 CcoS Cytochrome oxid 23.7 55 0.0014 14.0 3.0 28 24-51 9-36 (45) 83 COG4093 Uncharacterized protei 23.5 49 0.0013 14.2 1.7 26 15-43 14-39 (338) 84 pfam09680 Tiny_TM_bacill Prote 23.0 57 0.0014 13.9 2.2 17 20-36 8-24 (26) 85 cd02106 Band_7 The band 7 doma 22.9 57 0.0015 13.9 6.2 54 115-170 52-108 (121) 86 pfam06160 EzrA Septation ring 22.7 42 0.0011 14.6 1.2 18 20-37 2-19 (559) 87 pfam06097 DUF945 Bacterial pro 22.4 58 0.0015 13.8 2.4 20 19-38 6-25 (460) 88 pfam11772 EpuA DNA-directed RN 22.3 30 0.00076 15.4 0.4 23 25-47 6-28 (47) 89 pfam00155 Aminotran_1_2 Aminot 22.2 59 0.0015 13.8 4.8 11 142-152 262-272 (351) 90 PRK04778 septation ring format 21.9 60 0.0015 13.8 3.2 16 19-34 5-20 (569) 91 PRK03002 prsA peptidylprolyl i 21.5 61 0.0016 13.7 2.4 19 115-133 82-100 (285) 92 COG2268 Uncharacterized protei 21.2 62 0.0016 13.7 2.9 34 119-154 143-176 (548) 93 pfam03672 UPF0154 Uncharacteri 20.9 63 0.0016 13.7 2.5 16 24-39 4-19 (64) 94 PRK10905 hypothetical protein; 20.7 33 0.00084 15.2 0.4 18 19-36 2-19 (323) 95 PRK01833 tatA twin arginine tr 20.6 64 0.0016 13.6 3.7 11 18-28 9-19 (75) 96 PRK10856 hypothetical protein; 20.5 64 0.0016 13.6 4.0 19 16-34 112-130 (332) 97 TIGR01411 tatAE twin arginine- 20.3 62 0.0016 13.7 1.7 13 18-30 7-19 (48) 98 PRK04561 tatA twin arginine tr 20.1 65 0.0017 13.6 3.4 12 19-30 9-20 (75) No 1 >PRK08455 fliL flagellar basal body-associated protein FliL; Reviewed Probab=100.00 E-value=1.9e-40 Score=239.69 Aligned_cols=170 Identities=15% Similarity=0.221 Sum_probs=112.4 Q ss_pred CCCCCCCCCC-CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCCC--CCCCCCCCCC Q ss_conf 9854355323-467632059999999999999999999999706787652012455653101122333--3334444333 Q gi|254780373|r 1 MSYDDTTSQY-IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVR--SVHTGDTISL 77 (172) Q Consensus 1 ma~~~~~~~~-~kG~~~kl~Iii~~vv~ll~~g~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~ 77 (172) |||+++.+++ +|+++++++||++++++|+++|||+++| +++++..+...++.+........+.+.. .......... T Consensus 1 MAee~e~~e~~~kkk~k~lliIii~vvvlll~~gG~~~~-~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 79 (180) T PRK08455 1 MAEEQENTETKPKKKSKALLIIIIGVVVLLLLIGGVIAF-LLMGSSEEEKENAEQPAEEVQANPPANSAQEAKQRSNDFL 79 (180) T ss_pred CCCCCCCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHHHH-HHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC T ss_conf 986543555578887875887349999999999999998-7617898642222345421235677655444444443212 Q ss_pred CCCEEECCCCEEEEECC-CCCEEEEEEEEEEECCCH----HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHH Q ss_conf 35302103320242058-983389999998504402----4542189999999998418988950889999999999999 Q gi|254780373|r 78 KKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER 152 (172) Q Consensus 78 ~~~~~~~l~~fvvNL~~-~~~r~lk~~i~l~~~~~~----~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~ 152 (172) ....+++++||||||.+ +++||||++++|++++++ .+.|+|.|||.|+.+||+++++||++++||++||++|+++ T Consensus 80 ~~~~~~~l~~f~vNl~~~~~~rylq~~i~l~~~~~~~~~~~~~~~p~ird~ii~~ls~~~~~~l~~~~Gk~~Lr~ei~~~ 159 (180) T PRK08455 80 NIGPMYPLDPFTVNLLSQSGRRYLKTSISLELSNELLKPELDKKDPVIRDTIIRILSSKTVEEVSTNKGKERLKDEIVGK 159 (180) T ss_pred CCCCCCCCCCEEEECCCCCCCEEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHH T ss_conf 44565456777997778998638999999998688889999986699999999999649998950977899999999999 Q ss_pred HH-HHCCCCEEEEEEEEEEC Q ss_conf 85-42356312576432201 Q gi|254780373|r 153 VK-LRSQGFVSSVIFRTFII 171 (172) Q Consensus 153 in-~~~~g~V~~V~Ft~fVv 171 (172) +| ++.+|+|++||||+||| T Consensus 160 in~~l~~~~V~~V~Ft~fV~ 179 (180) T PRK08455 160 LNEFLIDGFIKNVFFTDFVV 179 (180) T ss_pred HHHHHCCCCEEEEEEEEEEE T ss_conf 99873679557998424176 No 2 >PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed Probab=100.00 E-value=1e-37 Score=224.85 Aligned_cols=155 Identities=10% Similarity=0.144 Sum_probs=108.8 Q ss_pred CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCE Q ss_conf 85435532346763205999999999999999999999970678765201245565310112233333344443333530 Q gi|254780373|r 2 SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQ 81 (172) Q Consensus 2 a~~~~~~~~~kG~~~kl~Iii~~vv~ll~~g~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 81 (172) |+++...++.+++|+|++||++++++++++|+|+ +| ++++...+.+....+.... ....+..+.. T Consensus 2 a~e~~e~e~~~k~KkKLiiii~~~vlll~ggggg-~~-~~lg~~~~~~~~~~~~~~~-------------~~~~~~~~~~ 66 (168) T PRK05696 2 ASEELEKDEAPKSKKKLIIIIVVGVLLALGGGGA-AW-FFMGSSDPAEAAAAEAAAA-------------AAAAPVPPAL 66 (168) T ss_pred CCHHHHCCCCCCCCCEEEHHHHHHHHHHHHHHHH-HH-HHHCCCCCCCCCCCCCCCC-------------CCCCCCCCCC T ss_conf 0023113467888633204799999999999999-99-9955887544444444556-------------6778877752 Q ss_pred EECC-CCEEEEECCCCC-EEEEEEEEEEECCCH----HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHH Q ss_conf 2103-320242058983-389999998504402----4542189999999998418988950889999999999999854 Q gi|254780373|r 82 IFSL-QPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL 155 (172) Q Consensus 82 ~~~l-~~fvvNL~~~~~-r~lk~~i~l~~~~~~----~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in~ 155 (172) |+++ +||||||.++++ ||||++++|++++++ ++.|+|.|||+++.+||+++++||+|++||++||+++++++|. T Consensus 67 y~~l~~~F~VNL~~~~~~ryLqv~i~L~~~d~~~~~~i~~~~P~IR~~ll~lls~~~~~~l~t~eGk~~Lr~e~~~~in~ 146 (168) T PRK05696 67 YVPMPRPFVFNVPGNGRDRLVQIKVQLMVRGSADEELAKKHIPLIENALLMTFSGADVDQLSTPAGKEELRQKALASVQE 146 (168) T ss_pred CCCCCCCEEEECCCCCCCEEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHCHHHHHHHHHHHHHHHHH T ss_conf 13578663886168997469999999998887689999875588999999999628998960987899999999999999 Q ss_pred -H----CCCCEEEEEEEEEEC Q ss_conf -2----356312576432201 Q gi|254780373|r 156 -R----SQGFVSSVIFRTFII 171 (172) Q Consensus 156 -~----~~g~V~~V~Ft~fVv 171 (172) + +++.|++||||+||| T Consensus 147 ~l~~~~g~~~V~~VlFT~FVv 167 (168) T PRK05696 147 TLQKVTGKPVVEKVLFTGFVM 167 (168) T ss_pred HHHHCCCCCCEEEEEECCCEE T ss_conf 976313887512785302364 No 3 >PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed Probab=100.00 E-value=3.7e-38 Score=227.22 Aligned_cols=144 Identities=16% Similarity=0.256 Sum_probs=105.9 Q ss_pred CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEECCC Q ss_conf 53234676320599999999999999999999997067876520124556531011223333334444333353021033 Q gi|254780373|r 7 TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQ 86 (172) Q Consensus 7 ~~~~~kG~~~kl~Iii~~vv~ll~~g~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~ 86 (172) ..+++|++|+|++||++++++++++|+|++| + +.+...+.+... .......++.|++++ T Consensus 15 e~~~~kkkkkkliIii~~~vlll~gggg~~f-~-~~~~~~~~~~~~-------------------~~~~~~~~~~f~~l~ 73 (167) T PRK12785 15 EGAAPPKKKKKLIIIAAAAVLLLGGGGGGWF-F-FFRGHGADEHHA-------------------EAAPKVKPPVFVDVP 73 (167) T ss_pred CCCCCCCCCCEEEEEHHHHHHHHHHHHHHEE-E-EECCCCCCCCCC-------------------CCCCCCCCCEEEECC T ss_conf 5677877773587619999999973114014-6-642688765555-------------------667778986376148 Q ss_pred CEEEEECC-CC-C-EEEEEEEEEEECCCH----HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHH-HHCC Q ss_conf 20242058-98-3-389999998504402----454218999999999841898895088999999999999985-4235 Q gi|254780373|r 87 PIITNFDS-SP-K-DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQ 158 (172) Q Consensus 87 ~fvvNL~~-~~-~-r~lk~~i~l~~~~~~----~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in-~~~~ 158 (172) +|+|||++ ++ + ||||++++|+++++. ++.++|+|||.|+.+||+++++||++++|+++||++|++|+| .+++ T Consensus 74 ~fvVNL~~~~g~r~ryLk~~i~Lev~~~~~~~~~~~~~P~IrD~i~~~L~~~~~~dL~~~~Gk~~Lr~ell~rin~~l~~ 153 (167) T PRK12785 74 DMLVNLAGDPGERVQYLKVKVVLEVKDEKQVEQIKPLMPRVTDLFQTYLRELRSSDLNGSAGLFRLKEELTRRVNVALAP 153 (167) T ss_pred CEEEECCCCCCCCCEEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHCHHHHHHHHHHHHHHHHHHCCC T ss_conf 85998789999853599999999988887899998753679999999997189989709377999999999999854178 Q ss_pred CCEEEEEEEEEEC Q ss_conf 6312576432201 Q gi|254780373|r 159 GFVSSVIFRTFII 171 (172) Q Consensus 159 g~V~~V~Ft~fVv 171 (172) ++|++||||+||| T Consensus 154 ~~V~~VlFtefVv 166 (167) T PRK12785 154 AQVNAVLFKEVVI 166 (167) T ss_pred CCEEEEEEEEEEE T ss_conf 8235998986387 No 4 >PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed Probab=100.00 E-value=9.8e-37 Score=219.46 Aligned_cols=143 Identities=13% Similarity=0.200 Sum_probs=106.2 Q ss_pred CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEECCCCE Q ss_conf 23467632059999999999999999999999706787652012455653101122333333444433335302103320 Q gi|254780373|r 9 QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPI 88 (172) Q Consensus 9 ~~~kG~~~kl~Iii~~vv~ll~~g~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~f 88 (172) +.++|+++|++||++++++++++|+|++|+|+ +....... ++.. +..+..++.|++|+|| T Consensus 5 ~~~~~~kkkl~iii~~~~lll~~~g~g~~~~~-~~~~~~~~-~~~~------------------~~~~~~~pvf~~l~~f 64 (159) T PRK07021 5 AASKKKKKSIWLILLILITLAAAAGAGYSYWL-SKQGAAHA-AAKA------------------EPAPPPAPVFFPLETF 64 (159) T ss_pred CCCCCCCCEEEHHHHHHHHHHHHHHHHHHHHH-CCCCCCCC-CCCC------------------CCCCCCCCEEEECCCE T ss_conf 77788876040589999999999999999995-47766666-6666------------------6778898757734751 Q ss_pred EEEEC-CCC-CEEEEEEEEEEECCCH----HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHH-HHCC--- Q ss_conf 24205-898-3389999998504402----454218999999999841898895088999999999999985-4235--- Q gi|254780373|r 89 ITNFD-SSP-KDWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQ--- 158 (172) Q Consensus 89 vvNL~-~~~-~r~lk~~i~l~~~~~~----~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in-~~~~--- 158 (172) ||||. +++ +||||++++|++++++ ++.++|.|||+++.+||+++++||++++||++||++|++++| .+.+ T Consensus 65 ~VNL~~~~~~~ryLqv~i~L~~~d~~~~~~l~~~~P~Ird~ll~lls~~~~~dL~t~eGk~~L~~ei~~~vn~~l~~~~~ 144 (159) T PRK07021 65 TVNLQPDDDADRVLYIGLTLRLKDEATRERLKEYLPEVRSRLLLLLSRKHAAELATEEGKQKLAAEIKETLEQPLVPGQP 144 (159) T ss_pred EEECCCCCCCCEEEEEEEEEEECCHHHHHHHHHCCHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 79713899864599999999976877898998607478999999985499889649889999999999999998745688 Q ss_pred -CCEEEEEEEEEEC Q ss_conf -6312576432201 Q gi|254780373|r 159 -GFVSSVIFRTFII 171 (172) Q Consensus 159 -g~V~~V~Ft~fVv 171 (172) ..|++||||+||| T Consensus 145 ~~~V~~VlFT~FVv 158 (159) T PRK07021 145 KQVVTDVLFTAFIL 158 (159) T ss_pred CCCEEEEEEEEEEE T ss_conf 88345892144064 No 5 >PRK07718 fliL flagellar basal body-associated protein FliL; Reviewed Probab=99.97 E-value=3.3e-31 Score=189.37 Aligned_cols=90 Identities=19% Similarity=0.339 Sum_probs=82.9 Q ss_pred CEEECCCCEEEEECCCCCEEEEEEEEEEECCCH----HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHH- Q ss_conf 302103320242058983389999998504402----454218999999999841898895088999999999999985- Q gi|254780373|r 80 LQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK- 154 (172) Q Consensus 80 ~~~~~l~~fvvNL~~~~~r~lk~~i~l~~~~~~----~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in- 154 (172) ...+++|+|+|||.+ +||+|+++.++++++. .+.+.|+|||.|+.+||+++++||++++|+++||++|++++| T Consensus 47 ~~~~~~~e~~tNL~~--~rylkv~i~le~~~~~~~~El~~r~pqIrD~Ii~~Ls~kt~~dl~~~~Gk~~Lk~ei~~~iN~ 124 (142) T PRK07718 47 ESSVEVPEITTNLKS--GNFIRISFKIETDSKKAKEELEKRDFQVKDIIISELAEMNAEDLEGKKGLEKLKEQLKEKINN 124 (142) T ss_pred CCCCCCCCEEEECCC--CCEEEEEEEEEECCHHHHHHHHHCCHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHH T ss_conf 554015851687599--967999999998898899776651425699999999749997945977899999999999986 Q ss_pred HHCCCCEEEEEEEEEEC Q ss_conf 42356312576432201 Q gi|254780373|r 155 LRSQGFVSSVIFRTFII 171 (172) Q Consensus 155 ~~~~g~V~~V~Ft~fVv 171 (172) .+.+|+|++||||+||| T Consensus 125 ~l~~G~V~~VyfT~fVi 141 (142) T PRK07718 125 LMQEGKVKKVYITSFIL 141 (142) T ss_pred HCCCCCEEEEEEEEEEE T ss_conf 46789469999887661 No 6 >COG1580 FliL Flagellar basal body-associated protein [Cell motility and secretion] Probab=99.97 E-value=8.5e-30 Score=181.69 Aligned_cols=97 Identities=16% Similarity=0.312 Sum_probs=87.1 Q ss_pred CCCCCEEECCCCEEEEECC-CCCEEEEEEEEEEECCC----HHHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHH Q ss_conf 3335302103320242058-98338999999850440----245421899999999984189889508899999999999 Q gi|254780373|r 76 SLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIE 150 (172) Q Consensus 76 ~~~~~~~~~l~~fvvNL~~-~~~r~lk~~i~l~~~~~----~~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~ 150 (172) .....+|+.+++|++||.+ ++.||+++.++++..+. +.+.+.|+|||.++.+|++++.++|++++|+++||.+|+ T Consensus 56 ~~~~~~~~~~~~~t~Nl~~~~~~~~v~i~i~l~~~n~~~~~el~~~~p~vrd~li~lfsskt~~eL~t~~Gke~Lk~ei~ 135 (159) T COG1580 56 VEILAYYYLLEEFTTNLLDGPKDRYVKIAITLEVANKALLEELEEKKPEVRDALLMLFSSKTAAELSTPEGKEKLKAEIK 135 (159) T ss_pred CCCCCEEEECCCEEEECCCCCCCEEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCHHHHHHHHHHH T ss_conf 87554465225504562668874799999988608888999999756899999999997178988368221899999999 Q ss_pred HHHH-HHCCC-CEEEEEEEEEECC Q ss_conf 9985-42356-3125764322019 Q gi|254780373|r 151 ERVK-LRSQG-FVSSVIFRTFIIA 172 (172) Q Consensus 151 ~~in-~~~~g-~V~~V~Ft~fVv~ 172 (172) +++| .+..| .|.+||||+|||. T Consensus 136 ~~in~~L~~g~~V~dV~fT~fiiq 159 (159) T COG1580 136 DRINTILKEGQVVKDVLFTNFIIQ 159 (159) T ss_pred HHHHHHHHCCCEEEEEEEEHHHCC T ss_conf 999899845872677855513119 No 7 >pfam03748 FliL Flagellar basal body-associated protein FliL. This FliL protein controls the rotational direction of the flagella during chemotaxis. FliL is a cytoplasmic membrane protein associated with the basal body. Probab=99.97 E-value=6.8e-30 Score=182.21 Aligned_cols=92 Identities=22% Similarity=0.443 Sum_probs=85.3 Q ss_pred CEEECCCCEEEEECCCCC-EEEEEEEEEEECCCH----HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHH Q ss_conf 302103320242058983-389999998504402----454218999999999841898895088999999999999985 Q gi|254780373|r 80 LQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK 154 (172) Q Consensus 80 ~~~~~l~~fvvNL~~~~~-r~lk~~i~l~~~~~~----~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in 154 (172) ..|++++||||||.++++ ||+|++++++++++. .+.++|.|||.++.+||+++++||++++|+++||++|++++| T Consensus 47 ~~~~~l~~~~vNl~~~~~~r~l~~~i~l~~~~~~~~~~~~~~~p~Ird~ii~~l~~~~~~dl~~~~g~~~Lk~~l~~~in 126 (145) T pfam03748 47 AAYVPLEPFVVNLADDGGTRYLKISIALEVRDPKAAEELEKHMPLIRDAILMLLSSKTAEDLSTPEGKEKLKEELLERIN 126 (145) T ss_pred CEEEECCCEEEECCCCCCCEEEEEEEEEEECCHHHHHHHHHCCHHHHHHHHHHHHCCCHHHCCCHHHHHHHHHHHHHHHH T ss_conf 64886498899826899636999999999768878998886263337999999865882121493379999999999999 Q ss_pred -HHCCCCEEEEEEEEEEC Q ss_conf -42356312576432201 Q gi|254780373|r 155 -LRSQGFVSSVIFRTFII 171 (172) Q Consensus 155 -~~~~g~V~~V~Ft~fVv 171 (172) .+.+++|++||||+||| T Consensus 127 ~~l~~~~V~~V~ft~fVv 144 (145) T pfam03748 127 EVLLEGEVEDVLFTSFVI 144 (145) T ss_pred HHHCCCCEEEEEEEEEEE T ss_conf 873758546998885086 No 8 >PRK05697 flagellar basal body-associated protein FliL-like protein; Validated Probab=99.92 E-value=6.5e-24 Score=149.68 Aligned_cols=92 Identities=16% Similarity=0.353 Sum_probs=80.4 Q ss_pred CEEECC-CCEEEEECCCC-C-EEEEEEEEEEECCCH----HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHH Q ss_conf 302103-32024205898-3-389999998504402----4542189999999998418988950889999999999999 Q gi|254780373|r 80 LQIFSL-QPIITNFDSSP-K-DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER 152 (172) Q Consensus 80 ~~~~~l-~~fvvNL~~~~-~-r~lk~~i~l~~~~~~----~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~ 152 (172) ..|+.+ |+||||+.+++ + ||+|+++++++++++ ++.|+|.|||.|+.+|+++++++|+|++||+.||++++++ T Consensus 31 ~~Y~~l~P~fV~N~~~~g~rlrylqv~v~Lmv~d~~~~~~le~H~PlIR~~li~lls~qt~~~l~t~eGre~Lr~e~l~~ 110 (135) T PRK05697 31 YAYYGLEPDIVTNYISDGKKLGYVKIDVELMVKDPDDLAAVEHHDPLIRNALVELLGQQTEDKVKSLTGREEIRQECLKQ 110 (135) T ss_pred EEEEECCCCEEEECCCCCCCEEEEEEEEEEEECCHHHHHHHHHHCHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHH T ss_conf 58996589979965789860469999999998787568999970768999999998549987965987899999999999 Q ss_pred HH-HH----CCCCEEEEEEEEEEC Q ss_conf 85-42----356312576432201 Q gi|254780373|r 153 VK-LR----SQGFVSSVIFRTFII 171 (172) Q Consensus 153 in-~~----~~g~V~~V~Ft~fVv 171 (172) +| ++ +++.|++||||+||+ T Consensus 111 vn~~l~~etG~~~Ve~VlFT~fV~ 134 (135) T PRK05697 111 VNELLEQETGKPLVVDLLFTKYLY 134 (135) T ss_pred HHHHHHHHHCCCCEEEEEEECCEE T ss_conf 999998631866434675000344 No 9 >PRK06654 fliL flagellar basal body-associated protein FliL; Reviewed Probab=99.54 E-value=1e-13 Score=94.12 Aligned_cols=88 Identities=18% Similarity=0.208 Sum_probs=73.8 Q ss_pred CEEECCCCEEEEECCC-CCEEEEEEEEEEECCCH------HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHH Q ss_conf 3021033202420589-83389999998504402------4542189999999998418988950889999999999999 Q gi|254780373|r 80 LQIFSLQPIITNFDSS-PKDWLRLDIALICKDIP------DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER 152 (172) Q Consensus 80 ~~~~~l~~fvvNL~~~-~~r~lk~~i~l~~~~~~------~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~ 152 (172) .+|-..++|-+|-+|. +.+|+ ++++|.+.... ...+.-++||.|..|+++++.++|.. .+++|.||+++ T Consensus 79 ~~Y~~~~e~r~nTaD~~~at~V-v~~aLGY~~n~k~l~~EL~~R~v~lkD~i~~yfs~kT~~ELrn---e~qiK~EIk~~ 154 (177) T PRK06654 79 IWYESIDEIRGNTADAPPKTFV-VKLALGYAENNVNILQELGRQKVRLKDIIREYFSQRTGQEIKN---ESQIKAEIKAR 154 (177) T ss_pred HHHHHCCHHCCCCCCCCCCEEE-EEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHH T ss_conf 5543113310455667872189-9987424678877999997648589999999984510998751---89999999999 Q ss_pred HH-HHCCCCEEEEEEEEEEC Q ss_conf 85-42356312576432201 Q gi|254780373|r 153 VK-LRSQGFVSSVIFRTFII 171 (172) Q Consensus 153 in-~~~~g~V~~V~Ft~fVv 171 (172) +| ++..|+|.+|+||.|=| T Consensus 155 IN~IL~~gkIkdI~FTq~di 174 (177) T PRK06654 155 INSILRNGEIKEIALTQIDI 174 (177) T ss_pred HHHHHHCCCEEEEEEEEEEE T ss_conf 99887428600698766543 No 10 >PRK08455 fliL flagellar basal body-associated protein FliL; Reviewed Probab=96.89 E-value=0.00056 Score=41.17 Aligned_cols=43 Identities=12% Similarity=-0.081 Sum_probs=34.4 Q ss_pred CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 5435532346763205999999999999999999999970678 Q gi|254780373|r 3 YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLF 45 (172) Q Consensus 3 ~~~~~~~~~kG~~~kl~Iii~~vv~ll~~g~g~~~~~~~~~~~ 45 (172) +.++.++++++....++|.+++++++.+++++|++...-.... T Consensus 7 ~~e~~~kkk~k~lliIii~vvvlll~~gG~~~~~l~~~~~~~~ 49 (180) T PRK08455 7 NTETKPKKKSKALLIIIIGVVVLLLLIGGVIAFLLMGSSEEEK 49 (180) T ss_pred CCCCCCCCCCCEEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCC T ss_conf 5555788878758873499999999999999987617898642 No 11 >PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed Probab=95.36 E-value=0.004 Score=36.48 Aligned_cols=35 Identities=9% Similarity=-0.013 Sum_probs=21.0 Q ss_pred CCCCCCC-----CCCCCCCCCHHHHHHHHHHHHHHHHHHH Q ss_conf 9854355-----3234676320599999999999999999 Q gi|254780373|r 1 MSYDDTT-----SQYIRGNQHKLFVTWFVVYTFIGIFCGW 35 (172) Q Consensus 1 ma~~~~~-----~~~~kG~~~kl~Iii~~vv~ll~~g~g~ 35 (172) ||++|+. .++....++|...+++++++++.+.+|+ T Consensus 1 ma~~~~~~~~~e~ee~~~~kkkkkkliIii~~~vlll~gg 40 (167) T PRK12785 1 MAKKEKKAEAAEGEEGAAPPKKKKKLIIIAAAAVLLLGGG 40 (167) T ss_pred CCCCCCCCCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHH T ss_conf 9987666765445456778777735876199999999731 No 12 >PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed Probab=94.62 E-value=0.039 Score=31.12 Aligned_cols=51 Identities=10% Similarity=-0.019 Sum_probs=38.6 Q ss_pred CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHH Q ss_conf 9854355323467632059999999999999999999999706787652012 Q gi|254780373|r 1 MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEK 52 (172) Q Consensus 1 ma~~~~~~~~~kG~~~kl~Iii~~vv~ll~~g~g~~~~~~~~~~~~~~~~~~ 52 (172) ||++ ..++++|.+...+++++++++++.++|+.|+.+.--........++. T Consensus 1 ma~~-~~~~~~kkkl~iii~~~~lll~~~g~g~~~~~~~~~~~~~~~~~~~~ 51 (159) T PRK07021 1 MADK-AASKKKKKSIWLILLILITLAAAAGAGYSYWLSKQGAAHAAAKAEPA 51 (159) T ss_pred CCCC-CCCCCCCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC T ss_conf 9988-77788876040589999999999999999995477666666666677 No 13 >PRK10920 putative uroporphyrinogen III C-methyltransferase; Provisional Probab=94.39 E-value=0.074 Score=29.62 Aligned_cols=33 Identities=12% Similarity=0.079 Sum_probs=22.6 Q ss_pred CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 532346763205999999999999999999999 Q gi|254780373|r 7 TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGI 39 (172) Q Consensus 7 ~~~~~kG~~~kl~Iii~~vv~ll~~g~g~~~~~ 39 (172) .+++.++++..+++.++++++++++|+|++++. T Consensus 26 ~~~~~~~~~~g~~l~~lai~l~la~g~g~y~~~ 58 (389) T PRK10920 26 ATEKKSKNRTALILSAVAIAIALAAGAGLYGWG 58 (389) T ss_pred CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 988999887419999999999999999999999 No 14 >TIGR02837 spore_II_R stage II sporulation protein R; InterPro: IPR014202 This entry is designated stage II sporulation protein R. A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species. SpoIIR is a signalling protein that links the activation of sigma E to the transcriptional activity of sigma F during sporulation , .. Probab=91.84 E-value=0.85 Score=23.84 Aligned_cols=57 Identities=12% Similarity=0.117 Sum_probs=44.3 Q ss_pred CCEEEEEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHH Q ss_conf 833899999985044024542189999999998418988950889999999999999 Q gi|254780373|r 96 PKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER 152 (172) Q Consensus 96 ~~r~lk~~i~l~~~~~~~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~ 152 (172) ...-+|+.+=.-.+.+++..++-.|||+++.+|+..=-+-=+-.+.+..||+.+.+- T Consensus 40 ~~~lIR~hvlANSDS~~DQ~LKl~vRDaVl~~i~p~l~g~~s~~ea~~~i~~~l~eI 96 (172) T TIGR02837 40 SEKLIRFHVLANSDSDEDQELKLKVRDAVLKEITPKLKGLKSLEEARRVIKENLPEI 96 (172) T ss_pred CCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCH T ss_conf 577167776524898467777777678888767787517878889999998518127 No 15 >PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed Probab=90.72 E-value=0.21 Score=27.10 Aligned_cols=42 Identities=7% Similarity=-0.139 Sum_probs=35.1 Q ss_pred CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 543553234676320599999999999999999999997067 Q gi|254780373|r 3 YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFL 44 (172) Q Consensus 3 ~~~~~~~~~kG~~~kl~Iii~~vv~ll~~g~g~~~~~~~~~~ 44 (172) .|.+..+++|.+...++++++++++..++|+.++.+...... T Consensus 6 ~e~e~~~k~KkKLiiii~~~vlll~ggggg~~~~lg~~~~~~ 47 (168) T PRK05696 6 LEKDEAPKSKKKLIIIIVVGVLLALGGGGAAWFFMGSSDPAE 47 (168) T ss_pred HHCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCC T ss_conf 113467888633204799999999999999999955887544 No 16 >PRK10270 hypothetical protein; Provisional Probab=88.68 E-value=0.72 Score=24.21 Aligned_cols=27 Identities=19% Similarity=0.178 Sum_probs=15.5 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 205999999999999999999999970 Q gi|254780373|r 16 HKLFVTWFVVYTFIGIFCGWLGGIVML 42 (172) Q Consensus 16 ~kl~Iii~~vv~ll~~g~g~~~~~~~~ 42 (172) +|.+++++++++++++++|++++.+.. T Consensus 2 kk~~~~~~~l~~~l~i~~g~~~~~~~~ 28 (340) T PRK10270 2 KKVLLIILLLLVVLGIAAGVGVWKVRH 28 (340) T ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 028999999999999999999987410 No 17 >pfam04375 HemX HemX. This family consists of several bacterial HemX proteins. The hemX gene is not essential for haem synthesis in B. subtilis. HemX is a polytopic membrane protein which by an unknown mechanism down-regulates the level of HemA. Probab=87.06 E-value=1.1 Score=23.19 Aligned_cols=17 Identities=18% Similarity=0.057 Sum_probs=6.4 Q ss_pred CCCCCCCHHHHHHHHHH Q ss_conf 34676320599999999 Q gi|254780373|r 10 YIRGNQHKLFVTWFVVY 26 (172) Q Consensus 10 ~~kG~~~kl~Iii~~vv 26 (172) .++|+...+..+.+++. T Consensus 24 ~~~g~~~~l~~~allla 40 (372) T pfam04375 24 AKSGGATGLAALALLVA 40 (372) T ss_pred CCCCCHHHHHHHHHHHH T ss_conf 55775279999999999 No 18 >pfam12072 DUF3552 Domain of unknown function (DUF3552). This presumed domain is functionally uncharacterized. This domain is found in bacteria, archaea and eukaryotes. This domain is about 200 amino acids in length. This domain is found associated with pfam00013, pfam01966. This domain has a single completely conserved residue A that may be functionally important. Probab=83.85 E-value=1.3 Score=22.89 Aligned_cols=25 Identities=12% Similarity=0.284 Sum_probs=17.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 5999999999999999999999970 Q gi|254780373|r 18 LFVTWFVVYTFIGIFCGWLGGIVML 42 (172) Q Consensus 18 l~Iii~~vv~ll~~g~g~~~~~~~~ 42 (172) ++|++.++.+++|++.||++..+.. T Consensus 1 ~~Ii~~i~~~~iG~~~G~~~~~~~~ 25 (201) T pfam12072 1 LIIILAIIALVVGFAIGYFVRKSIA 25 (201) T ss_pred CCHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9239999999999999999999999 No 19 >PRK09379 membrane-bound transcriptional regulator LytR; Provisional Probab=82.94 E-value=1.3 Score=22.87 Aligned_cols=23 Identities=13% Similarity=0.081 Sum_probs=8.2 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHH Q ss_conf 32059999999999999999999 Q gi|254780373|r 15 QHKLFVTWFVVYTFIGIFCGWLG 37 (172) Q Consensus 15 ~~kl~Iii~~vv~ll~~g~g~~~ 37 (172) |+|++++++.+++++.+++|+++ T Consensus 2 KKkil~~i~~v~~vlll~~g~~~ 24 (303) T PRK09379 2 KKKILFWILGIIGVLIIGGGIYA 24 (303) T ss_pred CCEEEHHHHHHHHHHHHHHHHHH T ss_conf 82660369999999999999999 No 20 >PRK03598 hypothetical protein; Provisional Probab=82.31 E-value=1.3 Score=22.77 Aligned_cols=18 Identities=22% Similarity=0.287 Sum_probs=7.1 Q ss_pred HHHHHHHHHHHHHHHHHH Q ss_conf 059999999999999999 Q gi|254780373|r 17 KLFVTWFVVYTFIGIFCG 34 (172) Q Consensus 17 kl~Iii~~vv~ll~~g~g 34 (172) |-++++++++++++++++ T Consensus 3 k~~~~~~~~~~~~~~~~~ 20 (331) T PRK03598 3 KPVVIGLAVVALVAVGAG 20 (331) T ss_pred CHHHHHHHHHHHHHHHHH T ss_conf 338999999999999999 No 21 >cd03400 Band_7_1 A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic H Probab=79.27 E-value=4.7 Score=19.80 Aligned_cols=82 Identities=13% Similarity=0.153 Sum_probs=56.5 Q ss_pred EEEEECCCCCEEEEEEEEEEECCCHH---------------HHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHH Q ss_conf 02420589833899999985044024---------------542189999999998418988950889999999999999 Q gi|254780373|r 88 IITNFDSSPKDWLRLDIALICKDIPD---------------KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER 152 (172) Q Consensus 88 fvvNL~~~~~r~lk~~i~l~~~~~~~---------------e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~ 152 (172) +.|.-.++ --+.+++++.++-... .-..|.+|+.+-...+..++++|=+ ..|..+..+|.+. T Consensus 14 ~~vlskdg--l~v~~dvtV~Y~v~~~~~~~l~~~~G~~y~~~iI~p~vrs~~R~v~~~y~a~elys-~kR~~i~~~I~~~ 90 (124) T cd03400 14 IDVLSKEG--LSINADVSVQYRINPNKAAAVHSKLGTDYARKIVRPTFRSLVREVTGRYTAEQIYS-TKRKEIESAIKKE 90 (124) T ss_pred EEEECCCC--CEEEEEEEEEEEECHHHHHHHHHHHCCCHHHEEECHHHHHHHHHHHCCCCHHHHHH-HHHHHHHHHHHHH T ss_conf 88787899--78999999999998888999999849777773521789999999973378999988-5799999999999 Q ss_pred HHHHC-C-C-CEEEEEEEEEECC Q ss_conf 85423-5-6-3125764322019 Q gi|254780373|r 153 VKLRS-Q-G-FVSSVIFRTFIIA 172 (172) Q Consensus 153 in~~~-~-g-~V~~V~Ft~fVv~ 172 (172) ++... + | .|++|+++++..+ T Consensus 91 l~~~l~~~gi~ve~VlIr~I~lP 113 (124) T cd03400 91 LIEEFVGDGLILEEVLLRNIKLP 113 (124) T ss_pred HHHHHHHCCEEEEEEEEEEEECC T ss_conf 99988638959999999975289 No 22 >COG5353 Uncharacterized protein conserved in bacteria [Function unknown] Probab=78.00 E-value=2.8 Score=21.03 Aligned_cols=42 Identities=12% Similarity=-0.006 Sum_probs=19.6 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHH Q ss_conf 320599999999999999999999997067876520124556 Q gi|254780373|r 15 QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKF 56 (172) Q Consensus 15 ~~kl~Iii~~vv~ll~~g~g~~~~~~~~~~~~~~~~~~~~~~ 56 (172) +...+|+|++++.++..+.+++++..-+.+.....+++.... T Consensus 4 k~~~~i~ii~viflai~~s~~~~~~~s~~P~~~~~~qA~~~a 45 (161) T COG5353 4 KHLIIIIIILVIFLAIILSIALFFWKSMKPYHEAEEQAIDLA 45 (161) T ss_pred EEEEEEHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH T ss_conf 476622468899999999999987575184421688999987 No 23 >PRK06770 hypothetical protein; Provisional Probab=74.35 E-value=4.9 Score=19.69 Aligned_cols=25 Identities=8% Similarity=-0.105 Sum_probs=12.4 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 2059999999999999999999999 Q gi|254780373|r 16 HKLFVTWFVVYTFIGIFCGWLGGIV 40 (172) Q Consensus 16 ~kl~Iii~~vv~ll~~g~g~~~~~~ 40 (172) ...++.+++.++++++|.++...++ T Consensus 4 ~~kwi~ii~~~~Vl~ig~tygml~y 28 (185) T PRK06770 4 LFKWIGIIAGMAVLGIGVTYGMLYY 28 (185) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999888777887 No 24 >TIGR01495 ETRAMP early transcribed membrane protein (ETRAMP) family; InterPro: IPR006389 These sequences represent a family of proteins from the malaria parasite Plasmodium falciparum, several of which have been shown to be expressed specifically in the ring stage as well as the rodent parasite Plasmodium yoelii . A homolog from Plasmodium chabaudi was localized to the parasitophorous vacuole membrane . Members have an initial hydrophobic, Phe/Tyr-rich stretch long enough to span the membrane, a highly charged region rich in Lys, a second putative transmembrane region, and a second highly charged, low complexity sequence region. Some members have up to 100 residues of additional C-terminal sequence. These genes have been shown to be found in the sub-telomeric regions of both Plasmodium falciparum and P. yoelii chromosomes.. Probab=74.17 E-value=3.7 Score=20.34 Aligned_cols=38 Identities=8% Similarity=-0.133 Sum_probs=18.1 Q ss_pred CCCCC--CCCCHHHHH-HHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 32346--763205999-999999999999999999970678 Q gi|254780373|r 8 SQYIR--GNQHKLFVT-WFVVYTFIGIFCGWLGGIVMLFLF 45 (172) Q Consensus 8 ~~~~k--G~~~kl~Ii-i~~vv~ll~~g~g~~~~~~~~~~~ 45 (172) .+.+| -+++.+++= .++..+.+.+|.|.++|+++-... T Consensus 53 ~~~~KkNr~~k~ilySl~~as~lAlL~g~~~GlG~y~~~K~ 93 (99) T TIGR01495 53 AEKKKKNRNKKIILYSLSIASGLALLVGAGVGLGYYYKKKN 93 (99) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 99987777522799989999999999999999999875236 No 25 >pfam09716 ETRAMP Malarial early transcribed membrane protein (ETRAMP). These sequences represent a family of proteins from the malaria parasite Plasmodium falciparum, several of which have been shown to be expressed specifically in the ring stage as well as the rodent parasite Plasmodium yoelii. A homologue from Plasmodium chabaudi was localized to the parasitophorous vacuole membrane. Members have an initial hydrophobic, Phe/Tyr-rich, stretch long enough to span the membrane, a highly charged region rich in Lys, a second putative transmembrane region and a second highly charged, low complexity sequence region. Some members have up to 100 residues of additional C-terminal sequence. These genes have been shown to be found in the sub-telomeric regions of both Plasmodium falciparum and P. yoelii chromosomes. Probab=72.89 E-value=2.8 Score=21.01 Aligned_cols=34 Identities=12% Similarity=-0.048 Sum_probs=17.9 Q ss_pred CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 3234676320599999999999999999999997 Q gi|254780373|r 8 SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVM 41 (172) Q Consensus 8 ~~~~kG~~~kl~Iii~~vv~ll~~g~g~~~~~~~ 41 (172) -+.++.++++++|..+...+.+++|.+++++++. T Consensus 44 ~~kKkk~kK~~iiSsias~lalli~~~~G~g~y~ 77 (84) T pfam09716 44 LEKKKKNKKKIIISSIASGLALLIGTALGLGYYK 77 (84) T ss_pred HHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9998863412008999999999999888876541 No 26 >PRK01844 hypothetical protein; Provisional Probab=71.59 E-value=6.4 Score=19.06 Aligned_cols=23 Identities=22% Similarity=0.080 Sum_probs=12.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 59999999999999999999999 Q gi|254780373|r 18 LFVTWFVVYTFIGIFCGWLGGIV 40 (172) Q Consensus 18 l~Iii~~vv~ll~~g~g~~~~~~ 40 (172) ++|+++++.+++|+.+|+|..-. T Consensus 5 ~~Ili~i~~li~G~~~GffiaRk 27 (72) T PRK01844 5 LGILVGVVALVAGVALGFFIARK 27 (72) T ss_pred HHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999999 No 27 >pfam07423 DUF1510 Protein of unknown function (DUF1510). This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown. Probab=70.38 E-value=4 Score=20.19 Aligned_cols=12 Identities=25% Similarity=0.213 Sum_probs=4.3 Q ss_pred HHHHHHHHHHHH Q ss_conf 999999999999 Q gi|254780373|r 20 VTWFVVYTFIGI 31 (172) Q Consensus 20 Iii~~vv~ll~~ 31 (172) |+|.+|++|+++ T Consensus 18 iaI~iV~llIii 29 (214) T pfam07423 18 IAIGIVVVLIII 29 (214) T ss_pred HHHHHHHHHHHH T ss_conf 999999999999 No 28 >PRK11636 mrcA peptidoglycan synthetase; Provisional Probab=66.24 E-value=5.1 Score=19.61 Aligned_cols=25 Identities=16% Similarity=0.029 Sum_probs=10.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 0599999999999999999999997 Q gi|254780373|r 17 KLFVTWFVVYTFIGIFCGWLGGIVM 41 (172) Q Consensus 17 kl~Iii~~vv~ll~~g~g~~~~~~~ 41 (172) |.+++++++++++++++++++++++ T Consensus 5 k~~~~~~~~~~~~~~~~~~~~~~~~ 29 (850) T PRK11636 5 KYFLILAVCCILLGAGSIYGLYRYI 29 (850) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999987 No 29 >COG2959 HemX Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Probab=63.95 E-value=8.5 Score=18.39 Aligned_cols=27 Identities=11% Similarity=-0.020 Sum_probs=10.6 Q ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 676320599999999999999999999 Q gi|254780373|r 12 RGNQHKLFVTWFVVYTFIGIFCGWLGG 38 (172) Q Consensus 12 kG~~~kl~Iii~~vv~ll~~g~g~~~~ 38 (172) |++...++..+.++++|..++|||+++ T Consensus 28 k~g~g~~l~~~all~aLgLGagg~~f~ 54 (391) T COG2959 28 KNGAGLLLSLAALLLALGLGAGGYYFG 54 (391) T ss_pred CCCCHHHHHHHHHHHHHHHCHHHHHHH T ss_conf 788426889999999998440578888 No 30 >COG3167 PilO Tfp pilus assembly protein PilO [Cell motility and secretion / Intracellular trafficking and secretion] Probab=62.85 E-value=6.6 Score=18.97 Aligned_cols=26 Identities=12% Similarity=0.097 Sum_probs=13.3 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 205999999999999999999999970678 Q gi|254780373|r 16 HKLFVTWFVVYTFIGIFCGWLGGIVMLFLF 45 (172) Q Consensus 16 ~kl~Iii~~vv~ll~~g~g~~~~~~~~~~~ 45 (172) .++++++++++++++.| |++++++.. T Consensus 23 ~rlv~~lL~~~~V~~lG----y~f~~s~k~ 48 (211) T COG3167 23 PRLVFCLLAVAAVLGLG----YAFYLSGKL 48 (211) T ss_pred HHHHHHHHHHHHHHHHH----HHHHHCCHH T ss_conf 79999999999999999----999854078 No 31 >pfam09551 Spore_II_R Stage II sporulation protein R (spore_II_R). SpoIIR is designated stage II sporulation protein R. A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species. SpoIIR is a signalling protein that links the activation of sigma E to the transcriptional activity of sigma F during sporulation. Probab=62.69 E-value=12 Score=17.64 Aligned_cols=33 Identities=9% Similarity=0.297 Sum_probs=26.3 Q ss_pred EEEEEEEEEECCCHHHHHHHHHHHHHHHHHHCC Q ss_conf 899999985044024542189999999998418 Q gi|254780373|r 99 WLRLDIALICKDIPDKVFLETLHQDIMAYIRTV 131 (172) Q Consensus 99 ~lk~~i~l~~~~~~~e~~~p~Ird~il~~L~~~ 131 (172) -+|+-+-.-.+.+++..++-.+||.++.+|+.. T Consensus 5 ~iRfHVlANSDs~~DQ~lKl~VRD~Vl~~~~~~ 37 (132) T pfam09551 5 LIRFHVLANSDSPEDQALKLKVRDEVLEYLTPK 37 (132) T ss_pred EEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHH T ss_conf 189999827999899999999899999999998 No 32 >pfam12245 DUF3607 Protein of unknown function (DUF3607). This family of proteins is found in bacteria. Proteins in this family are typically between 202 and 818 amino acids in length. There are two conserved sequence motifs: AGN and GMT. Probab=62.27 E-value=12 Score=17.60 Aligned_cols=27 Identities=15% Similarity=0.115 Sum_probs=21.1 Q ss_pred CEEECCCCEEEEECCCCCEEEEEEEEE Q ss_conf 302103320242058983389999998 Q gi|254780373|r 80 LQIFSLQPIITNFDSSPKDWLRLDIAL 106 (172) Q Consensus 80 ~~~~~l~~fvvNL~~~~~r~lk~~i~l 106 (172) .++-+-..+++||..+=+||+|+.+.- T Consensus 43 ~yiNP~~~it~~LssGLDRk~kvsV~r 69 (721) T pfam12245 43 NYINPVGSITVALSSGLDRKVKLSVLR 69 (721) T ss_pred CEECCCCCEEEEEECCCCCEEEEEEEE T ss_conf 300788747999841655307999995 No 33 >PRK10927 essential cell division protein; Provisional Probab=61.61 E-value=4.5 Score=19.88 Aligned_cols=12 Identities=0% Similarity=0.099 Sum_probs=4.7 Q ss_pred HHHHCCCCCCCC Q ss_conf 997067876520 Q gi|254780373|r 39 IVMLFLFAGQKE 50 (172) Q Consensus 39 ~~~~~~~~~~~~ 50 (172) +||+....++.. T Consensus 51 LyFith~K~e~~ 62 (319) T PRK10927 51 LYFITHHKKEES 62 (319) T ss_pred EEEEECCCCCCC T ss_conf 478870587667 No 34 >TIGR00247 TIGR00247 conserved hypothetical protein TIGR00247; InterPro: IPR003770 This family contains several aminodeoxychorismate lyase proteins. Aminodeoxychorismate lyase is a pyridoxal 5'-phosphate-dependent enzyme that converts 4-aminodeoxychorismate to pyruvate and p-aminobenzoate, a precursor of folic acid in bacteria . . Probab=61.48 E-value=11 Score=17.74 Aligned_cols=21 Identities=10% Similarity=0.080 Sum_probs=11.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999 Q gi|254780373|r 20 VTWFVVYTFIGIFCGWLGGIV 40 (172) Q Consensus 20 Iii~~vv~ll~~g~g~~~~~~ 40 (172) |+|..+++|+++.||++.+.+ T Consensus 16 i~i~~~~vll~~~gs~~~y~~ 36 (373) T TIGR00247 16 IIILLLLVLLLIIGSILLYKI 36 (373) T ss_pred HHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999988998877 No 35 >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Probab=60.96 E-value=13 Score=17.46 Aligned_cols=24 Identities=8% Similarity=-0.007 Sum_probs=9.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 599999999999999999999997 Q gi|254780373|r 18 LFVTWFVVYTFIGIFCGWLGGIVM 41 (172) Q Consensus 18 l~Iii~~vv~ll~~g~g~~~~~~~ 41 (172) +.+.+.++++++++.+++++|++. T Consensus 9 ~r~~i~i~~v~~~~~~~~~~w~~~ 32 (310) T PRK10559 9 SRTAITVVLVILAFIAIFNAWVYY 32 (310) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999999999999862 No 36 >COG5294 Uncharacterized protein conserved in bacteria [Function unknown] Probab=58.67 E-value=8.8 Score=18.32 Aligned_cols=19 Identities=11% Similarity=0.167 Sum_probs=11.3 Q ss_pred EEEEECCCCCEEEEEEEEE Q ss_conf 0242058983389999998 Q gi|254780373|r 88 IITNFDSSPKDWLRLDIAL 106 (172) Q Consensus 88 fvvNL~~~~~r~lk~~i~l 106 (172) |+.+-..+.++||+++..= T Consensus 72 f~a~~~lr~~aYLKlt~kg 90 (113) T COG5294 72 FTATHNLRKEAYLKLTHKG 90 (113) T ss_pred EEECCCCCCCCEEEEEECC T ss_conf 9714767876379999547 No 37 >COG3197 FixS Uncharacterized protein, possibly involved in nitrogen fixation [Inorganic ion transport and metabolism] Probab=53.61 E-value=14 Score=17.22 Aligned_cols=34 Identities=9% Similarity=-0.124 Sum_probs=18.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHH Q ss_conf 9999999999999999999999706787652012 Q gi|254780373|r 19 FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEK 52 (172) Q Consensus 19 ~Iii~~vv~ll~~g~g~~~~~~~~~~~~~~~~~~ 52 (172) .+.+-+.+++.++|.++|+|.+-.++.++...++ T Consensus 5 ~~Lipvsi~l~~v~l~~flWavksgQyDDl~g~a 38 (58) T COG3197 5 YILIPVSILLGAVGLGAFLWAVKSGQYDDLDGPA 38 (58) T ss_pred EEHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCH T ss_conf 2179999999999999999851357755654638 No 38 >PRK01294 lipase chaperone; Provisional Probab=51.00 E-value=19 Score=16.53 Aligned_cols=15 Identities=0% Similarity=-0.494 Sum_probs=5.4 Q ss_pred HHHHHHHHHHCCCCC Q ss_conf 999999997067876 Q gi|254780373|r 33 CGWLGGIVMLFLFAG 47 (172) Q Consensus 33 ~g~~~~~~~~~~~~~ 47 (172) +++.++++..+.... T Consensus 19 ~~~~~~~~~~~~~~~ 33 (339) T PRK01294 19 LAVWYWLGLPPSSDT 33 (339) T ss_pred HHHHHHHCCCCCCCC T ss_conf 999998065667887 No 39 >PRK10361 DNA recombination protein RmuC; Provisional Probab=49.43 E-value=20 Score=16.39 Aligned_cols=31 Identities=16% Similarity=0.309 Sum_probs=19.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC Q ss_conf 5999999999999999999999970678765 Q gi|254780373|r 18 LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQ 48 (172) Q Consensus 18 l~Iii~~vv~ll~~g~g~~~~~~~~~~~~~~ 48 (172) +-|++.++++|+|+..||++...-.+..... T Consensus 3 ~~~~i~~i~al~G~~igwl~~~~~~~~~~a~ 33 (475) T PRK10361 3 FSIMVYAVIALVGVAIGWLFASYQHAQQKAE 33 (475) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCCHHHH T ss_conf 7799999999999999999999873451446 No 40 >PRK13481 glycosyltransferase; Provisional Probab=49.30 E-value=20 Score=16.37 Aligned_cols=17 Identities=0% Similarity=0.172 Sum_probs=6.4 Q ss_pred CCCCCCCHHHHHHHHHH Q ss_conf 34676320599999999 Q gi|254780373|r 10 YIRGNQHKLFVTWFVVY 26 (172) Q Consensus 10 ~~kG~~~kl~Iii~~vv 26 (172) ++|.+.+++++.+++.+ T Consensus 34 ~k~k~~~~~~~~~~l~~ 50 (269) T PRK13481 34 PKKKKSKRILLKILLTI 50 (269) T ss_pred CCCHHHHHHHHHHHHHH T ss_conf 64225688899999999 No 41 >cd03401 Band_7_prohibitin Band_7_prohibitin. A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup group includes proteins similar to prohibitin (a lipid raft-associated integral membrane protein). Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. These microdomains in addition to being stable scaffolds may also be also dynamic units with their own regulatory functions. Prohibitin is a mitochondrial inner-membrane protein which may act as a chaperone for the stabilization of mitochondrial proteins. Human prohibitin forms a heter-oligomeric complex with Bap-37 (prohibitin 2, a band 7 domain carrying homologue). This complex may protect non-assembled membrane proteins against proteolysis by the m-AAA protease. Prohibitin and Bap-37 yeast homologues have been implicated in yeast longevity and, in the maintenance of mitochondrial morphology. Probab=46.34 E-value=22 Score=16.11 Aligned_cols=53 Identities=9% Similarity=0.118 Sum_probs=41.7 Q ss_pred HHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHHHCC---CCEEEEEEEEEE Q ss_conf 2189999999998418988950889999999999999854235---631257643220 Q gi|254780373|r 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ---GFVSSVIFRTFI 170 (172) Q Consensus 116 ~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in~~~~---g~V~~V~Ft~fV 170 (172) ..|.+++.+=..++..+.+++-+ -|..|..+|.++++.... =.|.+|.+++.- T Consensus 94 l~~~~~~~lR~v~g~~~~~ei~s--~R~~i~~~i~~~l~~~~~~~GI~v~~V~i~~i~ 149 (196) T cd03401 94 LPSIINEVLKAVVAQFTAEELIT--QREEVSALIREALTERAKDFGIILDDVSITHLT 149 (196) T ss_pred HHHHHHHHHHHHHCCCCHHHHHH--HHHHHHHHHHHHHHHHHHHCCEEEEEEEEEECC T ss_conf 99999998898845755999986--599999999999998887289499999998548 No 42 >pfam06365 CD34_antigen CD34/Podocalyxin family. This family consists of several mammalian CD34 antigen proteins. The CD34 antigen is a human leukocyte membrane protein expressed specifically by lymphohematopoietic progenitor cells. CD34 is a phosphoprotein. Activation of protein kinase C (PKC) has been found to enhance CD34 phosphorylation. This family contains several eukaryotic podocalyxin proteins. Podocalyxin is a major membrane protein of the glomerular epithelium and is thought to be involved in maintenance of the architecture of the foot processes and filtration slits characteristic of this unique epithelium by virtue of its high negative charge. Podocalyxin functions as an anti-adhesin that maintains an open filtration pathway between neighbouring foot processes in the glomerular epithelium by charge repulsion. Probab=45.51 E-value=15 Score=17.02 Aligned_cols=22 Identities=0% Similarity=-0.377 Sum_probs=8.8 Q ss_pred CHHHHHHHHHH--HHHHHHHHHHH Q ss_conf 20599999999--99999999999 Q gi|254780373|r 16 HKLFVTWFVVY--TFIGIFCGWLG 37 (172) Q Consensus 16 ~kl~Iii~~vv--~ll~~g~g~~~ 37 (172) .+++|.++... +||++.+++.| T Consensus 99 ~~llIaLV~~gs~llLi~~~~~~Y 122 (202) T pfam06365 99 YPTLIALVTSGGFLLLIAAIYTGY 122 (202) T ss_pred CCEEEEHHHHHHHHHHHHHHHHHH T ss_conf 454765287647999999998778 No 43 >TIGR00847 ccoS cytochrome oxidase maturation protein, cbb3-type; InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation . Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. . Probab=44.89 E-value=24 Score=15.99 Aligned_cols=33 Identities=6% Similarity=-0.175 Sum_probs=13.6 Q ss_pred HHHHHHHHHHHHHH--HHHHHHHHCCCCCCCCHHH Q ss_conf 99999999999999--9999997067876520124 Q gi|254780373|r 21 TWFVVYTFIGIFCG--WLGGIVMLFLFAGQKEEKY 53 (172) Q Consensus 21 ii~~vv~ll~~g~g--~~~~~~~~~~~~~~~~~~~ 53 (172) ++++++.++.++.| +|.+-.-.++.++.+-++. T Consensus 5 ~~L~Pisl~lG~~GL~AFlWslksGQyDD~~G~a~ 39 (53) T TIGR00847 5 TILIPISLLLGGVGLVAFLWSLKSGQYDDLEGAAE 39 (53) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHH T ss_conf 77889999999999999998531147888642067 No 44 >TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds. EmrB encodes a highly hydrophobic 56.2-kDa peptide, with 14 potential alpha-helices to span the inner membrane. EmrA encodes a putative 42.7-kDa peptide containing a single hydrophobic domain and a large C-terminal hydrophilic domain.; GO: 0015238 drug transporter activity, 0006855 multidrug transport, 0009276 1-2nm peptidoglycan-based cell wall. Probab=43.06 E-value=25 Score=15.82 Aligned_cols=23 Identities=9% Similarity=0.094 Sum_probs=10.9 Q ss_pred HHCCCHHHHCCHHHHHHHHHHHH Q ss_conf 84189889508899999999999 Q gi|254780373|r 128 IRTVSIKQITGAQGFRYFKEDIE 150 (172) Q Consensus 128 L~~~~~~dl~~~~Gk~~Lk~el~ 150 (172) ||.+...==+.....+++|+.++ T Consensus 115 LsakkL~v~s~~~~~~qar~~l~ 137 (379) T TIGR00998 115 LSAKKLKVESLKIKLEQAREKLK 137 (379) T ss_pred HHHHHHHHHHHHHHHHHHHHHHH T ss_conf 24567889999999999999987 No 45 >PRK11556 multidrug efflux system subunit MdtA; Provisional Probab=42.14 E-value=26 Score=15.74 Aligned_cols=14 Identities=29% Similarity=0.363 Sum_probs=5.8 Q ss_pred CCCCCHHHHHHHHH Q ss_conf 67632059999999 Q gi|254780373|r 12 RGNQHKLFVTWFVV 25 (172) Q Consensus 12 kG~~~kl~Iii~~v 25 (172) |++.+.-|++++++ T Consensus 2 ~~~~~~~~~~~~~~ 15 (415) T PRK11556 2 KGSYKFRWVIVIVV 15 (415) T ss_pred CCCHHHHHHHHHHH T ss_conf 84115589999999 No 46 >PRK10930 FtsH protease regulator HflK; Provisional Probab=40.85 E-value=27 Score=15.63 Aligned_cols=70 Identities=11% Similarity=0.195 Sum_probs=46.3 Q ss_pred EEEEEEEEEEECCCH-----------HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHH-HH----CCCCE Q ss_conf 389999998504402-----------454218999999999841898895088999999999999985-42----35631 Q gi|254780373|r 98 DWLRLDIALICKDIP-----------DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LR----SQGFV 161 (172) Q Consensus 98 r~lk~~i~l~~~~~~-----------~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in-~~----~~g~V 161 (172) ..+.+++.+.++-.. .........+++=.+..+.+.+++-| +||..++.+.++++. ++ ..=.| T Consensus 155 NIVdV~~~VQYrI~dp~~yLFnv~dPe~tlr~aaESAmReVVG~~~~d~vLT-~gR~~Ia~~v~~~lQ~~Ld~Y~~GI~I 233 (419) T PRK10930 155 NVVRVEMNVQYRVTDPEKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILT-EGRTVIRSDTQRELEETIRPYDMGITL 233 (419) T ss_pred CEEEEEEEEEEEECCHHHHEEECCCHHHHHHHHHHHHHHHHHCCCCHHHHHC-CCHHHHHHHHHHHHHHHHHHHCCCCEE T ss_conf 7698778999995685781364578768999999999999976364899964-888999999999999999850899789 Q ss_pred EEEEEEE Q ss_conf 2576432 Q gi|254780373|r 162 SSVIFRT 168 (172) Q Consensus 162 ~~V~Ft~ 168 (172) .+|-|.+ T Consensus 234 ~~V~lq~ 240 (419) T PRK10930 234 LDVNFQA 240 (419) T ss_pred EEEEECC T ss_conf 9988467 No 47 >pfam08229 SHR3_chaperone ER membrane protein SH3. This family of proteins are membrane localized chaperones that are required for correct plasma membrane localisation of amino acid permeases (AAPs). SH3 prevents AAPs proteins from aggregating and assists in their correct folding. In the absence of SH3, AAPs are retained in the ER. Probab=39.72 E-value=29 Score=15.53 Aligned_cols=14 Identities=14% Similarity=0.192 Sum_probs=6.6 Q ss_pred EEECCCCEEEEECC Q ss_conf 02103320242058 Q gi|254780373|r 81 QIFSLQPIITNFDS 94 (172) Q Consensus 81 ~~~~l~~fvvNL~~ 94 (172) ++..+--+++|+.. T Consensus 98 y~~~i~vYltNi~~ 111 (196) T pfam08229 98 YVVGVIVYLTNIVT 111 (196) T ss_pred HHHHHEEEEEECCC T ss_conf 98867035563024 No 48 >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Probab=38.77 E-value=28 Score=15.57 Aligned_cols=29 Identities=3% Similarity=0.002 Sum_probs=11.5 Q ss_pred HHHH---HHHHHHHHHCCCHHHHCCHHHHHHHH Q ss_conf 1899---99999998418988950889999999 Q gi|254780373|r 117 LETL---HQDIMAYIRTVSIKQITGAQGFRYFK 146 (172) Q Consensus 117 ~p~I---rd~il~~L~~~~~~dl~~~~Gk~~Lk 146 (172) -|.+ +..+|..........+ ...-+++|| T Consensus 155 SPel~~AQ~EyL~~~~~~~~~~~-~~aa~~rL~ 186 (407) T PRK09783 155 IPDWVEAQSEYLLLRETGGTATQ-TEGILERLR 186 (407) T ss_pred CHHHHHHHHHHHHHHHHCCCHHH-HHHHHHHHH T ss_conf 88899999999999872797268-899999999 No 49 >PRK10833 putative assembly protein; Provisional Probab=38.62 E-value=30 Score=15.43 Aligned_cols=22 Identities=9% Similarity=0.081 Sum_probs=9.4 Q ss_pred CHHHHHHHHHHHHHHHHHHHHH Q ss_conf 2059999999999999999999 Q gi|254780373|r 16 HKLFVTWFVVYTFIGIFCGWLG 37 (172) Q Consensus 16 ~kl~Iii~~vv~ll~~g~g~~~ 37 (172) |+++++++++++++.+|..++. T Consensus 2 Krll~~l~illvvvv~gl~aLv 23 (617) T PRK10833 2 RRFLTTLMILLVVLVAGLSALV 23 (617) T ss_pred CHHHHHHHHHHHHHHHHHHHHH T ss_conf 4189999999999999999881 No 50 >smart00786 SHR3_chaperone ER membrane protein SH3. This family of proteins are membrane localised chaperones that are required for correct plasma membrane localisation of amino acid permeases (AAPs) PUBMED:15623581. Shr3 prevents AAPs proteins from aggregating and assists in their correct folding. In the absence of Shr3, AAPs are retained in the ER. Probab=38.18 E-value=30 Score=15.39 Aligned_cols=13 Identities=15% Similarity=0.250 Sum_probs=5.7 Q ss_pred EECCCCEEEEECC Q ss_conf 2103320242058 Q gi|254780373|r 82 IFSLQPIITNFDS 94 (172) Q Consensus 82 ~~~l~~fvvNL~~ 94 (172) +..+--+++|+.. T Consensus 99 ~~~i~vYltNi~~ 111 (196) T smart00786 99 VLGVCVYLTNIVK 111 (196) T ss_pred HHHHHEEEEECCC T ss_conf 9867035563024 No 51 >PRK10381 ferric enterobactin transport protein FepE; Provisional Probab=38.05 E-value=30 Score=15.38 Aligned_cols=11 Identities=0% Similarity=0.093 Sum_probs=4.2 Q ss_pred EEEEEEEEECC Q ss_conf 99999985044 Q gi|254780373|r 100 LRLDIALICKD 110 (172) Q Consensus 100 lk~~i~l~~~~ 110 (172) ...++...... T Consensus 170 ~~~~ls~~a~t 180 (379) T PRK10381 170 TSWTLSFTAPT 180 (379) T ss_pred CCEEEEEECCC T ss_conf 33489872598 No 52 >pfam03264 Cytochrom_NNT NapC/NirT cytochrome c family, N-terminal region. Within the NapC/NirT family of cytochrome c proteins, some members, such as NapC and NirT, bind four haem groups, while others, such as TorC, bind five haems. This family aligns the common N-terminal region that contains four haem-binding C-X(2)-CH motifs. Probab=37.84 E-value=31 Score=15.36 Aligned_cols=35 Identities=11% Similarity=0.040 Sum_probs=15.7 Q ss_pred HHHHHHHHHHHCCC-HHHHCCHHHHHHHHHHHHHHHHH Q ss_conf 99999999984189-88950889999999999999854 Q gi|254780373|r 119 TLHQDIMAYIRTVS-IKQITGAQGFRYFKEDIEERVKL 155 (172) Q Consensus 119 ~Ird~il~~L~~~~-~~dl~~~~Gk~~Lk~el~~~in~ 155 (172) -++|....++...+ ++-+. +-+.++.+.-.++++. T Consensus 87 g~~d~~~~~~g~~~~p~k~e--~~r~~~a~~~~~~~~~ 122 (174) T pfam03264 87 ASKEVYAELTGTIDTPEKFE--AHRLEMAERVWARMKA 122 (174) T ss_pred HHHHHHHHHHCCCCCHHHHH--HHHHHHHHHHHHHHHC T ss_conf 69999999962789577887--8789999999999860 No 53 >COG3763 Uncharacterized protein conserved in bacteria [Function unknown] Probab=37.79 E-value=31 Score=15.36 Aligned_cols=21 Identities=19% Similarity=0.371 Sum_probs=9.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHH Q ss_conf 599999999999999999999 Q gi|254780373|r 18 LFVTWFVVYTFIGIFCGWLGG 38 (172) Q Consensus 18 l~Iii~~vv~ll~~g~g~~~~ 38 (172) +.|+++++.+++|+.+|+|.. T Consensus 5 lail~ivl~ll~G~~~G~fia 25 (71) T COG3763 5 LAILLIVLALLAGLIGGFFIA 25 (71) T ss_pred HHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999999999999 No 54 >PRK00059 prsA peptidylprolyl isomerase; Provisional Probab=36.63 E-value=21 Score=16.21 Aligned_cols=18 Identities=33% Similarity=0.266 Sum_probs=6.4 Q ss_pred HHHHHHHHHHHHHHHHHH Q ss_conf 059999999999999999 Q gi|254780373|r 17 KLFVTWFVVYTFIGIFCG 34 (172) Q Consensus 17 kl~Iii~~vv~ll~~g~g 34 (172) |.+|+.+++++++..++| T Consensus 5 ~ki~~~~ii~~~~~~~vg 22 (336) T PRK00059 5 KKIVASLLVGVFIFSAVG 22 (336) T ss_pred HHHHHHHHHHHHHHHHHC T ss_conf 999999999999999830 No 55 >PRK12705 hypothetical protein; Provisional Probab=36.55 E-value=32 Score=15.24 Aligned_cols=26 Identities=15% Similarity=0.319 Sum_probs=15.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 05999999999999999999999970 Q gi|254780373|r 17 KLFVTWFVVYTFIGIFCGWLGGIVML 42 (172) Q Consensus 17 kl~Iii~~vv~ll~~g~g~~~~~~~~ 42 (172) .+++++++++++++.+.|+++.+... T Consensus 8 ~~~~i~~l~~~~ig~~lg~~~~~~~~ 33 (485) T PRK12705 8 LTILVLFLILVLIGLVLGVFIRYLYA 33 (485) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999999999 No 56 >pfam10410 DnaB_bind DnaB-helicase binding domain of primase. This domain is the C-terminal region three-helical domain of primase. Primases synthesize short RNA strands on single-stranded DNA templates, thereby generating the hybrid duplexes required for the initiation of synthesis by DNA polymerases. Primases are recruited to single-stranded DNA by helicases, and this domain is the region of the primase which binds DnaB-helicase. It is associated with the Toprim domain (pfam01751) which is the central catalytic core. Probab=36.24 E-value=11 Score=17.70 Aligned_cols=41 Identities=2% Similarity=0.020 Sum_probs=27.7 Q ss_pred HHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHHHCCCCEEEEEE Q ss_conf 9999841898895088999999999999985423563125764 Q gi|254780373|r 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIF 166 (172) Q Consensus 124 il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in~~~~g~V~~V~F 166 (172) ++..++..- |+++++||.++.+++..-++.+..+-.++.|. T Consensus 5 ~~~~l~~~~--dl~~~egk~~~~~~~~pli~~i~~~~~r~~y~ 45 (59) T pfam10410 5 LFRRLLEGY--DLDTPEGRAALLREALPLIAKIPDPVLRELYL 45 (59) T ss_pred HHHHHHHCC--CCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHH T ss_conf 999987358--99998899999999707875598388999999 No 57 >PRK00720 tatA twin arginine translocase protein A; Provisional Probab=36.14 E-value=33 Score=15.21 Aligned_cols=12 Identities=8% Similarity=0.138 Sum_probs=5.6 Q ss_pred HHHHHHHHHHHH Q ss_conf 999999999999 Q gi|254780373|r 19 FVTWFVVYTFIG 30 (172) Q Consensus 19 ~Iii~~vv~ll~ 30 (172) |+||++|++||. T Consensus 9 ~lIi~~vVllLF 20 (71) T PRK00720 9 WLIVLAVVLLLF 20 (71) T ss_pred HHHHHHHHHHHH T ss_conf 999999999995 No 58 >PRK09859 multidrug efflux system protein MdtE; Provisional Probab=35.67 E-value=20 Score=16.33 Aligned_cols=20 Identities=10% Similarity=0.192 Sum_probs=10.6 Q ss_pred CCCHHHHHHHHHHHHHHHHH Q ss_conf 63205999999999999999 Q gi|254780373|r 14 NQHKLFVTWFVVYTFIGIFC 33 (172) Q Consensus 14 ~~~kl~Iii~~vv~ll~~g~ 33 (172) +++|.+++.+++++++..|| T Consensus 2 ~~k~~~li~ll~~~~lL~gC 21 (385) T PRK09859 2 NRRRKLLIPLLFCGAMLTAC 21 (385) T ss_pred CCHHHHHHHHHHHHHHHHCC T ss_conf 82067899999999999537 No 59 >pfam03645 Tctex-1 Tctex-1 family. Tctex-1 is a dynein light chain. It has been shown that Tctex-1 can bind to the cytoplasmic tail of rhodopsin. C-terminal rhodopsin mutations responsible for retinitis pigmentosa inhibit this interaction. Probab=34.43 E-value=35 Score=15.05 Aligned_cols=53 Identities=17% Similarity=0.049 Sum_probs=40.3 Q ss_pred HHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHHHCCCC---EEEEEEE Q ss_conf 4218999999999841898895088999999999999985423563---1257643 Q gi|254780373|r 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF---VSSVIFR 167 (172) Q Consensus 115 ~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in~~~~g~---V~~V~Ft 167 (172) .....|++.+-..|.+.+|+.-....--..|.++|++++..+...+ |-.+++. T Consensus 3 ~v~~ii~~~l~~~L~~~~Y~~~~~~~~~~~i~~~I~~~lk~l~~~ryK~vv~v~I~ 58 (101) T pfam03645 3 EVKEIIKEVLEEKLGGVEYDHEKVQQWSKEISETILKRLKELGGKRYKYVVQVTIG 58 (101) T ss_pred HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEE T ss_conf 89999999999987899518699999999999999999984279871799999998 No 60 >TIGR02223 ftsN cell division protein FtsN; InterPro: IPR011930 FtsN is a poorly conserved protein active in cell division in a number of Proteobacteria. The N-terminal 30 residue region tends to by Lys/Arg-rich, and is followed by a membrane-spanning region. This is followed by an acidic low-complexity region of variable length and a well-conserved C-terminal domain of two tandem regions (Sporulation related repeat), found in several cell division and sporulation proteins. The role of FtsN as a suppressor for other cell division mutations is poorly understood; it may involve cell wall hydrolysis .. Probab=32.37 E-value=38 Score=14.86 Aligned_cols=48 Identities=8% Similarity=-0.105 Sum_probs=21.1 Q ss_pred CCHHHHHHHHHHHHHHHHHHH---------HHHHHHHCCCCCCCCHHHHHHHHHHCCC Q ss_conf 320599999999999999999---------9999970678765201245565310112 Q gi|254780373|r 15 QHKLFVTWFVVYTFIGIFCGW---------LGGIVMLFLFAGQKEEKYQKFILNNFYD 63 (172) Q Consensus 15 ~~kl~Iii~~vv~ll~~g~g~---------~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 63 (172) ...+++|.+++++|+. |++. -+|+|++..+.................+ T Consensus 33 ~~a~~~ia~~~i~l~~-g~~~DPaDsnPaPqagl~~~~~~~~~~~~~~~~~k~~~~~~ 89 (354) T TIGR02223 33 VRATVLIAVILILLFI-GGSSDPADSNPAPQAGLYLLTESKQAKEPEVLQPKNQTENG 89 (354) T ss_pred CHHHHHHHHHHHHHHH-HCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCC T ss_conf 2489999999999986-12567434663236663433057788887666555546777 No 61 >pfam03896 TRAP_alpha Translocon-associated protein (TRAP), alpha subunit. The alpha-subunit of the TRAP complex (TRAP alpha) is a single-spanning membrane protein of the endoplasmic reticulum (ER) which is found in proximity of nascent polypeptide chains translocating across the membrane. Probab=31.26 E-value=40 Score=14.75 Aligned_cols=25 Identities=8% Similarity=0.211 Sum_probs=13.2 Q ss_pred EEEEECCC-CCEEEEEEEEEEECCCH Q ss_conf 02420589-83389999998504402 Q gi|254780373|r 88 IITNFDSS-PKDWLRLDIALICKDIP 112 (172) Q Consensus 88 fvvNL~~~-~~r~lk~~i~l~~~~~~ 112 (172) |+|-+.+. ...|+-..+...+++|. T Consensus 99 fLVGF~NkG~~df~Vesi~ASfryP~ 124 (281) T pfam03896 99 FLVGFTNKGSEDFVVESLEASFRYPQ 124 (281) T ss_pred EEEEECCCCCCCEEEEEEEEEECCCC T ss_conf 99974247863258998643340675 No 62 >COG3322 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Probab=29.48 E-value=43 Score=14.58 Aligned_cols=30 Identities=13% Similarity=0.247 Sum_probs=14.0 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 205999999999999999999999970678 Q gi|254780373|r 16 HKLFVTWFVVYTFIGIFCGWLGGIVMLFLF 45 (172) Q Consensus 16 ~kl~Iii~~vv~ll~~g~g~~~~~~~~~~~ 45 (172) +|.++++..+++++.++.+++...++.... T Consensus 10 ~kvl~~~~~i~aal~~~~~~~~~~il~s~f 39 (295) T COG3322 10 KKVLIILLAIFAALTAALGGASYNILLSSF 39 (295) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 899999999999999999999999999854 No 63 >TIGR02898 spore_YhcN_YlaJ sporulation lipoprotein, YhcN/YlaJ family; InterPro: IPR014247 This entry contains YhcN and YlaJ, which are predicted lipoproteins that have been detected as spore proteins but not vegetative proteins in Bacillus subtilis. Both appear to be expressed under control of the RNA polymerase sigma-G factor. The YlaJ-like members of this family have a low-complexity, strongly acidic, 40-residue C-terminal domain. . Probab=28.24 E-value=34 Score=15.08 Aligned_cols=17 Identities=18% Similarity=0.530 Sum_probs=10.9 Q ss_pred HHHHHHHHHHHHHHHHH Q ss_conf 59999999999999999 Q gi|254780373|r 18 LFVTWFVVYTFIGIFCG 34 (172) Q Consensus 18 l~Iii~~vv~ll~~g~g 34 (172) |++++++.++|++.||+ T Consensus 2 l~~~ll~~~~l~~tgC~ 18 (185) T TIGR02898 2 LFIILLLLLLLLATGCT 18 (185) T ss_pred HHHHHHHHHHHHHHCCC T ss_conf 68899999999873134 No 64 >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily; InterPro: IPR014345 Members of this entry belong to the family of polysaccharide chain length determinant proteins. They are found in species that encode the PEP-CTERM/exosortase system and are predicted to act in protein sorting in a number of Gram-negative bacteria, they are also found near the epsH homologue that is the putative exosortase gene.. Probab=28.23 E-value=45 Score=14.46 Aligned_cols=40 Identities=8% Similarity=0.225 Sum_probs=31.4 Q ss_pred HHHHHHHHHCCCHH-HHCCHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 99999998418988-95088999999999999985423563 Q gi|254780373|r 121 HQDIMAYIRTVSIK-QITGAQGFRYFKEDIEERVKLRSQGF 160 (172) Q Consensus 121 rd~il~~L~~~~~~-dl~~~~Gk~~Lk~el~~~in~~~~g~ 160 (172) |-.+..+++..+.| .+++++-++.|=++|.+.|.+...|+ T Consensus 80 Rp~l~~V~r~~DlD~~~~~pa~~E~li~~l~~~i~i~~~gr 120 (510) T TIGR03007 80 RPNLEKVIRMLDLDVGAKSPAQLEALITKLQKNISISLAGR 120 (510) T ss_pred HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCEEEECCC T ss_conf 45789999885267776998999999998761434611167 No 65 >PRK06287 cobalt transport protein CbiN; Validated Probab=28.18 E-value=45 Score=14.45 Aligned_cols=17 Identities=12% Similarity=0.067 Sum_probs=7.9 Q ss_pred CHHHHHHHHHHHHHHHH Q ss_conf 20599999999999999 Q gi|254780373|r 16 HKLFVTWFVVYTFIGIF 32 (172) Q Consensus 16 ~kl~Iii~~vv~ll~~g 32 (172) .|.+++..++++|+.++ T Consensus 3 nkkfli~g~~iALlia~ 19 (105) T PRK06287 3 NKKFLIAGLIIALLIGI 19 (105) T ss_pred CCEEEHHHHHHHHHHHH T ss_conf 73765679999999998 No 66 >PRK00523 hypothetical protein; Provisional Probab=27.88 E-value=46 Score=14.42 Aligned_cols=21 Identities=14% Similarity=0.070 Sum_probs=8.8 Q ss_pred HHHHHHHHHHHHHHH-HHHHHH Q ss_conf 599999999999999-999999 Q gi|254780373|r 18 LFVTWFVVYTFIGIF-CGWLGG 38 (172) Q Consensus 18 l~Iii~~vv~ll~~g-~g~~~~ 38 (172) +.|.+.+++++++++ +|+|+. T Consensus 5 l~iglgiil~li~G~~~Gff~a 26 (73) T PRK00523 5 LILGLGIPLSLIVGGIIGYFVS 26 (73) T ss_pred HHHHHHHHHHHHHHHHHHHHHH T ss_conf 7659989999999999999999 No 67 >pfam09624 DUF2393 Protein of unknown function (DUF2393). The function of this protein is unknown. It is always found as part of a two-gene operon with IPR013416, a protein that appears to span the membrane seven times. It has so far been found in the bacteria Nostoc sp. PCC 7120, Agrobacterium tumefaciens, Rhizobium meliloti, and Gloeobacter violaceus. Probab=27.68 E-value=46 Score=14.40 Aligned_cols=29 Identities=10% Similarity=-0.101 Sum_probs=14.4 Q ss_pred CCEEECCCCEEE-EECCCCCEEEEEEEEEEECC Q ss_conf 530210332024-20589833899999985044 Q gi|254780373|r 79 KLQIFSLQPIIT-NFDSSPKDWLRLDIALICKD 110 (172) Q Consensus 79 ~~~~~~l~~fvv-NL~~~~~r~lk~~i~l~~~~ 110 (172) ..||+ ||.+ |.++....-+++.-.|...+ T Consensus 46 ~qyyV---pF~v~N~Gg~TAa~V~V~geL~~~~ 75 (119) T pfam09624 46 GQFYV---PFAVRNDGGQTAAAVTVIGELRQGG 75 (119) T ss_pred CEEEE---EEEEEECCCCEEEEEEEEEEECCCC T ss_conf 87899---9999968866777999999997699 No 68 >pfam08999 SP_C-Propep Surfactant protein C, N terminal propeptide. The N-terminal propeptide of surfactant protein C adopts an alpha-helical structure, with turn and extended regions. It's main function is the stabilisation of metastable surfactant protein C (SP-C), since the latter can irreversibly transform from its native alpha-helical structure to beta-sheet aggregates and form amyloid-like fibrils. The correct intracellular trafficking of proSP-C has also been reported to depend on the propeptide. Probab=27.57 E-value=46 Score=14.39 Aligned_cols=20 Identities=20% Similarity=0.356 Sum_probs=8.3 Q ss_pred CHHHHHHHHHHHHHHHHHHH Q ss_conf 20599999999999999999 Q gi|254780373|r 16 HKLFVTWFVVYTFIGIFCGW 35 (172) Q Consensus 16 ~kl~Iii~~vv~ll~~g~g~ 35 (172) +.++|+++++++++.+..|+ T Consensus 34 krlli~vvvvvlvvvvivga 53 (93) T pfam08999 34 KRLLIVVVVVVLVVVVIVGA 53 (93) T ss_pred HHHHHHHHHHHHHHHHHHHH T ss_conf 65131023346789999999 No 69 >cd03403 Band_7_stomatin_like Band_7_stomatin_like: A subgroup of the band 7 domain of flotillin (reggie) like proteins similar to stomatin and podicin (two lipid raft-associated integral membrane proteins). Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Stomatin is widely expressed and, highly expressed in red blood cells. It localizes predominantly to the plasma membrane and to intracellular vesicles of the endocytic pathway, where it is present in higher order homo-oligomeric complexes (of between 9 and 12 monomers). Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and, is implicated in trafficking of Glut1 glucose transporters. Prohibitin is a mitochondrial inner-membrane protein hypothesized to act as a chaperone for the stabilization of mitochondrial proteins. Podicin local Probab=27.14 E-value=47 Score=14.35 Aligned_cols=71 Identities=13% Similarity=0.140 Sum_probs=49.3 Q ss_pred EEEEEEEEEEEC--CCH---------HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHHHCC---CCEEE Q ss_conf 389999998504--402---------4542189999999998418988950889999999999999854235---63125 Q gi|254780373|r 98 DWLRLDIALICK--DIP---------DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ---GFVSS 163 (172) Q Consensus 98 r~lk~~i~l~~~--~~~---------~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in~~~~---g~V~~ 163 (172) ..+.+++.+.++ ++. .....+.+++.+-..+++.+.+++-+ .|+.|.++|.+.++.... =.|.+ T Consensus 57 ~~v~v~~~v~yrI~dp~~~~~~v~~~~~~l~~~~~~~lR~~i~~~~~~~i~~--~R~~i~~~i~~~l~~~l~~~Gi~v~~ 134 (215) T cd03403 57 VTVRVDAVLYYRVVDPVKAVYGVEDYRYAISQLAQTTLRSVIGKMELDELLS--EREEINAELVEILDEATDPWGVKVER 134 (215) T ss_pred CEEEEEEEEEEEECCHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCHHHHHH--HHHHHHHHHHHHHHHHHHCCCEEEEE T ss_conf 7899999999995788999973289999999999999998853233899985--49999999999999872128859999 Q ss_pred EEEEEEE Q ss_conf 7643220 Q gi|254780373|r 164 VIFRTFI 170 (172) Q Consensus 164 V~Ft~fV 170 (172) |.++++. T Consensus 135 v~i~~i~ 141 (215) T cd03403 135 VEIKDII 141 (215) T ss_pred EEEEECC T ss_conf 9997538 No 70 >pfam06796 NapE Periplasmic nitrate reductase protein NapE. This family consists of several bacterial periplasmic nitrate reductase NapE proteins. Seven genes, napKEFDABC, encoding the periplasmic nitrate reductase system were cloned from the denitrifying phototrophic bacterium Rhodobacter sphaeroides f. sp. denitrificans IL106. NapE is thought to be a transmembrane protein. Probab=27.01 E-value=47 Score=14.33 Aligned_cols=23 Identities=17% Similarity=0.189 Sum_probs=10.7 Q ss_pred CCCCCCCC-CCCCCCCCHHHHHHH Q ss_conf 98543553-234676320599999 Q gi|254780373|r 1 MSYDDTTS-QYIRGNQHKLFVTWF 23 (172) Q Consensus 1 ma~~~~~~-~~~kG~~~kl~Iii~ 23 (172) |+++..++ +..|+.-.|.++++. T Consensus 1 Ms~~~~~~~~~~k~~El~~f~fl~ 24 (55) T pfam06796 1 MSEQPSSTEKERKRKELKAFLFLT 24 (55) T ss_pred CCCCCCCCCCHHHHHHHHHHHHHH T ss_conf 987899998103479999999999 No 71 >KOG0860 consensus Probab=26.38 E-value=49 Score=14.27 Aligned_cols=21 Identities=5% Similarity=0.370 Sum_probs=10.5 Q ss_pred HHHHHHHHHHHH-HCCCHHHHC Q ss_conf 189999999998-418988950 Q gi|254780373|r 117 LETLHQDIMAYI-RTVSIKQIT 137 (172) Q Consensus 117 ~p~Ird~il~~L-~~~~~~dl~ 137 (172) ...+|+.+--+| |....++|. T Consensus 42 v~IMr~NV~KVlER~ekL~~L~ 63 (116) T KOG0860 42 VDIMRENVEKVLERGEKLDELD 63 (116) T ss_pred HHHHHHHHHHHHHHCCHHHHHH T ss_conf 9999991999998202087899 No 72 >PRK11677 cytochrome d ubiquinol oxidase subunit III; Provisional Probab=26.33 E-value=49 Score=14.26 Aligned_cols=22 Identities=14% Similarity=0.076 Sum_probs=10.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHC Q ss_conf 9999999999999999999706 Q gi|254780373|r 22 WFVVYTFIGIFCGWLGGIVMLF 43 (172) Q Consensus 22 i~~vv~ll~~g~g~~~~~~~~~ 43 (172) +.++.+++|+.+|++++.+..+ T Consensus 5 ~ali~lvvGiiIG~~~~R~~~~ 26 (134) T PRK11677 5 YALIGLVVGIIIGAVAMRFGNR 26 (134) T ss_pred HHHHHHHHHHHHHHHHHHHCCC T ss_conf 9999999999999999998175 No 73 >cd03404 Band_7_HflK Band_7_HflK: The band 7 domain of flotillin (reggie) like proteins. This group includes proteins similar to prokaryotic HlfK (High frequency of lysogenization K). Although many members of the band 7 family are lipid raft associated, prokaryote plasma membranes lack cholesterol and are unlikely to have lipid raft domains. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Escherichia coli HflK is an integral membrane protein which may localize to the plasma membrane. HflK associates with another band 7 family member (HflC) to form an HflKC complex. HflKC interacts with FtsH in a large complex termed the FtsH holo-enzyme. FtsH is an AAA ATP-dependent protease which exerts progressive proteolysis against membrane-embedded and soluble substrate proteins. HflKC can modulate the activity of FtsH. HflKC plays a role in the decision between lysogenic and lytic cycle growth during la Probab=26.32 E-value=49 Score=14.26 Aligned_cols=70 Identities=9% Similarity=0.124 Sum_probs=48.4 Q ss_pred EEEEEEEEEEC--CCH---------HHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHHHC-----CCCEE Q ss_conf 89999998504--402---------454218999999999841898895088999999999999985423-----56312 Q gi|254780373|r 99 WLRLDIALICK--DIP---------DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVS 162 (172) Q Consensus 99 ~lk~~i~l~~~--~~~---------~e~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in~~~-----~g~V~ 162 (172) .+.+...+.++ ++. .....+.+++.+-..+++.+.+++-+ .++..+.++++++++... +=.|. T Consensus 87 ~v~vd~~v~yrI~dp~~~~~~~~~~~~~l~~~~~~~lR~~ig~~~lde~l~-~~R~~i~~~i~~~l~~~~~~~~~GI~v~ 165 (266) T cd03404 87 IVDVEFAVQYRISDPYDYLFNVRDPEGTLRQAAESAMREVVGRSTLDDVLT-EGREEIAQDVRELLQAILDAYKAGIEIV 165 (266) T ss_pred EEEEEEEEEEEECCHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCHHHHHH-CCHHHHHHHHHHHHHHHHHCCCCCEEEE T ss_conf 899999999998868998886258999999999999999972660688864-3799999999999999873456867999 Q ss_pred EEEEEEE Q ss_conf 5764322 Q gi|254780373|r 163 SVIFRTF 169 (172) Q Consensus 163 ~V~Ft~f 169 (172) +|-+++. T Consensus 166 ~V~i~~i 172 (266) T cd03404 166 GVNLQDA 172 (266) T ss_pred EEEEEEC T ss_conf 9997526 No 74 >PRK11901 hypothetical protein; Reviewed Probab=26.24 E-value=49 Score=14.25 Aligned_cols=18 Identities=17% Similarity=0.095 Sum_probs=9.7 Q ss_pred HHHHHHHHHHHHHHHHHH Q ss_conf 599999999999999999 Q gi|254780373|r 18 LFVTWFVVYTFIGIFCGW 35 (172) Q Consensus 18 l~Iii~~vv~ll~~g~g~ 35 (172) |+-+-++|++||.+|+|- T Consensus 39 MiGiGILVLLLLIIgIgS 56 (329) T PRK11901 39 MIGIGILVLLLLIIAIGS 56 (329) T ss_pred HHHHHHHHHHHHHHHHHH T ss_conf 999999999999998656 No 75 >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF. Probab=26.14 E-value=33 Score=15.22 Aligned_cols=22 Identities=18% Similarity=0.329 Sum_probs=13.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999997 Q gi|254780373|r 20 VTWFVVYTFIGIFCGWLGGIVM 41 (172) Q Consensus 20 Iii~~vv~ll~~g~g~~~~~~~ 41 (172) |+++++.+++|++.||++..+. T Consensus 1 Ii~~ii~lviG~~iGy~l~k~~ 22 (514) T TIGR03319 1 ILLALVALIVGLIIGYLLRKRI 22 (514) T ss_pred CCHHHHHHHHHHHHHHHHHHHH T ss_conf 9068999999999999999999 No 76 >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Probab=25.64 E-value=50 Score=14.19 Aligned_cols=30 Identities=7% Similarity=0.167 Sum_probs=12.5 Q ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 676320599999999999999999999997 Q gi|254780373|r 12 RGNQHKLFVTWFVVYTFIGIFCGWLGGIVM 41 (172) Q Consensus 12 kG~~~kl~Iii~~vv~ll~~g~g~~~~~~~ 41 (172) +.+.++.++.+.+++++.++..||+++.+. T Consensus 9 ~~~~k~~~~~~~~~~~~~a~~~~~~~~~~~ 38 (352) T COG1566 9 KAKRKRFKLPLTLLVVLAAVLYGGLIWLYY 38 (352) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 445567788999999999999999999972 No 77 >TIGR01215 minE cell division topological specificity factor MinE; InterPro: IPR005527 Cytokinesis needs to be regulated spatially in order to ensure that it occurs between the daughter genomes. In prokaryotes such as Escherichia coli, cytokinesis is initiated by FtsZ, a tubulin-like protein that assembles into a ring structure at the cell centre called the Z ring. A fundamental problem in prokaryotic cell biology is to understand how the midcell division site is identified. Two major negative regulatory systems are known to be involved in preventing Z-ring assembly at all sites except the midcell. One of these systems, called nucleoid occlusion, blocks Z-ring assembly in the area occupied by an unsegregated nucleoid until a critical stage in chromosome replication or segregation is reached. The other system consists of three proteins, MinC, MinD and MinE, which prevent assembly of Z rings in regions of the cell not covered by the nucleoid, such as the cell poles. MinC is an inhibitor of FtsZ polymerization, resulting in the inhibition of Z ring assembly in the cell; MinD greatly enhances the inhibitory effects of MinC in vivo; and MinE antagonizes the effects of MinC and MinD . MinE is a small bifunctional protein. The amino terminus of MinE is required to interact with MinD, while the carboxyl terminus is required for 'topological specificity' - that is, the ability of MinE to antagonize MinCD inhibition of Z rings at the midcell position but not at the poles.. Probab=25.57 E-value=50 Score=14.18 Aligned_cols=40 Identities=10% Similarity=0.086 Sum_probs=35.4 Q ss_pred HHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHH Q ss_conf 2189999999998418988950889999999999999854 Q gi|254780373|r 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL 155 (172) Q Consensus 116 ~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in~ 155 (172) -....||++..++..-+...-..|+=.+.||.||++-|.- T Consensus 15 Sa~~Ak~RL~li~A~~R~~~~~~P~yle~lR~dileVi~K 54 (89) T TIGR01215 15 SAEVAKDRLQLIVAEERAQSGAAPDYLEELRKDILEVIQK 54 (89) T ss_pred HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH T ss_conf 1789999998876644422678871238889999988773 No 78 >pfam01145 Band_7 SPFH domain / Band 7 family. This family has been called SPFH, Band 7 or PHB domain. Probab=25.31 E-value=51 Score=14.15 Aligned_cols=53 Identities=8% Similarity=0.151 Sum_probs=40.8 Q ss_pred HHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHHHCC--C-CEEEEEEEEEE Q ss_conf 2189999999998418988950889999999999999854235--6-31257643220 Q gi|254780373|r 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ--G-FVSSVIFRTFI 170 (172) Q Consensus 116 ~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in~~~~--g-~V~~V~Ft~fV 170 (172) ..+.+++.+-..++..+.+|+-+ ++..+.+++.+++|.... | .|.+|.++++- T Consensus 91 l~~~~~~~lr~~~~~~~~~~~~~--~r~~i~~~v~~~l~~~l~~~Gi~i~~v~i~~i~ 146 (177) T pfam01145 91 LRPLVRSALREVIARYTLDELLS--NREEIAQEVKEALQEELDKYGIEIEDVQITDID 146 (177) T ss_pred HHHHHHHHHHHHHHCCCHHHHHH--HHHHHHHHHHHHHHHHHHHCCCEEEEEEEEECC T ss_conf 99999999999860466999986--189999999999999998669889999997448 No 79 >pfam09576 COX9 Cytochrome c oxidase subunit COX9. COX9 is subunit VIIa of yeast cytochrome c oxidase. Cells lacking this subunit do not have a functional cytochrome c oxidase holoenzyme. Probab=24.90 E-value=52 Score=14.11 Aligned_cols=36 Identities=11% Similarity=-0.154 Sum_probs=21.4 Q ss_pred CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 234676320599999999999999999999997067 Q gi|254780373|r 9 QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFL 44 (172) Q Consensus 9 ~~~kG~~~kl~Iii~~vv~ll~~g~g~~~~~~~~~~ 44 (172) ++.-|.-++-+|.=+.+-..+|...+.++++..... T Consensus 4 aPItG~Lrrrii~Disig~glG~~~a~~~Wyg~H~p 39 (57) T pfam09576 4 APITGMLRRRIITDISIGFGLGTVMASYWWYGYHKP 39 (57) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH T ss_conf 764125654456423577765777877777652147 No 80 >smart00019 SF_P Pulmonary surfactant proteins. Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-C, a component of surfactant, is a highly hydrophobic peptide of 35 amino acid residues which is processed from a larger precursor protein. SP-C is post-translationally modified by the covalent attachment of two palmitoyl groups on two adjacent cysteines Probab=24.16 E-value=15 Score=17.01 Aligned_cols=23 Identities=22% Similarity=0.362 Sum_probs=11.1 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 63205999999999999999999 Q gi|254780373|r 14 NQHKLFVTWFVVYTFIGIFCGWL 36 (172) Q Consensus 14 ~~~kl~Iii~~vv~ll~~g~g~~ 36 (172) +-|+++|++++|++++.+..|++ T Consensus 32 ~lKrLlivVvVvVlvVvViVGaL 54 (191) T smart00019 32 HLKRLLIVVVVVVLVVVVIVGAL 54 (191) T ss_pred CHHHEEEEEEEEHHHHHHHHHHH T ss_conf 71007778742025799999999 No 81 >COG4640 Predicted membrane protein [Function unknown] Probab=24.03 E-value=54 Score=14.02 Aligned_cols=28 Identities=14% Similarity=0.062 Sum_probs=14.2 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 6320599999999999999999999997 Q gi|254780373|r 14 NQHKLFVTWFVVYTFIGIFCGWLGGIVM 41 (172) Q Consensus 14 ~~~kl~Iii~~vv~ll~~g~g~~~~~~~ 41 (172) .+++++.+..+.++++.++..++++-++ T Consensus 48 skK~ii~was~a~~lIlii~~~~fgk~f 75 (465) T COG4640 48 SKKKIIPWASGAFILILIIILFFFGKNF 75 (465) T ss_pred CCCEEEHHHHHHHHHHHHHHHHHHHHCC T ss_conf 6111200478899999999999975403 No 82 >pfam03597 CcoS Cytochrome oxidase maturation protein cbb3-type. Probab=23.66 E-value=55 Score=13.98 Aligned_cols=28 Identities=7% Similarity=-0.198 Sum_probs=12.8 Q ss_pred HHHHHHHHHHHHHHHHHHHCCCCCCCCH Q ss_conf 9999999999999999970678765201 Q gi|254780373|r 24 VVYTFIGIFCGWLGGIVMLFLFAGQKEE 51 (172) Q Consensus 24 ~vv~ll~~g~g~~~~~~~~~~~~~~~~~ 51 (172) +-+++.+++.++|++..-.++.++-+.+ T Consensus 9 isl~l~~~~l~~f~Wavk~gQfDDle~~ 36 (45) T pfam03597 9 ISLLLGAVGLAAFLWAVKSGQFDDLEGP 36 (45) T ss_pred HHHHHHHHHHHHHHHHHCCCCCCCCCCC T ss_conf 9999999999999998505877788775 No 83 >COG4093 Uncharacterized protein conserved in bacteria [Function unknown] Probab=23.51 E-value=49 Score=14.23 Aligned_cols=26 Identities=8% Similarity=-0.064 Sum_probs=9.9 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 32059999999999999999999999706 Q gi|254780373|r 15 QHKLFVTWFVVYTFIGIFCGWLGGIVMLF 43 (172) Q Consensus 15 ~~kl~Iii~~vv~ll~~g~g~~~~~~~~~ 43 (172) ++.+++.|.+|++. |..-+.|||+.. T Consensus 14 kr~~wl~i~ivv~~---g~ySaGWFylA~ 39 (338) T COG4093 14 KRLFWLVIAIVVLI---GAYSAGWFYLAD 39 (338) T ss_pred CCHHHHHHHHHHHH---HHHCCHHHHHHH T ss_conf 22348999999988---775010766776 No 84 >pfam09680 Tiny_TM_bacill Protein of unknown function (Tiny_TM_bacill). This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV. Probab=23.01 E-value=57 Score=13.90 Aligned_cols=17 Identities=6% Similarity=0.100 Sum_probs=7.8 Q ss_pred HHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999 Q gi|254780373|r 20 VTWFVVYTFIGIFCGWL 36 (172) Q Consensus 20 Iii~~vv~ll~~g~g~~ 36 (172) +|+++.++|+.+|+.|+ T Consensus 8 LiVVLFILLIIVG~s~~ 24 (26) T pfam09680 8 LIVVLFILLIIVGASYF 24 (26) T ss_pred HHHHHHHHHHHHHHHHH T ss_conf 69999999999833540 No 85 >cd02106 Band_7 The band 7 domain of flotillin (reggie) like proteins. This group contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role i Probab=22.87 E-value=57 Score=13.89 Aligned_cols=54 Identities=7% Similarity=0.083 Sum_probs=41.3 Q ss_pred HHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHHHHC---CCCEEEEEEEEEE Q ss_conf 4218999999999841898895088999999999999985423---5631257643220 Q gi|254780373|r 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS---QGFVSSVIFRTFI 170 (172) Q Consensus 115 ~~~p~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in~~~---~g~V~~V~Ft~fV 170 (172) ...+.+++.+-..++..+.+++ ..+++.|.+++.+.++... +=.|.+|.+++.- T Consensus 52 ~i~~~~~~~lr~~i~~~~~~~~--~~~r~~i~~~i~~~l~~~~~~~Gi~v~~v~i~~i~ 108 (121) T cd02106 52 ALRQLAQSALRSVIGKMTLDEL--LEDRDEIAAEVREALQEDLDKYGIEVVDVRIKDID 108 (121) T ss_pred HHHHHHHHHHHHHHHHCCHHHH--HHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEEECC T ss_conf 9999999999999711537765--20166689999999988787519589999998638 No 86 >pfam06160 EzrA Septation ring formation regulator, EzrA. During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerizes into a ring structure that establishes the location of the nascent division site. EzrA modulates the frequency and position of FtsZ ring formation. Probab=22.74 E-value=42 Score=14.61 Aligned_cols=18 Identities=11% Similarity=0.371 Sum_probs=8.2 Q ss_pred HHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999 Q gi|254780373|r 20 VTWFVVYTFIGIFCGWLG 37 (172) Q Consensus 20 Iii~~vv~ll~~g~g~~~ 37 (172) ||+++|+++++.++++++ T Consensus 2 ii~iivivii~~~~~~~~ 19 (559) T pfam06160 2 IIGIIVIVIVAYLAGYFL 19 (559) T ss_pred EEEHHHHHHHHHHHHHHH T ss_conf 440899999999999999 No 87 >pfam06097 DUF945 Bacterial protein of unknown function (DUF945). This family consists of several hypothetical bacterial proteins of unknown function. Probab=22.43 E-value=58 Score=13.84 Aligned_cols=20 Identities=15% Similarity=0.129 Sum_probs=7.1 Q ss_pred HHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999 Q gi|254780373|r 19 FVTWFVVYTFIGIFCGWLGG 38 (172) Q Consensus 19 ~Iii~~vv~ll~~g~g~~~~ 38 (172) .+.++++++++.+|+.||.| T Consensus 6 a~gviv~l~a~~~g~~wytG 25 (460) T pfam06097 6 AIGVIVALGAVWTGGPWYTG 25 (460) T ss_pred EEHHHHHHHHHHHHHHHHHH T ss_conf 20989999999853465767 No 88 >pfam11772 EpuA DNA-directed RNA polymerase subunit beta. This short 60-residue long bacterial family is the beta subunit of the DNA-directed RNA polymerase, likely to be EC:2.7.7.6. It is membrane-bound and is referred to by the name EpuA. Probab=22.28 E-value=30 Score=15.44 Aligned_cols=23 Identities=9% Similarity=-0.002 Sum_probs=11.0 Q ss_pred HHHHHHHHHHHHHHHHHHCCCCC Q ss_conf 99999999999999997067876 Q gi|254780373|r 25 VYTFIGIFCGWLGGIVMLFLFAG 47 (172) Q Consensus 25 vv~ll~~g~g~~~~~~~~~~~~~ 47 (172) ++.++....|...+|..++...+ T Consensus 6 ~L~~~~l~~G~miGYgviG~G~p 28 (47) T pfam11772 6 LLAALALVIGLMIGYGVIGGGNP 28 (47) T ss_pred HHHHHHHHHHHHEEEEEECCCCH T ss_conf 99999999877801323169987 No 89 >pfam00155 Aminotran_1_2 Aminotransferase class I and II. Probab=22.21 E-value=59 Score=13.81 Aligned_cols=11 Identities=27% Similarity=0.573 Sum_probs=4.3 Q ss_pred HHHHHHHHHHH Q ss_conf 99999999999 Q gi|254780373|r 142 FRYFKEDIEER 152 (172) Q Consensus 142 k~~Lk~el~~~ 152 (172) ..++|+.+.++ T Consensus 262 ~~~~~~~~~~~ 272 (351) T pfam00155 262 LEEMRQRIKER 272 (351) T ss_pred HHHHHHHHHHH T ss_conf 99999999999 No 90 >PRK04778 septation ring formation regulator EzrA; Provisional Probab=21.86 E-value=60 Score=13.77 Aligned_cols=16 Identities=25% Similarity=0.434 Sum_probs=5.6 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9999999999999999 Q gi|254780373|r 19 FVTWFVVYTFIGIFCG 34 (172) Q Consensus 19 ~Iii~~vv~ll~~g~g 34 (172) ++|+++|+++++.+++ T Consensus 5 iii~iivlvii~~~~~ 20 (569) T PRK04778 5 LIIAIVVIIIIAYLVG 20 (569) T ss_pred HHHHHHHHHHHHHHHH T ss_conf 7899999999999999 No 91 >PRK03002 prsA peptidylprolyl isomerase; Reviewed Probab=21.54 E-value=61 Score=13.74 Aligned_cols=19 Identities=0% Similarity=-0.043 Sum_probs=10.6 Q ss_pred HHHHHHHHHHHHHHHCCCH Q ss_conf 4218999999999841898 Q gi|254780373|r 115 VFLETLHQDIMAYIRTVSI 133 (172) Q Consensus 115 ~~~p~Ird~il~~L~~~~~ 133 (172) ....+..+.+...|.+..+ T Consensus 82 ~~k~qyg~~f~~~L~q~gl 100 (285) T PRK03002 82 KAKSQYGDQFKNVLENNGL 100 (285) T ss_pred HHHHHHHHHHHHHHHHCCC T ss_conf 9999987899999998699 No 92 >COG2268 Uncharacterized protein conserved in bacteria [Function unknown] Probab=21.19 E-value=62 Score=13.69 Aligned_cols=34 Identities=18% Similarity=0.262 Sum_probs=24.3 Q ss_pred HHHHHHHHHHHCCCHHHHCCHHHHHHHHHHHHHHHH Q ss_conf 999999999841898895088999999999999985 Q gi|254780373|r 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK 154 (172) Q Consensus 119 ~Ird~il~~L~~~~~~dl~~~~Gk~~Lk~el~~~in 154 (172) ...+.+=..++++++.+|.. -|.....++.+.+- T Consensus 143 ~l~~~lR~i~a~~t~~el~e--dR~~F~~~V~~~v~ 176 (548) T COG2268 143 TLEGALRAVLAQMTVEELNE--DRLGFAQVVQEVVG 176 (548) T ss_pred HHHHHHHHHHHHCCHHHHHH--HHHHHHHHHHHHHH T ss_conf 99999999987559998746--67627999999988 No 93 >pfam03672 UPF0154 Uncharacterized protein family (UPF0154). This family contains a set of short bacterial proteins of unknown function. Probab=20.86 E-value=63 Score=13.65 Aligned_cols=16 Identities=19% Similarity=0.374 Sum_probs=6.8 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9999999999999999 Q gi|254780373|r 24 VVYTFIGIFCGWLGGI 39 (172) Q Consensus 24 ~vv~ll~~g~g~~~~~ 39 (172) ++.+++|+.+|+|+.. T Consensus 4 il~ll~G~~~Gff~ar 19 (64) T pfam03672 4 VLCLLAGFILGYFISR 19 (64) T ss_pred HHHHHHHHHHHHHHHH T ss_conf 8999998999999999 No 94 >PRK10905 hypothetical protein; Validated Probab=20.72 E-value=33 Score=15.18 Aligned_cols=18 Identities=17% Similarity=-0.011 Sum_probs=8.8 Q ss_pred HHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999 Q gi|254780373|r 19 FVTWFVVYTFIGIFCGWL 36 (172) Q Consensus 19 ~Iii~~vv~ll~~g~g~~ 36 (172) +-|-++|++||.+|+|-. T Consensus 2 ~gigi~vl~lliigiGSA 19 (323) T PRK10905 2 MGVGILVLLLLIIGIGSA 19 (323) T ss_pred CCEEHHHHHHHHHHHHHH T ss_conf 410024577888620043 No 95 >PRK01833 tatA twin arginine translocase protein A; Provisional Probab=20.55 E-value=64 Score=13.62 Aligned_cols=11 Identities=9% Similarity=0.286 Sum_probs=3.8 Q ss_pred HHHHHHHHHHH Q ss_conf 59999999999 Q gi|254780373|r 18 LFVTWFVVYTF 28 (172) Q Consensus 18 l~Iii~~vv~l 28 (172) ++||.++|++| T Consensus 9 llIi~~iv~ll 19 (75) T PRK01833 9 LLIIVAIIVLL 19 (75) T ss_pred HHHHHHHHHHH T ss_conf 99999999999 No 96 >PRK10856 hypothetical protein; Provisional Probab=20.48 E-value=64 Score=13.61 Aligned_cols=19 Identities=26% Similarity=0.632 Sum_probs=8.2 Q ss_pred CHHHHHHHHHHHHHHHHHH Q ss_conf 2059999999999999999 Q gi|254780373|r 16 HKLFVTWFVVYTFIGIFCG 34 (172) Q Consensus 16 ~kl~Iii~~vv~ll~~g~g 34 (172) ..|++.++++++++++.+. T Consensus 112 ~l~~~~~lv~~vvl~l~~~ 130 (332) T PRK10856 112 WLMSFTWLVLFVVIGLTGA 130 (332) T ss_pred HHHHHHHHHHHHHHHHHHH T ss_conf 3789999999999998888 No 97 >TIGR01411 tatAE twin arginine-targeting protein translocase, TatA/E family; InterPro: IPR006312 This family represents TatA and TatE. The Tat (twin-arginine translocation) system is a Sec-independent exporter for folded proteins, often with a redox cofactor already bound, across the bacterial inner membrane. Functionally equivalent systems are found in the chloroplast and some in archaeal species. The signal peptide recognized by the Tat system is modeled by IPR006311 from INTERPRO. ; GO: 0015031 protein transport, 0016021 integral to membrane. Probab=20.30 E-value=62 Score=13.70 Aligned_cols=13 Identities=15% Similarity=0.153 Sum_probs=6.9 Q ss_pred HHHHHHHHHHHHH Q ss_conf 5999999999999 Q gi|254780373|r 18 LFVTWFVVYTFIG 30 (172) Q Consensus 18 l~Iii~~vv~ll~ 30 (172) -||+|++|++|+- T Consensus 7 ~~liiL~v~~LlF 19 (48) T TIGR01411 7 HLLIILVVILLLF 19 (48) T ss_pred HHHHHHHHHHHHC T ss_conf 9999999988641 No 98 >PRK04561 tatA twin arginine translocase protein A; Provisional Probab=20.13 E-value=65 Score=13.57 Aligned_cols=12 Identities=8% Similarity=0.246 Sum_probs=5.5 Q ss_pred HHHHHHHHHHHH Q ss_conf 999999999999 Q gi|254780373|r 19 FVTWFVVYTFIG 30 (172) Q Consensus 19 ~Iii~~vv~ll~ 30 (172) |+|++++++|+- T Consensus 9 ~lIv~~ivvllF 20 (75) T PRK04561 9 WLVVLVIVLLVF 20 (75) T ss_pred HHHHHHHHHHHH T ss_conf 999999999983 Done!