BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780373|ref|YP_003064786.1| flagellar basal
body-associated protein FliL [Candidatus Liberibacter asiaticus str.
psy62]
         (172 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780373|ref|YP_003064786.1| flagellar basal body-associated protein FliL [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040050|gb|ACT56846.1| flagellar basal body-associated protein FliL [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 172

 Score =  353 bits (905), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 172/172 (100%), Positives = 172/172 (100%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN
Sbjct: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
           FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL
Sbjct: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA 172
           HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA
Sbjct: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA 172


>gi|315121842|ref|YP_004062331.1| flagellar basal body-associated protein FliL [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495244|gb|ADR51843.1| flagellar basal body-associated protein FliL [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 170

 Score =  224 bits (570), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 133/173 (76%), Gaps = 4/173 (2%)

Query: 1   MSYDDTTSQYIRGNQ-HKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           MSY+D     IRGNQ ++ F+  F+V T IGIFCGWLGGIV+      +K+E   + I  
Sbjct: 1   MSYNDKN---IRGNQSYERFIMQFIVCTAIGIFCGWLGGIVISSFVLAEKKENSIESIFK 57

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
           N Y+N  RS++  D +  K  QIF+L PIITNFDSSP++WLRLD+ALIC   P+KVFLE 
Sbjct: 58  NVYNNRTRSIYANDAVYPKDPQIFALHPIITNFDSSPENWLRLDVALICDKTPNKVFLEI 117

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA 172
           LHQDIMAY+RTVS+K ITG+QGFRYFKED+EERVKLR+QG VS+VIFRTFIIA
Sbjct: 118 LHQDIMAYVRTVSMKHITGSQGFRYFKEDVEERVKLRAQGSVSNVIFRTFIIA 170


>gi|209547933|ref|YP_002279850.1| flagellar basal body-associated protein FliL [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209533689|gb|ACI53624.1| flagellar basal body-associated protein FliL [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 168

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 92/168 (54%), Gaps = 5/168 (2%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           D +  Q  + +   + +    V T +G   GW  G ++     G KE + Q         
Sbjct: 5   DASAGQPKKKSGTLMMIIGIAVLTLLGAGGGWAVGTIVAPNIKGAKEAE-QAKDAEAKKK 63

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
                 H    IS +   +  L+PI +N     ++W+RL++AL+    PD    E +HQD
Sbjct: 64  AEEGLAH----ISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSEDIHQD 119

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 120 ILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|307318917|ref|ZP_07598348.1| flagellar basal body-associated protein FliL [Sinorhizobium
           meliloti AK83]
 gi|306895331|gb|EFN26086.1| flagellar basal body-associated protein FliL [Sinorhizobium
           meliloti AK83]
          Length = 163

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/168 (34%), Positives = 92/168 (54%), Gaps = 7/168 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  S+  +     + +    V T +    GWL G+ +L     +K E   +   N   +
Sbjct: 2   EEIESKETKAPSRLMTIAAVAVLTLVAGGGGWLAGM-LLAPPPAEKTEAAAELPANATGE 60

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
             +        I+     I  L PI TN     ++W+RL++AL     PD    ET+HQD
Sbjct: 61  EDIPK------IAAVAHGIVQLDPITTNLAYPAENWVRLEVALQFDGAPDVALAETIHQD 114

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I AY++TVS++QI G +GF+Y ++DI+ERV LRS+G V++V+FRTF+I
Sbjct: 115 IAAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSEGRVTNVMFRTFVI 162


>gi|150395490|ref|YP_001325957.1| flagellar basal body-associated protein FliL [Sinorhizobium medicae
           WSM419]
 gi|150027005|gb|ABR59122.1| flagellar basal body-associated protein FliL [Sinorhizobium medicae
           WSM419]
          Length = 163

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/138 (40%), Positives = 84/138 (60%), Gaps = 7/138 (5%)

Query: 34  GWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD 93
           GWL G+ +L   A +K E   +   N   +  +  + T          I  L PI TN  
Sbjct: 32  GWLAGM-LLAPPAAEKTEAAVELPANATGEEEIARIATVAN------GIVQLDPITTNLA 84

Query: 94  SSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV 153
              ++W+RL++AL    +PD    ET+HQDI AY++TVS++Q+ G +GF+Y ++DI+ERV
Sbjct: 85  YPAENWVRLEVALQFNGVPDVALAETIHQDIAAYLKTVSLQQVQGPRGFQYLRDDIQERV 144

Query: 154 KLRSQGFVSSVIFRTFII 171
            LRS+G V+SV+FRTF+I
Sbjct: 145 DLRSEGRVTSVMFRTFVI 162


>gi|15964420|ref|NP_384773.1| flagellar transmembrane protein [Sinorhizobium meliloti 1021]
 gi|307311562|ref|ZP_07591203.1| flagellar basal body-associated protein FliL [Sinorhizobium
           meliloti BL225C]
 gi|15073597|emb|CAC45239.1| Flagellar transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306899579|gb|EFN30208.1| flagellar basal body-associated protein FliL [Sinorhizobium
           meliloti BL225C]
          Length = 163

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 58/168 (34%), Positives = 92/168 (54%), Gaps = 7/168 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  S+  +     + +    V T +    GWL G+ +L     +K E   +   N   +
Sbjct: 2   EEIESKETKAPSRLMTIAAVAVLTLVAGGGGWLAGM-LLAPPPAEKTEIPAELPANATGE 60

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
             +        +S     I  L PI TN     ++W+RL++AL     PD    ET+HQD
Sbjct: 61  EGI------PKMSAVAHGIVQLDPITTNLAYPAENWVRLEVALQFDGAPDVALAETIHQD 114

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I AY++TVS++QI G +GF+Y ++DI+ERV LRS+G V++V+FRTF+I
Sbjct: 115 IAAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSEGRVTNVMFRTFVI 162


>gi|116250487|ref|YP_766325.1| FliL flagella related protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255135|emb|CAK06209.1| method: conceptual translation supplied by author (flil) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 168

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 65/177 (36%), Positives = 97/177 (54%), Gaps = 16/177 (9%)

Query: 1   MSYDDTTSQYIRGNQHK-----LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKE-EKYQ 54
           M+  D ++    G  HK     + +    V T +G   GW  G ++     G KE E+ +
Sbjct: 1   MAEPDASA----GQSHKKSGSLMTIIGIAVLTLLGAGGGWAVGTIVAPNIKGAKEVEQAK 56

Query: 55  KFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK 114
                   +  +        IS +   +  L+PI +N     ++W+RL++AL+    PD 
Sbjct: 57  DAEAKKKAEEGLAR------ISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDV 110

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
              E +HQDI+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 111 KVSEDIHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|241203111|ref|YP_002974207.1| flagellar basal body-associated protein FliL [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857001|gb|ACS54668.1| flagellar basal body-associated protein FliL [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 168

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 94/169 (55%), Gaps = 7/169 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKE-EKYQKFILNNFY 62
           D +  Q  + +   + +    V T +G   GW  G ++     G KE E+ +        
Sbjct: 5   DASAGQSQKKSGALMTIIGIAVLTLLGAGGGWAVGTIVAPNIKGAKEVEQAKDAEAKKKA 64

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQ 122
           +  +  + T      +   +  L+PI +N     ++W+RL++AL+    PD    E +HQ
Sbjct: 65  EEGLARIST------EANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSEDIHQ 118

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           DI+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 119 DILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|86356317|ref|YP_468209.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CFN
           42]
 gi|86280419|gb|ABC89482.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CFN
           42]
          Length = 168

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 95/169 (56%), Gaps = 7/169 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKE-EKYQKFILNNFY 62
           D +  Q  + +   + +    V T +G   GW  G ++     G KE E+ ++       
Sbjct: 5   DISAGQSKKKSGPLMTIIGIAVLTLLGAGGGWAVGTIVAPEIKGAKEVEQAKEAEAKKKA 64

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQ 122
           +  +  + T      +   +  L+PI +N     ++W+RL++AL+    PD    E +HQ
Sbjct: 65  EEGLARIST------EANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVAEDIHQ 118

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           DI+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 119 DILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|218679633|ref|ZP_03527530.1| orfc; method: conceptual translation supplied by author (flil)
           [Rhizobium etli CIAT 894]
          Length = 150

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/154 (39%), Positives = 87/154 (56%), Gaps = 5/154 (3%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           + +    V T +G   GW  G ++     G KE +  K            +      IS 
Sbjct: 1   MTIIGIAVLTLLGAGGGWAVGTIVAPNIKGAKEAEQAKDAEAKKKAEEGLA-----RIST 55

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQIT 137
           +   I  L+PI +N     ++W+RL++AL+    PD    E +HQDI+AYIRTVS++QI 
Sbjct: 56  EANNIVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSEDIHQDILAYIRTVSLQQIE 115

Query: 138 GAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 GPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 149


>gi|227820863|ref|YP_002824833.1| putative flagellar basal body-associated protein FliL
           [Sinorhizobium fredii NGR234]
 gi|227339862|gb|ACP24080.1| putative flagellar basal body-associated protein FliL
           [Sinorhizobium fredii NGR234]
          Length = 163

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 89/154 (57%), Gaps = 7/154 (4%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           + +    V T +    GWL GI  L     +K E   +   N   +  +  + T      
Sbjct: 16  MTIAAVAVLTLVAGGGGWLVGI-FLAPPPAEKAEAVAEVPENATGEEGLPKIAT------ 68

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQIT 137
           +   I  L+PI TN     ++W+R+++AL  K +PD    E +HQDI+AY++TVS++QI 
Sbjct: 69  EANGIVQLEPITTNLAYPAENWVRVEVALQFKGVPDVALAEEIHQDIIAYLKTVSLQQIQ 128

Query: 138 GAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           G +GF+Y ++DI+ERV LRS G V++V+FRTF+I
Sbjct: 129 GPRGFQYLRDDIQERVDLRSDGRVTNVMFRTFVI 162


>gi|218670414|ref|ZP_03520085.1| flagellar biosynthesis transmembrane protein [Rhizobium etli GR56]
          Length = 150

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 87/154 (56%), Gaps = 5/154 (3%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           + +    + T +G   GW  G ++     G KE +  K            +      IS 
Sbjct: 1   MTIMGVAILTLLGAGGGWAVGTIVAPEIKGAKEAEQAKDAEAKKKAEEGLA-----RIST 55

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQIT 137
           +   +  L+PI +N     ++W+RL++AL+    PD    E +HQDI+AYIRTVS++QI 
Sbjct: 56  EANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSEDIHQDILAYIRTVSLQQIE 115

Query: 138 GAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 GPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 149


>gi|190890368|ref|YP_001976910.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
 gi|190695647|gb|ACE89732.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
          Length = 168

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 70/97 (72%)

Query: 75  ISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIK 134
           IS +   +  L+PI +N     ++W+RL++AL+    PD    E +HQDI+AYIRTVS++
Sbjct: 71  ISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVAEDIHQDILAYIRTVSLQ 130

Query: 135 QITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 131 QIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|222084870|ref|YP_002543399.1| flagellar biosynthesis transmembrane protein [Agrobacterium
           radiobacter K84]
 gi|221722318|gb|ACM25474.1| flagellar biosynthesis transmembrane protein [Agrobacterium
           radiobacter K84]
          Length = 164

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 69/96 (71%)

Query: 76  SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQ 135
            L+   I  L PIITN     ++W+RL+IAL+ K  PD    + +H+D++AY+RTVS++Q
Sbjct: 68  PLESSNIVQLDPIITNLGYPSQNWIRLEIALVFKGQPDAQLAQAIHEDVLAYVRTVSLQQ 127

Query: 136 ITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I G +G +Y ++D++ERV LRS+G VS V+FRTF+I
Sbjct: 128 IEGPRGLQYLRDDLQERVDLRSEGRVSKVMFRTFVI 163


>gi|218460349|ref|ZP_03500440.1| orfc; method: conceptual translation supplied by author (flil)
           [Rhizobium etli Kim 5]
          Length = 123

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 70/97 (72%)

Query: 75  ISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIK 134
           IS +   +  L+PI +N     ++W+RL++AL+    PD    E +HQDI+AYIRTVS++
Sbjct: 26  ISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSEDIHQDILAYIRTVSLQ 85

Query: 135 QITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           QI G +GF+Y ++DI+ERV LRSQG VS V+FRTF+I
Sbjct: 86  QIEGPRGFQYLRDDIQERVDLRSQGRVSKVMFRTFVI 122


>gi|325291934|ref|YP_004277798.1| flagellar protein [Agrobacterium sp. H13-3]
 gi|325059787|gb|ADY63478.1| flagellar protein [Agrobacterium sp. H13-3]
          Length = 166

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/99 (50%), Positives = 68/99 (68%)

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVS 132
           D I  +   I  L PI TN      +W+RL++AL+ K   +    E +HQDIMAY+RTVS
Sbjct: 67  DKIPAEANGIVQLDPITTNLAYPSTNWVRLEVALMFKGPVEVNLAEDIHQDIMAYVRTVS 126

Query: 133 IKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           ++Q+ G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 127 LQQLEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 165


>gi|15887893|ref|NP_353574.1| flagellar protein [Agrobacterium tumefaciens str. C58]
 gi|1086566|gb|AAB68973.1| orfC; Method: conceptual translation supplied by author
           [Agrobacterium tumefaciens]
 gi|2459719|gb|AAB71795.1| FliL [Agrobacterium tumefaciens]
 gi|15155485|gb|AAK86359.1| flagellar protein [Agrobacterium tumefaciens str. C58]
          Length = 166

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/99 (50%), Positives = 68/99 (68%)

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVS 132
           D I  +   I  L PI TN      +W+RL++AL+ K   +    E +HQDIMAY+RTVS
Sbjct: 67  DKIDAEANGIVQLDPITTNLAYPSTNWVRLEVALMFKGPVEVGLAEDIHQDIMAYVRTVS 126

Query: 133 IKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           ++Q+ G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 127 LQQLEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 165


>gi|222147576|ref|YP_002548533.1| flagellar protein [Agrobacterium vitis S4]
 gi|221734564|gb|ACM35527.1| flagellar protein [Agrobacterium vitis S4]
          Length = 172

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 80/154 (51%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +      T +G   GWL G ++       KEE+              +       +  
Sbjct: 18  LLIAALAGLTVVGAGAGWLVGTMVAPKVKVAKEEQKAAEEAGGKKKEGEKEETGLPKLPA 77

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQIT 137
           +   I  L P+ TN     + W+RL++AL+     D    E +HQD+MAY+RTVS++QI 
Sbjct: 78  EANGIVQLDPVTTNLAYPSESWVRLEVALVFNGPVDAKLAEDIHQDLMAYMRTVSLQQIE 137

Query: 138 GAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           G +GF Y K+D+ ERV +RS+G VS ++FRTF+I
Sbjct: 138 GPRGFDYLKDDLRERVDVRSEGRVSKLLFRTFVI 171


>gi|2275166|gb|AAB81418.1| FliL [Sinorhizobium meliloti]
          Length = 163

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/172 (31%), Positives = 93/172 (54%), Gaps = 15/172 (8%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  S+  +     + +    V T +    GWL G+ +L     +K E   +   N   +
Sbjct: 2   EEIESKETKATSRLMTIAAVAVLTLVAGGGGWLAGM-LLAPPPSEKTETAAELPANATGE 60

Query: 64  NSVRSVHT-GDTISLKKLQIFSLQPIITNFDS---SPKDWLRLDIALICKDIPDKVFLET 119
             +  +   G T    +          +++D    S ++W+RL++AL     PD    ET
Sbjct: 61  EDIPKMSAVGHTARAAR----------SDYDEPCLSAENWVRLEVALQFDGAPDVALAET 110

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +HQDI AY++TVS++QI G +GF+Y ++DI+ERV LRS+G V++V+FRTF+I
Sbjct: 111 IHQDIAAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSEGRVTNVMFRTFVI 162


>gi|163758020|ref|ZP_02165108.1| flagellar biosynthesis transmembrane protein [Hoeflea phototrophica
           DFL-43]
 gi|162284309|gb|EDQ34592.1| flagellar biosynthesis transmembrane protein [Hoeflea phototrophica
           DFL-43]
          Length = 171

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 66/90 (73%)

Query: 82  IFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQG 141
           +  L PI TN     + W+R++++L+    PD+   + +HQD+++Y+RTVS++QI G +G
Sbjct: 81  VLPLDPITTNLSYPSESWIRIEVSLLFGGAPDQALADQIHQDVLSYLRTVSLQQIDGPRG 140

Query: 142 FRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           F+Y ++D+ ERV+LRS+G V+ ++FRTF+I
Sbjct: 141 FQYLRDDLRERVRLRSEGRVNDILFRTFVI 170


>gi|13472581|ref|NP_104148.1| hypothetical protein mlr2923 [Mesorhizobium loti MAFF303099]
 gi|14023327|dbj|BAB49934.1| mlr2923 [Mesorhizobium loti MAFF303099]
          Length = 164

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 73/149 (48%), Gaps = 7/149 (4%)

Query: 23  FVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQI 82
            +V T   I  GW+ G  +    A        +        ++ +   TG T+       
Sbjct: 22  LLVVTAAAIGMGWMSGGYLKGAGAPSSVPVAPENEGKVAEPDAAQQPGTGPTL------- 74

Query: 83  FSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGF 142
            +L PI TN  S    W+R++++++          E +HQD++A++RTV + QI GA G+
Sbjct: 75  VALAPITTNIASPADTWIRMEVSVVYDAPQPPAMTEDIHQDLLAFVRTVKMHQIEGASGY 134

Query: 143 RYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           ++ K DIEER  +RSQG    V+ RT ++
Sbjct: 135 QHLKADIEERASIRSQGHAKQVLIRTLLL 163


>gi|260466614|ref|ZP_05812802.1| flagellar basal body-associated protein FliL [Mesorhizobium
           opportunistum WSM2075]
 gi|259029620|gb|EEW30908.1| flagellar basal body-associated protein FliL [Mesorhizobium
           opportunistum WSM2075]
          Length = 144

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 73/149 (48%), Gaps = 7/149 (4%)

Query: 23  FVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQI 82
            +V T   I  GW+ G  +  + A        +         +     TG T+ +     
Sbjct: 2   LLVVTAAAIGMGWMSGGYLKGVGAPSSVPAAPENEGKTAEPAATHEPGTGSTLVV----- 56

Query: 83  FSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGF 142
             L PI TN  S  + WLR++++++          E +HQD++A++RT+ + QI GA G+
Sbjct: 57  --LAPITTNIASPAETWLRMEVSVVYDAPQPPAMSEDIHQDLLAFVRTLKMHQIEGASGY 114

Query: 143 RYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           ++ K D++ER  +RSQG    V+ RT ++
Sbjct: 115 QHLKADLDERASIRSQGHAKQVLIRTLLL 143


>gi|110632651|ref|YP_672859.1| flagellar basal body-associated protein FliL [Mesorhizobium sp.
           BNC1]
 gi|110283635|gb|ABG61694.1| flagellar basal body-associated protein FliL [Chelativorans sp.
           BNC1]
          Length = 150

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 7/149 (4%)

Query: 23  FVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQ- 81
            +V T +    GWL G  +    A  + E   K       + +V+    G+    + L  
Sbjct: 6   LLVMTALAGGMGWLTGAYLEERSASGQSENAGK------TEVAVQEGQEGNEPDNESLSS 59

Query: 82  IFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQG 141
           I +L PI TN       W+R+++AL+ +   D     T+HQD+ AYIRT+ +KQI  A G
Sbjct: 60  IVALDPITTNLAEPTSIWVRMELALVFEGESDPTLARTIHQDLFAYIRTLRLKQIESASG 119

Query: 142 FRYFKEDIEERVKLRSQGFVSSVIFRTFI 170
           F++ K DI ER ++RS   V  V+  +F+
Sbjct: 120 FQHLKSDILERARIRSDDRVKQVLIMSFL 148


>gi|115523184|ref|YP_780095.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisA53]
 gi|115517131|gb|ABJ05115.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisA53]
          Length = 163

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 88/174 (50%), Gaps = 15/174 (8%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS +D      + +    +V   ++ T +G   G L  + ++     Q+    QK I   
Sbjct: 1   MSDEDAPKVERKQSSALQWVAVMLLLTAVGAAAGVLSSLHLVSTV--QRIADSQKEI--- 55

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK---VFL 117
             D  V S  +  +  L+KL      P++TN  S P  W+RL+ A++   + ++   + +
Sbjct: 56  -QDRPVASAFS-PSARLRKLS-----PVVTNLASPPNTWVRLEAAVVTDQLSEEEANILV 108

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             + +D++AY+RT+S  QI GA+G +Y +ED+ ER  +RS G V  +I  T ++
Sbjct: 109 ARVGEDVVAYLRTISPAQIEGARGLQYLREDLNERAAIRSSGKVRELIIETLVV 162


>gi|319781676|ref|YP_004141152.1| flagellar basal body-associated protein FliL [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317167564|gb|ADV11102.1| flagellar basal body-associated protein FliL [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 164

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 54/87 (62%)

Query: 85  LQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRY 144
           L PI TN  S    W+R++++++      +   + +HQD++A +RT+ + QI GA G+++
Sbjct: 77  LAPITTNIASPAGTWIRMEVSVVYDAPQPQAMSDDIHQDLLALVRTLKMHQIEGASGYQH 136

Query: 145 FKEDIEERVKLRSQGFVSSVIFRTFII 171
            K D+EER  +RSQG    V+ RT ++
Sbjct: 137 LKADLEERAAIRSQGHAKQVLIRTLLL 163


>gi|90422615|ref|YP_530985.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisB18]
 gi|90104629|gb|ABD86666.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisB18]
          Length = 147

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 78/154 (50%), Gaps = 19/154 (12%)

Query: 23  FVVYTFIGIFCGWLGGIVMLFLF--AGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKL 80
           F+V T +    G L  + +L         ++K +     + +  S R         L+K+
Sbjct: 7   FLVLTAVSAAAGVLSSLHVLSAVQHTADTQQKVEPPPAASAFSPSAR---------LRKM 57

Query: 81  QIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK---VFLETLHQDIMAYIRTVSIKQIT 137
                 P++TN  S P  W+R++ ++I   + D+   V +  + +D+++Y+RT+S  QI 
Sbjct: 58  A-----PVVTNMASPPGAWIRVEASVITDQVDDEQANVLIARVGEDVVSYLRTISPTQIE 112

Query: 138 GAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           GA+G +Y +ED+ ER  +RS G V  +I  T ++
Sbjct: 113 GARGLQYLREDLNERAAIRSSGKVRELIIETLVV 146


>gi|304392501|ref|ZP_07374441.1| flagellar basal body-associated protein FliL [Ahrensia sp. R2A130]
 gi|303295131|gb|EFL89491.1| flagellar basal body-associated protein FliL [Ahrensia sp. R2A130]
          Length = 150

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 76/153 (49%), Gaps = 18/153 (11%)

Query: 20  VTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKK 79
           +  FV+ T IG   G+ G       F GQK+   +  I           V  G+      
Sbjct: 14  IIMFVMVTAIGAGMGFGG-----LWFQGQKKVAVEPEI-----------VAKGEKPEPAT 57

Query: 80  LQIFSLQPIITNFDSSPKD-WLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITG 138
           L +  LQPI+TN  ++PKD W+RL+++L+  D  D    E + QD+ A +RT+ + Q+ G
Sbjct: 58  LHVHDLQPILTNI-AAPKDVWVRLELSLLTVDAIDAKLAEEIGQDLFALMRTIRLDQMEG 116

Query: 139 AQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             GF   +  I++R K R    V  V+FRT ++
Sbjct: 117 PSGFLALRHAIDQRAKFRGGEMVERVLFRTLVL 149


>gi|170741216|ref|YP_001769871.1| flagellar basal body-associated protein FliL [Methylobacterium sp.
           4-46]
 gi|168195490|gb|ACA17437.1| flagellar basal body-associated protein FliL [Methylobacterium sp.
           4-46]
          Length = 163

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 64/106 (60%), Gaps = 11/106 (10%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----IPDKVFLETLHQDIM 125
           +TGD      L   S+ P++TN   S + W+RL+ ++I +      PD V +  + QDI+
Sbjct: 64  YTGD------LSTRSVGPLVTNLVDSGEMWVRLEGSIIYRTGAVANPD-VAVAEIRQDIL 116

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           AY+RTVS+ Q+ GA G  + +ED+ ERV LR++G V  ++  T II
Sbjct: 117 AYLRTVSLAQLQGASGLMHLREDLNERVMLRTKGAVRELVVETLII 162


>gi|27381979|ref|NP_773508.1| flagellar protein [Bradyrhizobium japonicum USDA 110]
 gi|27355149|dbj|BAC52133.1| flagellar protein [Bradyrhizobium japonicum USDA 110]
          Length = 148

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 75/161 (46%), Gaps = 25/161 (15%)

Query: 19  FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQK-----EEKYQKFILNNFYDNSVRSVHTGD 73
            +   V  T + I  G L G   L LFA  +     ++      L + Y  S R      
Sbjct: 4   LIAAIVALTLVAIGAGALAG---LHLFAAAERVADAKKSPTPPPLASSYAGSAR------ 54

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK---VFLETLHQDIMAYIRT 130
              L+KL      PI+TN  +   +W R++ +++   + D+   +    + +DI+ Y+R+
Sbjct: 55  ---LRKLS-----PIVTNLAAPANNWARVEASMVTDSMSDEDAGILAAHISEDIVTYLRS 106

Query: 131 VSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            S  Q  G++G ++ ++D+ ER  +RS G V  +I  T +I
Sbjct: 107 ASAAQFEGSRGLQHLRDDLAERANVRSSGKVRELIIETLVI 147


>gi|254501481|ref|ZP_05113632.1| flagellar basal body-associated protein FliL [Labrenzia alexandrii
           DFL-11]
 gi|222437552|gb|EEE44231.1| flagellar basal body-associated protein FliL [Labrenzia alexandrii
           DFL-11]
          Length = 160

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 55/90 (61%), Gaps = 3/90 (3%)

Query: 85  LQPIITNFDSSPKDWLRLDIALICKDIPD---KVFLETLHQDIMAYIRTVSIKQITGAQG 141
           L+P++TN  + P  W+R+   L+ +D PD    V  + +  D ++++RT+++  + G  G
Sbjct: 70  LEPLVTNLATPPSTWIRVQATLLLEDEPDTDVSVLRKRIEDDFLSFLRTLTLAHLEGGVG 129

Query: 142 FRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            ++ +ED+ ER K+RS+G V  VI  + +I
Sbjct: 130 LQHLREDLNERAKVRSKGMVREVILESVVI 159


>gi|254720605|ref|ZP_05182416.1| flagellar basal body-associated protein FliL [Brucella sp. 83/13]
 gi|265985645|ref|ZP_06098380.1| flagellar basal body-associated protein FliL [Brucella sp. 83/13]
 gi|306838567|ref|ZP_07471404.1| flagellar basal body-associated protein FliL [Brucella sp. NF 2653]
 gi|264664237|gb|EEZ34498.1| flagellar basal body-associated protein FliL [Brucella sp. 83/13]
 gi|306406353|gb|EFM62595.1| flagellar basal body-associated protein FliL [Brucella sp. NF 2653]
          Length = 163

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 70/153 (45%), Gaps = 19/153 (12%)

Query: 24  VVYTFIGIFCGW-LGGIVMLFLFAGQKEE-KYQKFILNNFYDNSVRSVHTGDTISLKKLQ 81
            V T I    GW LG I+     A  K   K  K    +F   S+ +V            
Sbjct: 24  AVLTAIAGGGGWYLGNIISAGQQASAKPSGKEDKPKPGSFESRSIGAV------------ 71

Query: 82  IFSLQPIITNFDSSPKDWLRLDIALICK---DIPDKVFLETLHQDIMAYIRTVSIKQITG 138
              LQPIITN       W+RL+ +L+ K   +IP       +  D M ++R+V++ Q+ G
Sbjct: 72  -VPLQPIITNLGIPQTTWVRLEASLVAKPGHEIP-PAMAANVSDDFMRFLRSVNLMQLQG 129

Query: 139 AQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           A G  Y + D+EER +LRS+G V  V     ++
Sbjct: 130 AAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|225628630|ref|ZP_03786664.1| flagellar protein FliL [Brucella ceti str. Cudo]
 gi|237816669|ref|ZP_04595661.1| flagellar protein FliL [Brucella abortus str. 2308 A]
 gi|294853181|ref|ZP_06793853.1| flagellar basal body-associated protein FliL [Brucella sp. NVSL
           07-0026]
 gi|225616476|gb|EEH13524.1| flagellar protein FliL [Brucella ceti str. Cudo]
 gi|237787482|gb|EEP61698.1| flagellar protein FliL [Brucella abortus str. 2308 A]
 gi|294818836|gb|EFG35836.1| flagellar basal body-associated protein FliL [Brucella sp. NVSL
           07-0026]
          Length = 166

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 70/157 (44%), Gaps = 17/157 (10%)

Query: 19  FVTWFVVYTFIGIFCGW-LGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
            +    V T I    GW LG ++     AGQ+         +     S  S   G     
Sbjct: 22  LLAAVAVLTAIAGGGGWYLGNMI----SAGQQASAKPSGKEDKPKPGSFESRSIG----- 72

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICK---DIPDKVFLETLHQDIMAYIRTVSIK 134
               +  LQPIITN       W+RL+ +L+ K   +IP       +  D M ++R+V++ 
Sbjct: 73  ---AVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIP-PAMAANVSDDFMRFLRSVNLM 128

Query: 135 QITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 129 QLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 165


>gi|153011519|ref|YP_001372733.1| flagellar basal body-associated protein FliL [Ochrobactrum anthropi
           ATCC 49188]
 gi|151563407|gb|ABS16904.1| flagellar basal body-associated protein FliL [Ochrobactrum anthropi
           ATCC 49188]
          Length = 164

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 4/93 (4%)

Query: 82  IFSLQPIITNFDSSPKDWLRLDIALICK---DIPDKVFLETLHQDIMAYIRTVSIKQITG 138
           +  LQPIITN       W+RL+ +L+ K   +IP  V   ++  D ++++R+V++ Q+ G
Sbjct: 72  VVPLQPIITNLGIPQNTWVRLEASLVAKPGHEIPAAVA-ASVGDDFLSFLRSVNLMQLQG 130

Query: 139 AQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           A G  Y + D+EER +LRS+G V  V     ++
Sbjct: 131 AAGLAYLRSDLEERARLRSEGAVERVFISALVV 163


>gi|158422253|ref|YP_001523545.1| flagellar basal body-associated protein [Azorhizobium caulinodans
           ORS 571]
 gi|158329142|dbj|BAF86627.1| flagellar basal body-associated protein [Azorhizobium caulinodans
           ORS 571]
          Length = 176

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 81/166 (48%), Gaps = 23/166 (13%)

Query: 14  NQHKLFVTWFVVYTFIGIFCG-----WLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRS 68
           N  K  +   ++ T +G+  G      L   V   + A  KEE  +K     FY      
Sbjct: 25  NGTKGLILAILILTVLGVATGGGLGVQLATTVEKVVAAKAKEEPVKKE-QQLFY------ 77

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLE-TLHQDIM 125
              G+T+      +  ++P+I N  S P  W+R++ + + K+  + +    E TL +D+M
Sbjct: 78  --AGNTM------MQPMKPVIVNLASPPNTWVRIESSFVFKNGALANPALTESTLREDMM 129

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +Y+RT+++ Q  G    +  +ED+ ER ++RS+G V  +I  T ++
Sbjct: 130 SYLRTLTLSQFEGPSALQQLREDLNERARVRSEGRVDELIIETLVV 175


>gi|23499921|ref|NP_699361.1| flagellar protein FliL [Brucella suis 1330]
 gi|62317107|ref|YP_222960.1| flagellar protein FliL [Brucella abortus bv. 1 str. 9-941]
 gi|83269099|ref|YP_418390.1| flagellar basal body-associated protein FliL [Brucella melitensis
           biovar Abortus 2308]
 gi|148557885|ref|YP_001257217.1| putative flagellar protein FliL [Brucella ovis ATCC 25840]
 gi|161620241|ref|YP_001594127.1| flagellar basal body-associated protein FliL [Brucella canis ATCC
           23365]
 gi|189022372|ref|YP_001932113.1| Flagellar basal body-associated protein FliL [Brucella abortus S19]
 gi|225686017|ref|YP_002733989.1| flagellar basal body-associated protein FliL [Brucella melitensis
           ATCC 23457]
 gi|254691407|ref|ZP_05154661.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           6 str. 870]
 gi|254695295|ref|ZP_05157123.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           3 str. Tulya]
 gi|254698390|ref|ZP_05160218.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254702581|ref|ZP_05164409.1| flagellar basal body-associated protein FliL [Brucella suis bv. 3
           str. 686]
 gi|254706287|ref|ZP_05168115.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M163/99/10]
 gi|254711419|ref|ZP_05173230.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis B2/94]
 gi|254731837|ref|ZP_05190415.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           4 str. 292]
 gi|256014947|ref|YP_003104956.1| flagellar protein FliL, putative [Brucella microti CCM 4915]
 gi|256029951|ref|ZP_05443565.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M292/94/1]
 gi|256043078|ref|ZP_05446022.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256059604|ref|ZP_05449802.1| flagellar basal body-associated protein FliL [Brucella neotomae
           5K33]
 gi|256111938|ref|ZP_05452889.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 3 str. Ether]
 gi|256158113|ref|ZP_05456031.1| flagellar basal body-associated protein FliL [Brucella ceti
           M490/95/1]
 gi|256252933|ref|ZP_05458469.1| flagellar basal body-associated protein FliL [Brucella ceti B1/94]
 gi|256256593|ref|ZP_05462129.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           9 str. C68]
 gi|256262860|ref|ZP_05465392.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 2 str. 63/9]
 gi|260544346|ref|ZP_05820167.1| flagellar basal body-associated protein FliL [Brucella abortus NCTC
           8038]
 gi|260564308|ref|ZP_05834793.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. 16M]
 gi|260568511|ref|ZP_05838980.1| flagellar basal body-associated protein FliL [Brucella suis bv. 4
           str. 40]
 gi|260757021|ref|ZP_05869369.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           6 str. 870]
 gi|260759607|ref|ZP_05871955.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           4 str. 292]
 gi|260762849|ref|ZP_05875181.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260882831|ref|ZP_05894445.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           9 str. C68]
 gi|261215664|ref|ZP_05929945.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           3 str. Tulya]
 gi|261220024|ref|ZP_05934305.1| flagellar basal body-associated protein FliL [Brucella ceti B1/94]
 gi|261313731|ref|ZP_05952928.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M163/99/10]
 gi|261319027|ref|ZP_05958224.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis B2/94]
 gi|261323571|ref|ZP_05962768.1| flagellar basal body-associated protein FliL [Brucella neotomae
           5K33]
 gi|261753161|ref|ZP_05996870.1| flagellar basal body-associated protein FliL [Brucella suis bv. 3
           str. 686]
 gi|265986970|ref|ZP_06099527.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M292/94/1]
 gi|265989516|ref|ZP_06102073.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265993385|ref|ZP_06105942.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 3 str. Ether]
 gi|265996630|ref|ZP_06109187.1| flagellar basal body-associated protein FliL [Brucella ceti
           M490/95/1]
 gi|297249949|ref|ZP_06933650.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           5 str. B3196]
 gi|23463498|gb|AAN33366.1| flagellar protein FliL, putative [Brucella suis 1330]
 gi|62197300|gb|AAX75599.1| hypothetical FliL, flagellar protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82939373|emb|CAJ12323.1| Flagellar basal body-associated protein FliL [Brucella melitensis
           biovar Abortus 2308]
 gi|148369170|gb|ABQ62042.1| putative flagellar protein FliL [Brucella ovis ATCC 25840]
 gi|161337052|gb|ABX63356.1| flagellar basal body-associated protein FliL [Brucella canis ATCC
           23365]
 gi|189020946|gb|ACD73667.1| Flagellar basal body-associated protein FliL [Brucella abortus S19]
 gi|225642122|gb|ACO02035.1| flagellar basal body-associated protein FliL [Brucella melitensis
           ATCC 23457]
 gi|255997607|gb|ACU49294.1| flagellar protein FliL, putative [Brucella microti CCM 4915]
 gi|260097617|gb|EEW81491.1| flagellar basal body-associated protein FliL [Brucella abortus NCTC
           8038]
 gi|260151951|gb|EEW87044.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. 16M]
 gi|260155176|gb|EEW90257.1| flagellar basal body-associated protein FliL [Brucella suis bv. 4
           str. 40]
 gi|260669925|gb|EEX56865.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           4 str. 292]
 gi|260673270|gb|EEX60091.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260677129|gb|EEX63950.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           6 str. 870]
 gi|260872359|gb|EEX79428.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           9 str. C68]
 gi|260917271|gb|EEX84132.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           3 str. Tulya]
 gi|260918608|gb|EEX85261.1| flagellar basal body-associated protein FliL [Brucella ceti B1/94]
 gi|261298250|gb|EEY01747.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis B2/94]
 gi|261299551|gb|EEY03048.1| flagellar basal body-associated protein FliL [Brucella neotomae
           5K33]
 gi|261302757|gb|EEY06254.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M163/99/10]
 gi|261742914|gb|EEY30840.1| flagellar basal body-associated protein FliL [Brucella suis bv. 3
           str. 686]
 gi|262550927|gb|EEZ07088.1| flagellar basal body-associated protein FliL [Brucella ceti
           M490/95/1]
 gi|262764255|gb|EEZ10287.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 3 str. Ether]
 gi|263000185|gb|EEZ12875.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|263092695|gb|EEZ16904.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264659167|gb|EEZ29428.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M292/94/1]
 gi|297173818|gb|EFH33182.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           5 str. B3196]
 gi|326410340|gb|ADZ67404.1| Flagellar basal body-associated protein FliL [Brucella melitensis
           M28]
 gi|326553632|gb|ADZ88271.1| Flagellar basal body-associated protein FliL [Brucella melitensis
           M5-90]
          Length = 163

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 71/158 (44%), Gaps = 19/158 (12%)

Query: 19  FVTWFVVYTFIGIFCGW-LGGIVMLFLFAGQKEE-KYQKFILNNFYDNSVRSVHTGDTIS 76
            +    V T I    GW LG ++     A  K   K  K    +F   S+ +V       
Sbjct: 19  LLAAVAVLTAIAGGGGWYLGNMISAGQQASAKPSGKEDKPKPGSFESRSIGAV------- 71

Query: 77  LKKLQIFSLQPIITNFDSSPKDWLRLDIALICK---DIPDKVFLETLHQDIMAYIRTVSI 133
                   LQPIITN       W+RL+ +L+ K   +IP       +  D M ++R+V++
Sbjct: 72  ------VPLQPIITNLGIPQTTWVRLEASLVAKPGHEIP-PAMAANVSDDFMRFLRSVNL 124

Query: 134 KQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 125 MQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|254712019|ref|ZP_05173830.1| flagellar basal body-associated protein FliL [Brucella ceti
           M644/93/1]
 gi|254715088|ref|ZP_05176899.1| flagellar basal body-associated protein FliL [Brucella ceti
           M13/05/1]
 gi|261216797|ref|ZP_05931078.1| flagellar basal body-associated protein FliL [Brucella ceti
           M13/05/1]
 gi|261319664|ref|ZP_05958861.1| flagellar basal body-associated protein FliL [Brucella ceti
           M644/93/1]
 gi|260921886|gb|EEX88454.1| flagellar basal body-associated protein FliL [Brucella ceti
           M13/05/1]
 gi|261292354|gb|EEX95850.1| flagellar basal body-associated protein FliL [Brucella ceti
           M644/93/1]
          Length = 163

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 70/157 (44%), Gaps = 17/157 (10%)

Query: 19  FVTWFVVYTFIGIFCGW-LGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
            +    V T I    GW LG ++     AGQ+         +     S  S   G     
Sbjct: 19  LLAAVAVLTAIAGGGGWYLGNMI----SAGQQASAKPSGKEDKPKPGSFESRSIG----- 69

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICK---DIPDKVFLETLHQDIMAYIRTVSIK 134
               +  LQPIITN       W+RL+ +L+ K   +IP       +  D M ++R+V++ 
Sbjct: 70  ---AVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIP-PAMAANVSDDFMRFLRSVNLM 125

Query: 135 QITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 126 QLLGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|306846273|ref|ZP_07478834.1| flagellar basal body-associated protein FliL [Brucella sp. BO1]
 gi|306273268|gb|EFM55137.1| flagellar basal body-associated protein FliL [Brucella sp. BO1]
          Length = 163

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 71/158 (44%), Gaps = 19/158 (12%)

Query: 19  FVTWFVVYTFIGIFCGW-LGGIVMLFLFAGQKEE-KYQKFILNNFYDNSVRSVHTGDTIS 76
            +    V T I    GW LG ++     A  K   K  K    +F   S+ +V       
Sbjct: 19  LLAAVAVLTAIAGGGGWYLGNMISAGQQASAKPSGKEDKPKPGSFEARSIGAV------- 71

Query: 77  LKKLQIFSLQPIITNFDSSPKDWLRLDIALICK---DIPDKVFLETLHQDIMAYIRTVSI 133
                   LQPIITN       W+RL+ +L+ K   +IP       +  D M ++R+V++
Sbjct: 72  ------VPLQPIITNLGIPQTTWVRLEASLVAKPGHEIP-PAMAANVSDDFMRFLRSVNL 124

Query: 134 KQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 125 MQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|306841044|ref|ZP_07473768.1| flagellar basal body-associated protein FliL [Brucella sp. BO2]
 gi|306288933|gb|EFM60233.1| flagellar basal body-associated protein FliL [Brucella sp. BO2]
          Length = 163

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 71/158 (44%), Gaps = 19/158 (12%)

Query: 19  FVTWFVVYTFIGIFCGW-LGGIVMLFLFAGQKEE-KYQKFILNNFYDNSVRSVHTGDTIS 76
            +    V T I    GW LG ++     A  K   K  K    +F   S+ +V       
Sbjct: 19  LLAAVAVLTAIAGGGGWYLGNMISAGQQASAKPSGKEDKPKRGSFEARSIGAV------- 71

Query: 77  LKKLQIFSLQPIITNFDSSPKDWLRLDIALICK---DIPDKVFLETLHQDIMAYIRTVSI 133
                   LQPIITN       W+RL+ +L+ K   +IP       +  D M ++R+V++
Sbjct: 72  ------VPLQPIITNLGIPQTTWVRLEASLVAKPGHEIP-PAMAANVSDDFMRFLRSVNL 124

Query: 134 KQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 125 MQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|239834437|ref|ZP_04682765.1| flagellar basal body-associated protein FliL [Ochrobactrum
           intermedium LMG 3301]
 gi|239822500|gb|EEQ94069.1| flagellar basal body-associated protein FliL [Ochrobactrum
           intermedium LMG 3301]
          Length = 167

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 79/178 (44%), Gaps = 28/178 (15%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQ--------KEEKYQKF 56
           DTT+    G       T       + +  G  G  +   + A Q        KE+K +K 
Sbjct: 6   DTTTTETDGKAKSSLTTLLAAVAVLTVIAGGGGWYLGGMISADQLASAKVSGKEDKPKK- 64

Query: 57  ILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK---DIPD 113
                 D   RS+ T          +  LQPI+TN       W+RL+ +L+ K   +IP 
Sbjct: 65  -----GDFESRSIGT----------VVPLQPIVTNLGIPQDTWVRLEASLVAKPGHEIP- 108

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
                ++  D ++++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 109 AALAASVGDDFLSFLRSVNLMQLQGAAGLAYLRADLEERARLRSEGAVDRVFISALVV 166


>gi|296445180|ref|ZP_06887140.1| flagellar basal body-associated protein FliL [Methylosinus
           trichosporium OB3b]
 gi|296257354|gb|EFH04421.1| flagellar basal body-associated protein FliL [Methylosinus
           trichosporium OB3b]
          Length = 191

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 55/97 (56%), Gaps = 3/97 (3%)

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALI--CKDIPDK-VFLETLHQDIMAYIRTVSIK 134
            K ++  L PI+TN   S   W+RL  A+I     +P+  + +  +  DI+AY+RT+++ 
Sbjct: 94  PKWKLKELAPIVTNLSESEAGWVRLQAAIIYDMAALPEPDMLVSQVTADIVAYLRTMTLA 153

Query: 135 QITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            I GA G R   ED+ ER  +RS+G V  +I +  ++
Sbjct: 154 SIQGADGLRRLHEDLSERAAIRSEGHVRELIIQALVV 190


>gi|17989426|ref|NP_542059.1| flagellar protein FliL [Brucella melitensis bv. 1 str. 16M]
 gi|17985303|gb|AAL54323.1| flagellar protein flil [Brucella melitensis bv. 1 str. 16M]
          Length = 124

 Score = 70.9 bits (172), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 4/93 (4%)

Query: 82  IFSLQPIITNFDSSPKDWLRLDIALICK---DIPDKVFLETLHQDIMAYIRTVSIKQITG 138
           +  LQPIITN       W+RL+ +L+ K   +IP       +  D M ++R+V++ Q+ G
Sbjct: 32  VVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIP-PAMAANVSDDFMRFLRSVNLMQLQG 90

Query: 139 AQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           A G  Y + D+EER +LRS+G V  V     ++
Sbjct: 91  AAGLAYLRTDLEERARLRSEGAVDRVFISALVV 123


>gi|328545500|ref|YP_004305609.1| flagellar basal body-associated protein FliL [polymorphum gilvum
           SL003B-26A1]
 gi|326415241|gb|ADZ72304.1| Flagellar basal body-associated protein FliL [Polymorphum gilvum
           SL003B-26A1]
          Length = 169

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 60/95 (63%), Gaps = 5/95 (5%)

Query: 81  QIFSLQPIITNFDSSPKD-WLRLDIALIC--KDIPDKVFLET-LHQDIMAYIRTVSIKQI 136
           ++  L+P++TN  ++P+D W+RL  +++    D+ +   L   + +D++AY+RT+++ Q+
Sbjct: 75  RLRGLKPLVTNL-AAPRDAWIRLQASIVLDDGDVEEAGMLAGRIEEDVVAYLRTITLSQV 133

Query: 137 TGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            GA G ++ +ED+ ER   RS G V  +I  + +I
Sbjct: 134 EGAAGLQHLREDLNERAVARSGGRVRELILESLVI 168


>gi|182680543|ref|YP_001834689.1| flagellar basal body-associated protein FliL [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182636426|gb|ACB97200.1| flagellar basal body-associated protein FliL [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 167

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 52/92 (56%), Gaps = 3/92 (3%)

Query: 83  FSLQPIITNFDSSPKDWLRLDIALI--CKDIP-DKVFLETLHQDIMAYIRTVSIKQITGA 139
           + L PII N    P  W+RL+  ++   K +P  +V    L  D++ Y++T+S+ Q+ G 
Sbjct: 75  WPLPPIIANLADPPNSWIRLETVMLFDSKIVPKPEVLSMQLTTDVLGYLKTLSVAQLAGP 134

Query: 140 QGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            GF+  ++D+ ER  +RS G +  ++ +  +I
Sbjct: 135 SGFQNLRDDLNERAHIRSNGAIQELVIQALVI 166


>gi|217976230|ref|YP_002360377.1| flagellar basal body-associated protein FliL [Methylocella
           silvestris BL2]
 gi|217501606|gb|ACK49015.1| flagellar basal body-associated protein FliL [Methylocella
           silvestris BL2]
          Length = 168

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 5/91 (5%)

Query: 85  LQPIITNFDSSPKDWLRLDIALI----CKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQ 140
           L PII N       W+RL   L+        PD V    + +DI+ ++RT ++ QI GA 
Sbjct: 78  LPPIIANLAEPSDAWVRLQATLVLDRPASGKPD-VLAAQIAEDILGFMRTATLSQIAGAS 136

Query: 141 GFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           G ++ +ED+ ER  +RS G V  +I +T ++
Sbjct: 137 GLQHLREDLNERAMIRSDGRVRELILQTLVV 167


>gi|218528671|ref|YP_002419487.1| flagellar basal body-associated protein FliL [Methylobacterium
           chloromethanicum CM4]
 gi|218520974|gb|ACK81559.1| flagellar basal body-associated protein FliL [Methylobacterium
           chloromethanicum CM4]
          Length = 160

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 75/153 (49%), Gaps = 21/153 (13%)

Query: 34  GWLGGIVMLFLFAGQKE-----------EKYQKFILNNFYDNSVRSVH-TGDTISLKKLQ 81
           GW+G + ++ L A               EK            +V++++ TGD      L 
Sbjct: 13  GWIGALALVTLIAVGTGGGLGVYLLGTVEKSVDLKQREEAGKAVKALNYTGD------LS 66

Query: 82  IFSLQPIITNFDSSPKDWLRLDIALI--CKDIPDK-VFLETLHQDIMAYIRTVSIKQITG 138
           + S+  ++ N       W+R++ +++     +P+  V L  +  D +AY+RT+S+ QI G
Sbjct: 67  LRSVGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVTLAEIRADALAYLRTLSMAQIEG 126

Query: 139 AQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           A G ++ +ED+ ERV  R++G V  +I  + ++
Sbjct: 127 ANGLQHLREDLNERVATRTKGAVRELIVESLVV 159


>gi|118589976|ref|ZP_01547380.1| flagellar basal body-associated protein FliL [Stappia aggregata IAM
           12614]
 gi|118437473|gb|EAV44110.1| flagellar basal body-associated protein FliL [Stappia aggregata IAM
           12614]
          Length = 166

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 58/91 (63%), Gaps = 5/91 (5%)

Query: 85  LQPIITNFDSSPKD-WLRLDIALICKDIPDK---VFLETLHQDIMAYIRTVSIKQITGAQ 140
           L+P++TN  +SP+D W+R+  +++ +D PD    V  + +  D + Y+RT+++  + G  
Sbjct: 76  LEPLVTNL-ASPQDAWIRVQASILLEDDPDGDAGVLKKKVEDDFLGYMRTLTLSHLEGGI 134

Query: 141 GFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           G ++ +ED+ ER + R++G VS VI  + +I
Sbjct: 135 GLQHLREDLTERAQTRTRGQVSEVILESVVI 165


>gi|163850068|ref|YP_001638111.1| flagellar basal body-associated protein FliL [Methylobacterium
           extorquens PA1]
 gi|163661673|gb|ABY29040.1| flagellar basal body-associated protein FliL [Methylobacterium
           extorquens PA1]
          Length = 160

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 75/162 (46%), Gaps = 39/162 (24%)

Query: 34  GWLGGIVMLFLFAG---------------------QKEEKYQKFILNNFYDNSVRSVHTG 72
           GW+G + ++ L A                      Q+EE  +   + N+         TG
Sbjct: 13  GWIGALALVTLIAVGTGGGLGVYLLGTVEKSVDLKQREEAGKAVKVLNY---------TG 63

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALI--CKDIPDK-VFLETLHQDIMAYIR 129
           D      L + S+  ++ N       W+R++ +++     +P+  V L  +  D +AY+R
Sbjct: 64  D------LSLRSVGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVTLAEIRADALAYLR 117

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           T+S+ QI GA G ++ +ED+ ERV  R++G V  +I  + ++
Sbjct: 118 TLSLAQIEGANGLQHLREDLNERVATRTKGAVRELIVESLVV 159


>gi|240137202|ref|YP_002961671.1| Flagellar basal body-associated protein FliL [Methylobacterium
           extorquens AM1]
 gi|240007168|gb|ACS38394.1| Flagellar basal body-associated protein FliL [Methylobacterium
           extorquens AM1]
          Length = 160

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 75/162 (46%), Gaps = 39/162 (24%)

Query: 34  GWLGGIVMLFLFAG---------------------QKEEKYQKFILNNFYDNSVRSVHTG 72
           GW+G + ++ L A                      Q+EE  +   + N+         TG
Sbjct: 13  GWIGALALVTLIAVGTGGGLGVYLLGTVEKSVDLKQREEAGKAVKVLNY---------TG 63

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALI--CKDIPDK-VFLETLHQDIMAYIR 129
           D      L + S+  ++ N       W+R++ +++     +P+  V L  +  D +AY+R
Sbjct: 64  D------LSLRSVGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVTLAEIRADALAYLR 117

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           T+S+ QI GA G ++ +ED+ ERV  R++G V  +I  + ++
Sbjct: 118 TLSMAQIEGANGLQHLREDLNERVATRTKGAVRELIVESLVV 159


>gi|254559214|ref|YP_003066309.1| flagellar basal body-associated protein FliL [Methylobacterium
           extorquens DM4]
 gi|254266492|emb|CAX22256.1| Flagellar basal body-associated protein FliL [Methylobacterium
           extorquens DM4]
          Length = 160

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 75/162 (46%), Gaps = 39/162 (24%)

Query: 34  GWLGGIVMLFLFAG---------------------QKEEKYQKFILNNFYDNSVRSVHTG 72
           GW+G + ++ L A                      Q+EE  +   + N+         TG
Sbjct: 13  GWIGALALVTLIAVGTGGGLGVYLLGTVEKSVDLKQREEAGKAVKVLNY---------TG 63

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALI--CKDIPDK-VFLETLHQDIMAYIR 129
           D      L + S+  ++ N       W+R++ +++     +P+  V L  +  D +AY+R
Sbjct: 64  D------LSLRSVGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVTLAEIRADALAYLR 117

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           T+S+ QI GA G ++ +ED+ ERV  R++G V  +I  + ++
Sbjct: 118 TLSMAQIEGANGLQHLREDLNERVATRTKGAVRELIVESLVV 159


>gi|188579872|ref|YP_001923317.1| flagellar basal body-associated protein FliL [Methylobacterium
           populi BJ001]
 gi|179343370|gb|ACB78782.1| flagellar basal body-associated protein FliL [Methylobacterium
           populi BJ001]
          Length = 160

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 58/96 (60%), Gaps = 3/96 (3%)

Query: 79  KLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDK-VFLETLHQDIMAYIRTVSIKQ 135
           +L + S+  ++ N       W+R++ +++ K   +P+  V L  +  D +AY+RT+S+ Q
Sbjct: 64  ELSLRSVGSVVANLAEPTDSWVRIESSVVFKTGTLPNPDVTLAEIRADALAYLRTLSMAQ 123

Query: 136 ITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I GA G ++ +ED+ ERV +R++G V  +I  + ++
Sbjct: 124 IEGASGLQHLREDLNERVAIRTKGAVRELIVESLVV 159


>gi|114706621|ref|ZP_01439522.1| flagellar protein [Fulvimarina pelagi HTCC2506]
 gi|114538013|gb|EAU41136.1| flagellar protein [Fulvimarina pelagi HTCC2506]
          Length = 193

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 54/92 (58%), Gaps = 5/92 (5%)

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSI 133
           K L++ +L+P++TN  +    W+R++ ++I KD     PD +    +  D +A+ R++ I
Sbjct: 97  KPLRVVALKPVLTNLSNPSTSWIRIEASVIVKDDAETDPD-ILAAEIEADTLAFARSLQI 155

Query: 134 KQITGAQGFRYFKEDIEERVKLRSQGFVSSVI 165
            QI G +G  + ++D+ ER KLRS   V  +I
Sbjct: 156 AQIEGTRGLLHLRDDLRERAKLRSPAVVDYLI 187


>gi|319406981|emb|CBI80618.1| Flagellar basal body-associated protein FliL [Bartonella sp. 1-1C]
          Length = 166

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 76/168 (45%), Gaps = 25/168 (14%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGW-LGGIV---MLFLFAGQKEEKYQKFILNNFYDNSVR 67
           R +  K+F+    V T +    GW LG  V   M    +  KE    K   N    +S  
Sbjct: 14  RESSIKVFLIVGFVLTLVAAVSGWFLGAWVSREMAPTSSNLKELPMTKTPENLIAADS-- 71

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDI--- 124
                         I +L PI+TN       W+R++++L+ K  PD+    TL  DI   
Sbjct: 72  -------------HIVTLPPILTNIAVPENAWIRMEVSLVIK--PDENIESTLTADISND 116

Query: 125 -MAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +A++R V+I Q+ G  G    + D+ +R ++RS   VS+++  + ++
Sbjct: 117 FLAFLRQVTIDQVKGPSGLMNLRADLLDRARVRSDNKVSNILISSLVV 164


>gi|319898642|ref|YP_004158735.1| flagellar basal body-associated protein FliL [Bartonella
           clarridgeiae 73]
 gi|319402606|emb|CBI76151.1| Flagellar basal body-associated protein FliL [Bartonella
           clarridgeiae 73]
          Length = 166

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 76/164 (46%), Gaps = 17/164 (10%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           + N  K+F+   +V T +    GW         F G    +    I N+  +  V  V T
Sbjct: 14  KENSVKIFLIVGLVLTLVAAISGW---------FLGAWVSREMVPISNSSKEPPV--VKT 62

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDI----MAY 127
            + +      +  L PI+TN       W+R++++LI K  P++    TL  DI    + +
Sbjct: 63  PEYLVAADSHVVILPPILTNIAMPENAWIRMEVSLIIK--PNENIEATLTADISNDFLTF 120

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +R V+I Q+ G  G    + D+ +R ++RS   VS+++  + ++
Sbjct: 121 LRQVTIDQVKGPSGLMNLRADLLDRARIRSGNKVSNILISSLVV 164


>gi|319403966|emb|CBI77554.1| Flagellar basal body-associated protein FliL [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 166

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 75/164 (45%), Gaps = 17/164 (10%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           R +  K+F+    V T +    GW         F G    +      +N  +  +    T
Sbjct: 14  RESSIKVFLIVGFVLTLVAAVSGW---------FLGAWVSREMAPTSSNLKE--LPMTKT 62

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDI----MAY 127
            + +      I +L PI+TN       W+R++++L+ K  PD+    TL  DI    +A+
Sbjct: 63  PENLIAADSHIVTLPPILTNIAVPENAWIRMEVSLVIK--PDENIEATLTADISNDFLAF 120

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +R V+I Q+ G  G    + D+ +R ++RS   VS+++  + ++
Sbjct: 121 LRQVTIDQVKGPSGLMNLRADLLDRARVRSGNKVSNILISSLVV 164


>gi|170748102|ref|YP_001754362.1| flagellar basal body-associated protein FliL [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654624|gb|ACB23679.1| flagellar basal body-associated protein FliL [Methylobacterium
           radiotolerans JCM 2831]
          Length = 160

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 55/94 (58%), Gaps = 5/94 (5%)

Query: 82  IFSLQPIITNFDSSPKD-WLRLDIALICKD---IPDKVFLETLHQDIMAYIRTVSIKQIT 137
           + SL  ++TN  + P D W+RL+ ++I +       +  +  + QDI+ Y+RT+S+ QI 
Sbjct: 67  LTSLGTVVTNL-AGPGDVWVRLESSVIVRPGTFANPQAMVAEIRQDIVGYLRTLSVAQIE 125

Query: 138 GAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           G  G  + +ED+ ERV++RS G + +    T ++
Sbjct: 126 GPSGLSHLREDLTERVQIRSNGQIRTFFIETLVV 159


>gi|121602600|ref|YP_989395.1| flagellar basal body-associated protein FliL [Bartonella
           bacilliformis KC583]
 gi|120614777|gb|ABM45378.1| flagellar basal body-associated protein FliL [Bartonella
           bacilliformis KC583]
          Length = 165

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 51/89 (57%), Gaps = 2/89 (2%)

Query: 85  LQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLETLHQDIMAYIRTVSIKQITGAQGF 142
           L P++TN  S  K W+R++IALI K  +      +  +  D +A++R ++I Q+ G  G 
Sbjct: 75  LPPLVTNMASPEKAWIRVEIALIVKSGETISSTEVANISSDFLAFLRQITIDQVKGPSGL 134

Query: 143 RYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            + + D+ +R K+RS   +S+++    +I
Sbjct: 135 MHLRSDLFDRAKIRSGDKISNILISNLVI 163


>gi|319405406|emb|CBI79025.1| Flagellar basal body-associated protein FliL [Bartonella sp. AR
           15-3]
          Length = 166

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 52/95 (54%), Gaps = 6/95 (6%)

Query: 81  QIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDI----MAYIRTVSIKQI 136
            I  L PI+TN       W+R++++L+ K  PD+    TL  DI    +A++R  +I QI
Sbjct: 72  HIVILPPIVTNIAVPENAWIRMEVSLVIK--PDENIAATLTADISNDFLAFLRQATIDQI 129

Query: 137 TGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            G  G    + D+ +R ++RS   VS+++  + ++
Sbjct: 130 KGPSGLMNLRADLLDRARIRSGNKVSNILISSLVV 164


>gi|323136549|ref|ZP_08071630.1| flagellar basal body-associated protein FliL [Methylocystis sp.
           ATCC 49242]
 gi|322397866|gb|EFY00387.1| flagellar basal body-associated protein FliL [Methylocystis sp.
           ATCC 49242]
          Length = 185

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 5/99 (5%)

Query: 77  LKKLQIFSLQPIITNFDSSPKDWLRLDIALI--CKDIP--DKVFLETLHQDIMAYIRTVS 132
           L   ++  L  I+TN       W+RL  A++   K++P  +K+  E L  DI A++RT S
Sbjct: 87  LASFEVKELPAIVTNLAQPESSWIRLQAAIVYDPKELPHAEKLIAE-LTADITAFLRTAS 145

Query: 133 IKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I  + G+ G R  +E++ ER  +RS+  V   I  T ++
Sbjct: 146 ISSLEGSDGLRRLQEELGERATIRSERKVKEFIIETMVV 184


>gi|319409182|emb|CBI82826.1| Flagellar basal body-associated protein FliL [Bartonella
           schoenbuchensis R1]
          Length = 165

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 73/162 (45%), Gaps = 18/162 (11%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
           N  K  +   VV T +    GWL G+               K +  +  D+         
Sbjct: 16  NSVKTLLIVGVVLTVVAAASGWLLGM------------WVSKEVTPSSNDSKEPVAKASA 63

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----IPDKVFLETLHQDIMAYIR 129
           ++ +   ++  L PI+TN     K W+R++IAL+ K      PD V    +  D ++++ 
Sbjct: 64  SLIMDDSRMIILPPILTNIAVPDKTWIRMEIALVVKPGENISPDMV--ADISNDFVSFLH 121

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            ++I+Q+ G  G    + D+ +R K+RS   +S+++  + +I
Sbjct: 122 QMTIEQVKGPSGLMNLRSDLFDRAKIRSDDKISNILISSLVI 163


>gi|300024601|ref|YP_003757212.1| flagellar basal body-associated protein FliL [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526422|gb|ADJ24891.1| flagellar basal body-associated protein FliL [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 170

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 50/91 (54%), Gaps = 2/91 (2%)

Query: 83  FSLQPIITNFDSSPKDWLRLDIALIC--KDIPDKVFLETLHQDIMAYIRTVSIKQITGAQ 140
            S+  II +    PK  +RLD++++         V    + +DI+AY++ +++  I G +
Sbjct: 79  ISIPSIIVDLSGEPKSRVRLDVSIVAVHGTSEASVLKNEVREDIIAYLKGLTVADIQGVR 138

Query: 141 GFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           G +  +E +E+R K+R +G +  ++   F+I
Sbjct: 139 GLQNLREQLEDRAKIRGRGAILGLLIGGFVI 169


>gi|312115244|ref|YP_004012840.1| flagellar basal body-associated protein FliL [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220373|gb|ADP71741.1| flagellar basal body-associated protein FliL [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 144

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 55/106 (51%), Gaps = 3/106 (2%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK-DIPDKV-FLETLHQDIM 125
           SV    T++++  ++  L PI+ N  +     +RL+ A++ K DI D       +  D++
Sbjct: 39  SVTPNQTVTIRN-EVRVLAPIVANLANGSDLSVRLEAAVVLKPDIADAAEICAKISDDLV 97

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +++TVSI++I G  GF+  K D+  R      G    ++  TF++
Sbjct: 98  TFLKTVSIREIEGPTGFQLLKNDLRTRASRVGNGATLDLLILTFVV 143


>gi|254473297|ref|ZP_05086694.1| flagellar basal body-associated protein FliL [Pseudovibrio sp.
           JE062]
 gi|211957413|gb|EEA92616.1| flagellar basal body-associated protein FliL [Pseudovibrio sp.
           JE062]
          Length = 56

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 33/55 (60%)

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           ++ + QD++ Y RT+  +Q+ G +G    ++D+ ER K+R   FV  ++  + +I
Sbjct: 1   MKQVEQDLLLYARTLGPRQLEGTRGLLRLRDDLNERAKMRGGKFVKELVLESVVI 55


>gi|195433827|ref|XP_002064908.1| GK14954 [Drosophila willistoni]
 gi|194160993|gb|EDW75894.1| GK14954 [Drosophila willistoni]
          Length = 603

 Score = 36.6 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 7/79 (8%)

Query: 75  ISLKKLQIFSLQPIITN---FDSSPKDWLRLDIALICKDIPDKVF----LETLHQDIMAY 127
           ++L++ +   L PI+T     D++P   LR  +   C   PD  F    L  L  D+  Y
Sbjct: 251 MALQEREDKQLTPIVTKRKKLDTAPSPTLRKPVTSSCSSTPDWSFENINLNNLSDDVDKY 310

Query: 128 IRTVSIKQITGAQGFRYFK 146
           I T +I+ I    G  Y K
Sbjct: 311 IETDTIESILRTMGEEYLK 329


>gi|325475031|gb|EGC78217.1| hypothetical protein HMPREF9353_01064 [Treponema denticola F0402]
          Length = 324

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 13/84 (15%)

Query: 40  VMLFLFAGQK-EEKYQKFI-LNNFYDNSVRSVHTGDTISL--------KKLQIFSLQPII 89
           V LFL A    E + +K +  NN Y ++  ++ T +T SL        +K ++FS   + 
Sbjct: 75  VGLFLMAALGVEGEVEKLVDKNNSYKHTFTAIGTAETDSLPSLSFILDRKTKVFSYNGMK 134

Query: 90  TN---FDSSPKDWLRLDIALICKD 110
            +   F ++P+D+L+LD+ L+ KD
Sbjct: 135 IDSLSFSAAPEDYLKLDLTLVGKD 158


>gi|189426343|ref|YP_001953520.1| flagellar basal body-associated protein FliL [Geobacter lovleyi SZ]
 gi|189422602|gb|ACD97000.1| flagellar basal body-associated protein FliL [Geobacter lovleyi SZ]
          Length = 183

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 82  IFSLQPIITN-FDSSPKDWLRLDIALICKDIPDKVFLE----TLHQDIMAYIRTVSIKQI 136
           +FSL+P I N +D     +L++ + L       K  LE     +   I+  + T +++++
Sbjct: 87  VFSLEPFIVNIYDGQELRYLKVKVELEMVSAAVKPELEGRLAAIRDAILVVLTTKTLQEV 146

Query: 137 TGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
              QG    +E+I   + K+ +QG VS V F  F++
Sbjct: 147 QDVQGKNQLREEILTAISKIVAQGKVSKVYFTDFVV 182


>gi|153870843|ref|ZP_02000156.1| Band 7 protein [Beggiatoa sp. PS]
 gi|152072691|gb|EDN69844.1| Band 7 protein [Beggiatoa sp. PS]
          Length = 285

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 63/147 (42%), Gaps = 22/147 (14%)

Query: 28  FIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQP 87
           FI +  G  G  V+ +LF G  E  Y        Y      V   DT+ +  ++I   Q 
Sbjct: 41  FITVHAGEAG--VLYWLFLGGTETDYP-------YPEGFHIVWPWDTMHIYNMRI---QT 88

Query: 88  IITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMA-YIRTVSIKQITGAQGFRYFK 146
           I+ +FD   K  L + + L  +  P+   +  LHQ +   Y+ T+ I Q+         +
Sbjct: 89  ILHDFDVLTKQGLPIHLKLAIRFHPEYEMVGVLHQKVGPDYVNTIVIPQVESV-----LR 143

Query: 147 EDI----EERVKLRSQGFVSSVIFRTF 169
           ++I     E + +  +G ++++I R  
Sbjct: 144 KNIGHLNPEEIYINKEGILTTIIIRAL 170


>gi|315453005|ref|YP_004073275.1| putative flagellar protein FliL [Helicobacter felis ATCC 49179]
 gi|315132057|emb|CBY82685.1| possible flagellar protein FliL [Helicobacter felis ATCC 49179]
          Length = 182

 Score = 34.7 bits (78), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 73/169 (43%), Gaps = 21/169 (12%)

Query: 22  WFVVYTFIGIFCGWLGGIVMLFLF------------AGQKEEKYQKFILNNFYDNSVRSV 69
            FVV   + +    +G IV LF+              G   ++ +   +NN  D     V
Sbjct: 15  LFVVMGAVLVMLILVGVIVFLFMSKNAEPNGNAPKSGGAAAQQMRNAQMNNNTDEGSLMV 74

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFLETLHQD-IM 125
            + D +SL  L   +   ++     + + +L+  ++L   D   + +    ET  +D I+
Sbjct: 75  RSSDYLSLGPLYPLTGAFVVNLISQNGRRYLKASVSLELNDAKLLEEVKVKETAIKDTII 134

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLRS---QGFVSSVIFRTFII 171
             + + S+++IT  +G    KE+I  R  + S    GFV +V F  F+I
Sbjct: 135 EILSSKSVEEITTLKGKNRLKEEI--RSNINSFLIDGFVKNVFFTDFVI 181


Searching..................................................done


Results from round 2




>gi|254780373|ref|YP_003064786.1| flagellar basal body-associated protein FliL [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040050|gb|ACT56846.1| flagellar basal body-associated protein FliL [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 172

 Score =  230 bits (586), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 172/172 (100%), Positives = 172/172 (100%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN
Sbjct: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
           FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL
Sbjct: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA 172
           HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA
Sbjct: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA 172


>gi|315121842|ref|YP_004062331.1| flagellar basal body-associated protein FliL [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495244|gb|ADR51843.1| flagellar basal body-associated protein FliL [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 170

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 108/173 (62%), Positives = 132/173 (76%), Gaps = 4/173 (2%)

Query: 1   MSYDDTTSQYIRGN-QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           MSY+D     IRGN  ++ F+  F+V T IGIFCGWLGGIV+      +K+E   + I  
Sbjct: 1   MSYNDKN---IRGNQSYERFIMQFIVCTAIGIFCGWLGGIVISSFVLAEKKENSIESIFK 57

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
           N Y+N  RS++  D +  K  QIF+L PIITNFDSSP++WLRLD+ALIC   P+KVFLE 
Sbjct: 58  NVYNNRTRSIYANDAVYPKDPQIFALHPIITNFDSSPENWLRLDVALICDKTPNKVFLEI 117

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA 172
           LHQDIMAY+RTVS+K ITG+QGFRYFKED+EERVKLR+QG VS+VIFRTFIIA
Sbjct: 118 LHQDIMAYVRTVSMKHITGSQGFRYFKEDVEERVKLRAQGSVSNVIFRTFIIA 170


>gi|307318917|ref|ZP_07598348.1| flagellar basal body-associated protein FliL [Sinorhizobium
           meliloti AK83]
 gi|306895331|gb|EFN26086.1| flagellar basal body-associated protein FliL [Sinorhizobium
           meliloti AK83]
          Length = 163

 Score =  197 bits (500), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 92/168 (54%), Gaps = 7/168 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  S+  +     + +    V T +    GWL G+++    A +K E   +   N   +
Sbjct: 2   EEIESKETKAPSRLMTIAAVAVLTLVAGGGGWLAGMLLAPPPA-EKTEAAAELPANATGE 60

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
             +  +            I  L PI TN     ++W+RL++AL     PD    ET+HQD
Sbjct: 61  EDIPKIAA------VAHGIVQLDPITTNLAYPAENWVRLEVALQFDGAPDVALAETIHQD 114

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I AY++TVS++QI G +GF+Y ++DI+ERV LRS+G V++V+FRTF+I
Sbjct: 115 IAAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSEGRVTNVMFRTFVI 162


>gi|15964420|ref|NP_384773.1| flagellar transmembrane protein [Sinorhizobium meliloti 1021]
 gi|307311562|ref|ZP_07591203.1| flagellar basal body-associated protein FliL [Sinorhizobium
           meliloti BL225C]
 gi|15073597|emb|CAC45239.1| Flagellar transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306899579|gb|EFN30208.1| flagellar basal body-associated protein FliL [Sinorhizobium
           meliloti BL225C]
          Length = 163

 Score =  197 bits (500), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 92/168 (54%), Gaps = 7/168 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  S+  +     + +    V T +    GWL G+++    A +K E   +   N   +
Sbjct: 2   EEIESKETKAPSRLMTIAAVAVLTLVAGGGGWLAGMLLAPPPA-EKTEIPAELPANATGE 60

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
             +  +            I  L PI TN     ++W+RL++AL     PD    ET+HQD
Sbjct: 61  EGIPKMSA------VAHGIVQLDPITTNLAYPAENWVRLEVALQFDGAPDVALAETIHQD 114

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I AY++TVS++QI G +GF+Y ++DI+ERV LRS+G V++V+FRTF+I
Sbjct: 115 IAAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSEGRVTNVMFRTFVI 162


>gi|209547933|ref|YP_002279850.1| flagellar basal body-associated protein FliL [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209533689|gb|ACI53624.1| flagellar basal body-associated protein FliL [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 168

 Score =  195 bits (496), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 62/172 (36%), Positives = 94/172 (54%), Gaps = 6/172 (3%)

Query: 1   MSYDDTT-SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  D +  Q  + +   + +    V T +G   GW  G ++     G KE         
Sbjct: 1   MAEPDASAGQPKKKSGTLMMIIGIAVLTLLGAGGGWAVGTIVAPNIKGAKEA-----EQA 55

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
              +   ++      IS +   +  L+PI +N     ++W+RL++AL+    PD    E 
Sbjct: 56  KDAEAKKKAEEGLAHISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSED 115

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +HQDI+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 IHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|227820863|ref|YP_002824833.1| putative flagellar basal body-associated protein FliL
           [Sinorhizobium fredii NGR234]
 gi|227339862|gb|ACP24080.1| putative flagellar basal body-associated protein FliL
           [Sinorhizobium fredii NGR234]
          Length = 163

 Score =  193 bits (491), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 94/168 (55%), Gaps = 7/168 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++   +  +     + +    V T +    GWL GI +    A +K E   +   N   +
Sbjct: 2   EEIDIKQQKSPSLVMTIAAVAVLTLVAGGGGWLVGIFLAPPPA-EKAEAVAEVPENATGE 60

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
             +  + T      +   I  L+PI TN     ++W+R+++AL  K +PD    E +HQD
Sbjct: 61  EGLPKIAT------EANGIVQLEPITTNLAYPAENWVRVEVALQFKGVPDVALAEEIHQD 114

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I+AY++TVS++QI G +GF+Y ++DI+ERV LRS G V++V+FRTF+I
Sbjct: 115 IIAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSDGRVTNVMFRTFVI 162


>gi|116250487|ref|YP_766325.1| FliL flagella related protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255135|emb|CAK06209.1| method: conceptual translation supplied by author (flil) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 168

 Score =  193 bits (490), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 62/172 (36%), Positives = 94/172 (54%), Gaps = 6/172 (3%)

Query: 1   MSYDDTT-SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  D +  Q  + +   + +    V T +G   GW  G ++     G KE         
Sbjct: 1   MAEPDASAGQSHKKSGSLMTIIGIAVLTLLGAGGGWAVGTIVAPNIKGAKE-----VEQA 55

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
              +   ++      IS +   +  L+PI +N     ++W+RL++AL+    PD    E 
Sbjct: 56  KDAEAKKKAEEGLARISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSED 115

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +HQDI+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 IHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|86356317|ref|YP_468209.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CFN
           42]
 gi|86280419|gb|ABC89482.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CFN
           42]
          Length = 168

 Score =  193 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 62/172 (36%), Positives = 95/172 (55%), Gaps = 6/172 (3%)

Query: 1   MSYDD-TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ +D +  Q  + +   + +    V T +G   GW  G ++     G KE         
Sbjct: 1   MADEDISAGQSKKKSGPLMTIIGIAVLTLLGAGGGWAVGTIVAPEIKGAKE-----VEQA 55

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
              +   ++      IS +   +  L+PI +N     ++W+RL++AL+    PD    E 
Sbjct: 56  KEAEAKKKAEEGLARISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVAED 115

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +HQDI+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 IHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|241203111|ref|YP_002974207.1| flagellar basal body-associated protein FliL [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857001|gb|ACS54668.1| flagellar basal body-associated protein FliL [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 168

 Score =  193 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 62/172 (36%), Positives = 94/172 (54%), Gaps = 6/172 (3%)

Query: 1   MSYDDTT-SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  D +  Q  + +   + +    V T +G   GW  G ++     G KE         
Sbjct: 1   MAEPDASAGQSQKKSGALMTIIGIAVLTLLGAGGGWAVGTIVAPNIKGAKE-----VEQA 55

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
              +   ++      IS +   +  L+PI +N     ++W+RL++AL+    PD    E 
Sbjct: 56  KDAEAKKKAEEGLARISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSED 115

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +HQDI+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 IHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|222147576|ref|YP_002548533.1| flagellar protein [Agrobacterium vitis S4]
 gi|221734564|gb|ACM35527.1| flagellar protein [Agrobacterium vitis S4]
          Length = 172

 Score =  187 bits (474), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 54/171 (31%), Positives = 83/171 (48%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+         +     L +      T +G   GWL G ++       KEE+        
Sbjct: 1   MADAPALEGPSKKASPILLIAALAGLTVVGAGAGWLVGTMVAPKVKVAKEEQKAAEEAGG 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
                 +       +  +   I  L P+ TN     + W+RL++AL+     D    E +
Sbjct: 61  KKKEGEKEETGLPKLPAEANGIVQLDPVTTNLAYPSESWVRLEVALVFNGPVDAKLAEDI 120

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           HQD+MAY+RTVS++QI G +GF Y K+D+ ERV +RS+G VS ++FRTF+I
Sbjct: 121 HQDLMAYMRTVSLQQIEGPRGFDYLKDDLRERVDVRSEGRVSKLLFRTFVI 171


>gi|190890368|ref|YP_001976910.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
 gi|190695647|gb|ACE89732.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
          Length = 168

 Score =  185 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 93/172 (54%), Gaps = 6/172 (3%)

Query: 1   MSYDD-TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  D +  Q  + +   + +    + T +G   GW  G ++            ++    
Sbjct: 1   MADADLSAGQPKKKSGPLMTIIGVAILTLLGAGGGWAVGTIVAPEIKV-----AKEAEEA 55

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
              +   ++      IS +   +  L+PI +N     ++W+RL++AL+    PD    E 
Sbjct: 56  KDAEAKKKAEEGLAHISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVAED 115

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +HQDI+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 IHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|218679633|ref|ZP_03527530.1| orfc; method: conceptual translation supplied by author (flil)
           [Rhizobium etli CIAT 894]
          Length = 150

 Score =  184 bits (466), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 60/154 (38%), Positives = 87/154 (56%), Gaps = 5/154 (3%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           + +    V T +G   GW  G ++     G KE            +   ++      IS 
Sbjct: 1   MTIIGIAVLTLLGAGGGWAVGTIVAPNIKGAKEA-----EQAKDAEAKKKAEEGLARIST 55

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQIT 137
           +   I  L+PI +N     ++W+RL++AL+    PD    E +HQDI+AYIRTVS++QI 
Sbjct: 56  EANNIVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSEDIHQDILAYIRTVSLQQIE 115

Query: 138 GAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 GPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 149


>gi|218670414|ref|ZP_03520085.1| flagellar biosynthesis transmembrane protein [Rhizobium etli GR56]
          Length = 150

 Score =  181 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 58/154 (37%), Positives = 87/154 (56%), Gaps = 5/154 (3%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           + +    + T +G   GW  G ++     G KE            +   ++      IS 
Sbjct: 1   MTIMGVAILTLLGAGGGWAVGTIVAPEIKGAKEA-----EQAKDAEAKKKAEEGLARIST 55

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQIT 137
           +   +  L+PI +N     ++W+RL++AL+    PD    E +HQDI+AYIRTVS++QI 
Sbjct: 56  EANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSEDIHQDILAYIRTVSLQQIE 115

Query: 138 GAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 GPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 149


>gi|150395490|ref|YP_001325957.1| flagellar basal body-associated protein FliL [Sinorhizobium medicae
           WSM419]
 gi|150027005|gb|ABR59122.1| flagellar basal body-associated protein FliL [Sinorhizobium medicae
           WSM419]
          Length = 163

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 57/168 (33%), Positives = 93/168 (55%), Gaps = 7/168 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  S+  +     + +      T +    GWL G+++    A +K E   +   N   +
Sbjct: 2   EEIESKETKSPSRVMTIAAVAALTLVAGGGGWLAGMLLAPP-AAEKTEAAVELPANATGE 60

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
             +  + T          I  L PI TN     ++W+RL++AL    +PD    ET+HQD
Sbjct: 61  EEIARIAT------VANGIVQLDPITTNLAYPAENWVRLEVALQFNGVPDVALAETIHQD 114

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I AY++TVS++Q+ G +GF+Y ++DI+ERV LRS+G V+SV+FRTF+I
Sbjct: 115 IAAYLKTVSLQQVQGPRGFQYLRDDIQERVDLRSEGRVTSVMFRTFVI 162


>gi|2275166|gb|AAB81418.1| FliL [Sinorhizobium meliloti]
          Length = 163

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 51/168 (30%), Positives = 89/168 (52%), Gaps = 7/168 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  S+  +     + +    V T +    GWL G+++      +K E   +   N   +
Sbjct: 2   EEIESKETKATSRLMTIAAVAVLTLVAGGGGWLAGMLLAPPP-SEKTETAAELPANATGE 60

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
             +  +      +      +    +      S ++W+RL++AL     PD    ET+HQD
Sbjct: 61  EDIPKMSAVGHTARAARSDYDEPCL------SAENWVRLEVALQFDGAPDVALAETIHQD 114

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I AY++TVS++QI G +GF+Y ++DI+ERV LRS+G V++V+FRTF+I
Sbjct: 115 IAAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSEGRVTNVMFRTFVI 162


>gi|13472581|ref|NP_104148.1| hypothetical protein mlr2923 [Mesorhizobium loti MAFF303099]
 gi|14023327|dbj|BAB49934.1| mlr2923 [Mesorhizobium loti MAFF303099]
          Length = 164

 Score =  167 bits (423), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 46/163 (28%), Positives = 77/163 (47%), Gaps = 7/163 (4%)

Query: 9   QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRS 68
           Q  +G    +     +V T   I  GW+ G  +    A        +        ++ + 
Sbjct: 8   QPRKGPSLVVQGAMLLVVTAAAIGMGWMSGGYLKGAGAPSSVPVAPENEGKVAEPDAAQQ 67

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYI 128
             TG T       + +L PI TN  S    W+R++++++          E +HQD++A++
Sbjct: 68  PGTGPT-------LVALAPITTNIASPADTWIRMEVSVVYDAPQPPAMTEDIHQDLLAFV 120

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           RTV + QI GA G+++ K DIEER  +RSQG    V+ RT ++
Sbjct: 121 RTVKMHQIEGASGYQHLKADIEERASIRSQGHAKQVLIRTLLL 163


>gi|222084870|ref|YP_002543399.1| flagellar biosynthesis transmembrane protein [Agrobacterium
           radiobacter K84]
 gi|221722318|gb|ACM25474.1| flagellar biosynthesis transmembrane protein [Agrobacterium
           radiobacter K84]
          Length = 164

 Score =  166 bits (421), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 54/171 (31%), Positives = 88/171 (51%), Gaps = 8/171 (4%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     S   +G+   + +   +  T +G   GW  G ++                   
Sbjct: 1   MAEAADASANSKGSPLVMTIVGLLALTVLGGGGGWFLGTIVAPKIKAATAAVQAATQTTG 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
               ++          L+   I  L PIITN     ++W+RL+IAL+ K  PD    + +
Sbjct: 61  DEKQAIA--------PLESSNIVQLDPIITNLGYPSQNWIRLEIALVFKGQPDAQLAQAI 112

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           H+D++AY+RTVS++QI G +G +Y ++D++ERV LRS+G VS V+FRTF+I
Sbjct: 113 HEDVLAYVRTVSLQQIEGPRGLQYLRDDLQERVDLRSEGRVSKVMFRTFVI 163


>gi|260466614|ref|ZP_05812802.1| flagellar basal body-associated protein FliL [Mesorhizobium
           opportunistum WSM2075]
 gi|259029620|gb|EEW30908.1| flagellar basal body-associated protein FliL [Mesorhizobium
           opportunistum WSM2075]
          Length = 144

 Score =  163 bits (413), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 42/150 (28%), Positives = 72/150 (48%), Gaps = 7/150 (4%)

Query: 22  WFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQ 81
             +V T   I  GW+ G  +  + A        +         +     TG T       
Sbjct: 1   MLLVVTAAAIGMGWMSGGYLKGVGAPSSVPAAPENEGKTAEPAATHEPGTGST------- 53

Query: 82  IFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQG 141
           +  L PI TN  S  + WLR++++++          E +HQD++A++RT+ + QI GA G
Sbjct: 54  LVVLAPITTNIASPAETWLRMEVSVVYDAPQPPAMSEDIHQDLLAFVRTLKMHQIEGASG 113

Query: 142 FRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +++ K D++ER  +RSQG    V+ RT ++
Sbjct: 114 YQHLKADLDERASIRSQGHAKQVLIRTLLL 143


>gi|325291934|ref|YP_004277798.1| flagellar protein [Agrobacterium sp. H13-3]
 gi|325059787|gb|ADY63478.1| flagellar protein [Agrobacterium sp. H13-3]
          Length = 166

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 57/169 (33%), Positives = 89/169 (52%), Gaps = 5/169 (2%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            ++ T    + +   + +    + T +G   GW  G ++       K    +        
Sbjct: 2   ENEQTEGKKKSSPMVMTIAGVAILTLLGAGGGWFVGGMVAP-----KIAGAEAHAPAAAG 56

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQ 122
           ++  +     D I  +   I  L PI TN      +W+RL++AL+ K   +    E +HQ
Sbjct: 57  EHGEKKGEGIDKIPAEANGIVQLDPITTNLAYPSTNWVRLEVALMFKGPVEVNLAEDIHQ 116

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           DIMAY+RTVS++Q+ G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 117 DIMAYVRTVSLQQLEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 165


>gi|163758020|ref|ZP_02165108.1| flagellar biosynthesis transmembrane protein [Hoeflea phototrophica
           DFL-43]
 gi|162284309|gb|EDQ34592.1| flagellar biosynthesis transmembrane protein [Hoeflea phototrophica
           DFL-43]
          Length = 171

 Score =  157 bits (398), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 47/170 (27%), Positives = 93/170 (54%), Gaps = 3/170 (1%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           + D    Q  + +   + +   +V + +    GW+ G ++    A ++E   +       
Sbjct: 4   NEDQEEEQGKKKSGLIVTIAVVLVLSGLAGGGGWVVGGMIAPQVAVEEEAAVEAEESGEE 63

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLH 121
              + +    G+     +  +  L PI TN     + W+R++++L+    PD+   + +H
Sbjct: 64  GAEAEKDEEAGNK---SRENVLPLDPITTNLSYPSESWIRIEVSLLFGGAPDQALADQIH 120

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           QD+++Y+RTVS++QI G +GF+Y ++D+ ERV+LRS+G V+ ++FRTF+I
Sbjct: 121 QDVLSYLRTVSLQQIDGPRGFQYLRDDLRERVRLRSEGRVNDILFRTFVI 170


>gi|319898642|ref|YP_004158735.1| flagellar basal body-associated protein FliL [Bartonella
           clarridgeiae 73]
 gi|319402606|emb|CBI76151.1| Flagellar basal body-associated protein FliL [Bartonella
           clarridgeiae 73]
          Length = 166

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 39/175 (22%), Positives = 76/175 (43%), Gaps = 15/175 (8%)

Query: 1   MSYDDT--TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +     S   + N  K+F+   +V T +    GW         F G    +    I 
Sbjct: 1   MAEEPKKEESIVQKENSVKIFLIVGLVLTLVAAISGW---------FLGAWVSREMVPIS 51

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD--KVF 116
           N+  +  V  V T + +      +  L PI+TN       W+R++++LI K   +     
Sbjct: 52  NSSKEPPV--VKTPEYLVAADSHVVILPPILTNIAMPENAWIRMEVSLIIKPNENIEATL 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
              +  D + ++R V+I Q+ G  G    + D+ +R ++RS   VS+++  + ++
Sbjct: 110 TADISNDFLTFLRQVTIDQVKGPSGLMNLRADLLDRARIRSGNKVSNILISSLVV 164


>gi|110632651|ref|YP_672859.1| flagellar basal body-associated protein FliL [Mesorhizobium sp.
           BNC1]
 gi|110283635|gb|ABG61694.1| flagellar basal body-associated protein FliL [Chelativorans sp.
           BNC1]
          Length = 150

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 48/151 (31%), Positives = 75/151 (49%), Gaps = 7/151 (4%)

Query: 21  TWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKL 80
              +V T +    GWL G  +    A  + E   K       + +V+    G+    + L
Sbjct: 4   AALLVMTALAGGMGWLTGAYLEERSASGQSENAGK------TEVAVQEGQEGNEPDNESL 57

Query: 81  Q-IFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGA 139
             I +L PI TN       W+R+++AL+ +   D     T+HQD+ AYIRT+ +KQI  A
Sbjct: 58  SSIVALDPITTNLAEPTSIWVRMELALVFEGESDPTLARTIHQDLFAYIRTLRLKQIESA 117

Query: 140 QGFRYFKEDIEERVKLRSQGFVSSVIFRTFI 170
            GF++ K DI ER ++RS   V  V+  +F+
Sbjct: 118 SGFQHLKSDILERARIRSDDRVKQVLIMSFL 148


>gi|319406981|emb|CBI80618.1| Flagellar basal body-associated protein FliL [Bartonella sp. 1-1C]
          Length = 166

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 76/175 (43%), Gaps = 15/175 (8%)

Query: 1   MSYDDTTSQYI--RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +    + I  R +  K+F+    V T +    GW         F G    +      
Sbjct: 1   MAEESKKEENIVQRESSIKVFLIVGFVLTLVAAVSGW---------FLGAWVSREMAPTS 51

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD--KVF 116
           +N  +  +    T + +      I +L PI+TN       W+R++++L+ K   +     
Sbjct: 52  SNLKE--LPMTKTPENLIAADSHIVTLPPILTNIAVPENAWIRMEVSLVIKPDENIESTL 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
              +  D +A++R V+I Q+ G  G    + D+ +R ++RS   VS+++  + ++
Sbjct: 110 TADISNDFLAFLRQVTIDQVKGPSGLMNLRADLLDRARVRSDNKVSNILISSLVV 164


>gi|218460349|ref|ZP_03500440.1| orfc; method: conceptual translation supplied by author (flil)
           [Rhizobium etli Kim 5]
          Length = 123

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 49/99 (49%), Positives = 70/99 (70%)

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVS 132
             IS +   +  L+PI +N     ++W+RL++AL+    PD    E +HQDI+AYIRTVS
Sbjct: 24  ARISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSEDIHQDILAYIRTVS 83

Query: 133 IKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           ++QI G +GF+Y ++DI+ERV LRSQG VS V+FRTF+I
Sbjct: 84  LQQIEGPRGFQYLRDDIQERVDLRSQGRVSKVMFRTFVI 122


>gi|319403966|emb|CBI77554.1| Flagellar basal body-associated protein FliL [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 166

 Score =  155 bits (391), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 76/175 (43%), Gaps = 15/175 (8%)

Query: 1   MSYDDTTSQYI--RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +    + I  R +  K+F+    V T +    GW         F G    +      
Sbjct: 1   MAEESKKEENIVQRESSIKVFLIVGFVLTLVAAVSGW---------FLGAWVSREMAPTS 51

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD--KVF 116
           +N  +  +    T + +      I +L PI+TN       W+R++++L+ K   +     
Sbjct: 52  SNLKE--LPMTKTPENLIAADSHIVTLPPILTNIAVPENAWIRMEVSLVIKPDENIEATL 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
              +  D +A++R V+I Q+ G  G    + D+ +R ++RS   VS+++  + ++
Sbjct: 110 TADISNDFLAFLRQVTIDQVKGPSGLMNLRADLLDRARVRSGNKVSNILISSLVV 164


>gi|115523184|ref|YP_780095.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisA53]
 gi|115517131|gb|ABJ05115.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisA53]
          Length = 163

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 44/174 (25%), Positives = 84/174 (48%), Gaps = 15/174 (8%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS +D      + +    +V   ++ T +G   G L  + ++     Q+    QK I + 
Sbjct: 1   MSDEDAPKVERKQSSALQWVAVMLLLTAVGAAAGVLSSLHLVSTV--QRIADSQKEIQD- 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK---VFL 117
                        +      ++  L P++TN  S P  W+RL+ A++   + ++   + +
Sbjct: 58  ---------RPVASAFSPSARLRKLSPVVTNLASPPNTWVRLEAAVVTDQLSEEEANILV 108

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             + +D++AY+RT+S  QI GA+G +Y +ED+ ER  +RS G V  +I  T ++
Sbjct: 109 ARVGEDVVAYLRTISPAQIEGARGLQYLREDLNERAAIRSSGKVRELIIETLVV 162


>gi|319781676|ref|YP_004141152.1| flagellar basal body-associated protein FliL [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317167564|gb|ADV11102.1| flagellar basal body-associated protein FliL [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 164

 Score =  153 bits (387), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 40/163 (24%), Positives = 73/163 (44%), Gaps = 7/163 (4%)

Query: 9   QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRS 68
           Q  +G    +     ++ T   I  GW+ G  +  + A        +         +   
Sbjct: 8   QPRKGPSPVIQAGMLLLVTAAAIGVGWMSGGYLKGVGAPASVPVAPENEGKIMQPAAAEQ 67

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYI 128
              G         +  L PI TN  S    W+R++++++      +   + +HQD++A +
Sbjct: 68  PGLGPM-------LVVLAPITTNIASPAGTWIRMEVSVVYDAPQPQAMSDDIHQDLLALV 120

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           RT+ + QI GA G+++ K D+EER  +RSQG    V+ RT ++
Sbjct: 121 RTLKMHQIEGASGYQHLKADLEERAAIRSQGHAKQVLIRTLLL 163


>gi|15887893|ref|NP_353574.1| flagellar protein [Agrobacterium tumefaciens str. C58]
 gi|1086566|gb|AAB68973.1| orfC; Method: conceptual translation supplied by author
           [Agrobacterium tumefaciens]
 gi|2459719|gb|AAB71795.1| FliL [Agrobacterium tumefaciens]
 gi|15155485|gb|AAK86359.1| flagellar protein [Agrobacterium tumefaciens str. C58]
          Length = 166

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 85/168 (50%), Gaps = 4/168 (2%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  ++  + +   +     VV   +    G      M+      K    +         
Sbjct: 2   ENEQAEGKKKSSPLVMTIAGVVILTLLGAGGGWLVGGMIAP----KVAATEAHATAAAGG 57

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
           +  +     D I  +   I  L PI TN      +W+RL++AL+ K   +    E +HQD
Sbjct: 58  HGEKKGEGLDKIDAEANGIVQLDPITTNLAYPSTNWVRLEVALMFKGPVEVGLAEDIHQD 117

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           IMAY+RTVS++Q+ G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 118 IMAYVRTVSLQQLEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 165


>gi|225628630|ref|ZP_03786664.1| flagellar protein FliL [Brucella ceti str. Cudo]
 gi|237816669|ref|ZP_04595661.1| flagellar protein FliL [Brucella abortus str. 2308 A]
 gi|294853181|ref|ZP_06793853.1| flagellar basal body-associated protein FliL [Brucella sp. NVSL
           07-0026]
 gi|225616476|gb|EEH13524.1| flagellar protein FliL [Brucella ceti str. Cudo]
 gi|237787482|gb|EEP61698.1| flagellar protein FliL [Brucella abortus str. 2308 A]
 gi|294818836|gb|EFG35836.1| flagellar basal body-associated protein FliL [Brucella sp. NVSL
           07-0026]
          Length = 166

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 68/173 (39%), Gaps = 13/173 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS                 +    V T I    GW  G ++    AGQ+         + 
Sbjct: 4   MSDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMI---SAGQQASAKPSGKEDK 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLE 118
               S  S   G         +  LQPIITN       W+RL+ +L+ K           
Sbjct: 61  PKPGSFESRSIG--------AVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIPPAMAA 112

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 113 NVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 165


>gi|254720605|ref|ZP_05182416.1| flagellar basal body-associated protein FliL [Brucella sp. 83/13]
 gi|265985645|ref|ZP_06098380.1| flagellar basal body-associated protein FliL [Brucella sp. 83/13]
 gi|306838567|ref|ZP_07471404.1| flagellar basal body-associated protein FliL [Brucella sp. NF 2653]
 gi|264664237|gb|EEZ34498.1| flagellar basal body-associated protein FliL [Brucella sp. 83/13]
 gi|306406353|gb|EFM62595.1| flagellar basal body-associated protein FliL [Brucella sp. NF 2653]
          Length = 163

 Score =  151 bits (381), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 68/173 (39%), Gaps = 13/173 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS                 +    V T I    GW  G ++    AGQ+         + 
Sbjct: 1   MSDAAREKDGKAKGSMMGLLAVVAVLTAIAGGGGWYLGNII---SAGQQASAKPSGKEDK 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLE 118
               S  S   G         +  LQPIITN       W+RL+ +L+ K           
Sbjct: 58  PKPGSFESRSIG--------AVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIPPAMAA 109

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 110 NVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|23499921|ref|NP_699361.1| flagellar protein FliL [Brucella suis 1330]
 gi|62317107|ref|YP_222960.1| flagellar protein FliL [Brucella abortus bv. 1 str. 9-941]
 gi|83269099|ref|YP_418390.1| flagellar basal body-associated protein FliL [Brucella melitensis
           biovar Abortus 2308]
 gi|148557885|ref|YP_001257217.1| putative flagellar protein FliL [Brucella ovis ATCC 25840]
 gi|161620241|ref|YP_001594127.1| flagellar basal body-associated protein FliL [Brucella canis ATCC
           23365]
 gi|189022372|ref|YP_001932113.1| Flagellar basal body-associated protein FliL [Brucella abortus S19]
 gi|225686017|ref|YP_002733989.1| flagellar basal body-associated protein FliL [Brucella melitensis
           ATCC 23457]
 gi|254691407|ref|ZP_05154661.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           6 str. 870]
 gi|254695295|ref|ZP_05157123.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           3 str. Tulya]
 gi|254698390|ref|ZP_05160218.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254702581|ref|ZP_05164409.1| flagellar basal body-associated protein FliL [Brucella suis bv. 3
           str. 686]
 gi|254706287|ref|ZP_05168115.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M163/99/10]
 gi|254711419|ref|ZP_05173230.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis B2/94]
 gi|254731837|ref|ZP_05190415.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           4 str. 292]
 gi|256014947|ref|YP_003104956.1| flagellar protein FliL, putative [Brucella microti CCM 4915]
 gi|256029951|ref|ZP_05443565.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M292/94/1]
 gi|256043078|ref|ZP_05446022.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256059604|ref|ZP_05449802.1| flagellar basal body-associated protein FliL [Brucella neotomae
           5K33]
 gi|256111938|ref|ZP_05452889.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 3 str. Ether]
 gi|256158113|ref|ZP_05456031.1| flagellar basal body-associated protein FliL [Brucella ceti
           M490/95/1]
 gi|256252933|ref|ZP_05458469.1| flagellar basal body-associated protein FliL [Brucella ceti B1/94]
 gi|256256593|ref|ZP_05462129.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           9 str. C68]
 gi|256262860|ref|ZP_05465392.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 2 str. 63/9]
 gi|260544346|ref|ZP_05820167.1| flagellar basal body-associated protein FliL [Brucella abortus NCTC
           8038]
 gi|260564308|ref|ZP_05834793.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. 16M]
 gi|260568511|ref|ZP_05838980.1| flagellar basal body-associated protein FliL [Brucella suis bv. 4
           str. 40]
 gi|260757021|ref|ZP_05869369.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           6 str. 870]
 gi|260759607|ref|ZP_05871955.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           4 str. 292]
 gi|260762849|ref|ZP_05875181.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260882831|ref|ZP_05894445.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           9 str. C68]
 gi|261215664|ref|ZP_05929945.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           3 str. Tulya]
 gi|261220024|ref|ZP_05934305.1| flagellar basal body-associated protein FliL [Brucella ceti B1/94]
 gi|261313731|ref|ZP_05952928.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M163/99/10]
 gi|261319027|ref|ZP_05958224.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis B2/94]
 gi|261323571|ref|ZP_05962768.1| flagellar basal body-associated protein FliL [Brucella neotomae
           5K33]
 gi|261753161|ref|ZP_05996870.1| flagellar basal body-associated protein FliL [Brucella suis bv. 3
           str. 686]
 gi|265986970|ref|ZP_06099527.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M292/94/1]
 gi|265989516|ref|ZP_06102073.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265993385|ref|ZP_06105942.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 3 str. Ether]
 gi|265996630|ref|ZP_06109187.1| flagellar basal body-associated protein FliL [Brucella ceti
           M490/95/1]
 gi|297249949|ref|ZP_06933650.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           5 str. B3196]
 gi|23463498|gb|AAN33366.1| flagellar protein FliL, putative [Brucella suis 1330]
 gi|62197300|gb|AAX75599.1| hypothetical FliL, flagellar protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82939373|emb|CAJ12323.1| Flagellar basal body-associated protein FliL [Brucella melitensis
           biovar Abortus 2308]
 gi|148369170|gb|ABQ62042.1| putative flagellar protein FliL [Brucella ovis ATCC 25840]
 gi|161337052|gb|ABX63356.1| flagellar basal body-associated protein FliL [Brucella canis ATCC
           23365]
 gi|189020946|gb|ACD73667.1| Flagellar basal body-associated protein FliL [Brucella abortus S19]
 gi|225642122|gb|ACO02035.1| flagellar basal body-associated protein FliL [Brucella melitensis
           ATCC 23457]
 gi|255997607|gb|ACU49294.1| flagellar protein FliL, putative [Brucella microti CCM 4915]
 gi|260097617|gb|EEW81491.1| flagellar basal body-associated protein FliL [Brucella abortus NCTC
           8038]
 gi|260151951|gb|EEW87044.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. 16M]
 gi|260155176|gb|EEW90257.1| flagellar basal body-associated protein FliL [Brucella suis bv. 4
           str. 40]
 gi|260669925|gb|EEX56865.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           4 str. 292]
 gi|260673270|gb|EEX60091.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260677129|gb|EEX63950.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           6 str. 870]
 gi|260872359|gb|EEX79428.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           9 str. C68]
 gi|260917271|gb|EEX84132.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           3 str. Tulya]
 gi|260918608|gb|EEX85261.1| flagellar basal body-associated protein FliL [Brucella ceti B1/94]
 gi|261298250|gb|EEY01747.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis B2/94]
 gi|261299551|gb|EEY03048.1| flagellar basal body-associated protein FliL [Brucella neotomae
           5K33]
 gi|261302757|gb|EEY06254.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M163/99/10]
 gi|261742914|gb|EEY30840.1| flagellar basal body-associated protein FliL [Brucella suis bv. 3
           str. 686]
 gi|262550927|gb|EEZ07088.1| flagellar basal body-associated protein FliL [Brucella ceti
           M490/95/1]
 gi|262764255|gb|EEZ10287.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 3 str. Ether]
 gi|263000185|gb|EEZ12875.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|263092695|gb|EEZ16904.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264659167|gb|EEZ29428.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M292/94/1]
 gi|297173818|gb|EFH33182.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           5 str. B3196]
 gi|326410340|gb|ADZ67404.1| Flagellar basal body-associated protein FliL [Brucella melitensis
           M28]
 gi|326553632|gb|ADZ88271.1| Flagellar basal body-associated protein FliL [Brucella melitensis
           M5-90]
          Length = 163

 Score =  151 bits (381), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 68/173 (39%), Gaps = 13/173 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS                 +    V T I    GW  G ++    AGQ+         + 
Sbjct: 1   MSDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMI---SAGQQASAKPSGKEDK 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLE 118
               S  S   G         +  LQPIITN       W+RL+ +L+ K           
Sbjct: 58  PKPGSFESRSIG--------AVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIPPAMAA 109

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 110 NVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|306846273|ref|ZP_07478834.1| flagellar basal body-associated protein FliL [Brucella sp. BO1]
 gi|306273268|gb|EFM55137.1| flagellar basal body-associated protein FliL [Brucella sp. BO1]
          Length = 163

 Score =  150 bits (379), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 44/173 (25%), Positives = 68/173 (39%), Gaps = 13/173 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS                 +    V T I    GW  G ++    AGQ+         + 
Sbjct: 1   MSDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMI---SAGQQASAKPSGKEDK 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLE 118
               S  +   G         +  LQPIITN       W+RL+ +L+ K           
Sbjct: 58  PKPGSFEARSIG--------AVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIPPAMAA 109

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 110 NVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|306841044|ref|ZP_07473768.1| flagellar basal body-associated protein FliL [Brucella sp. BO2]
 gi|306288933|gb|EFM60233.1| flagellar basal body-associated protein FliL [Brucella sp. BO2]
          Length = 163

 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 45/174 (25%), Positives = 67/174 (38%), Gaps = 15/174 (8%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGW-LGGIVMLFLFAGQKEEKYQKFILN 59
           MS                 +    V T I    GW LG ++     A  K     K    
Sbjct: 1   MSDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMISAGQQASAK--PSGKEDKP 58

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFL 117
                  RS+            +  LQPIITN       W+RL+ +L+ K          
Sbjct: 59  KRGSFEARSIGA----------VVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIPPAMA 108

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 109 ANVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|319409182|emb|CBI82826.1| Flagellar basal body-associated protein FliL [Bartonella
           schoenbuchensis R1]
          Length = 165

 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 72/160 (45%), Gaps = 14/160 (8%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
           N  K  +   VV T +    GWL G+               K +  +  D+         
Sbjct: 16  NSVKTLLIVGVVLTVVAAASGWLLGM------------WVSKEVTPSSNDSKEPVAKASA 63

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD--KVFLETLHQDIMAYIRTV 131
           ++ +   ++  L PI+TN     K W+R++IAL+ K   +     +  +  D ++++  +
Sbjct: 64  SLIMDDSRMIILPPILTNIAVPDKTWIRMEIALVVKPGENISPDMVADISNDFVSFLHQM 123

Query: 132 SIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +I+Q+ G  G    + D+ +R K+RS   +S+++  + +I
Sbjct: 124 TIEQVKGPSGLMNLRSDLFDRAKIRSDDKISNILISSLVI 163


>gi|254712019|ref|ZP_05173830.1| flagellar basal body-associated protein FliL [Brucella ceti
           M644/93/1]
 gi|254715088|ref|ZP_05176899.1| flagellar basal body-associated protein FliL [Brucella ceti
           M13/05/1]
 gi|261216797|ref|ZP_05931078.1| flagellar basal body-associated protein FliL [Brucella ceti
           M13/05/1]
 gi|261319664|ref|ZP_05958861.1| flagellar basal body-associated protein FliL [Brucella ceti
           M644/93/1]
 gi|260921886|gb|EEX88454.1| flagellar basal body-associated protein FliL [Brucella ceti
           M13/05/1]
 gi|261292354|gb|EEX95850.1| flagellar basal body-associated protein FliL [Brucella ceti
           M644/93/1]
          Length = 163

 Score =  146 bits (369), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 44/173 (25%), Positives = 67/173 (38%), Gaps = 13/173 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M                  +    V T I    GW  G ++    AGQ+         + 
Sbjct: 1   MRDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMI---SAGQQASAKPSGKEDK 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLE 118
               S  S   G         +  LQPIITN       W+RL+ +L+ K           
Sbjct: 58  PKPGSFESRSIG--------AVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIPPAMAA 109

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 110 NVSDDFMRFLRSVNLMQLLGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|304392501|ref|ZP_07374441.1| flagellar basal body-associated protein FliL [Ahrensia sp. R2A130]
 gi|303295131|gb|EFL89491.1| flagellar basal body-associated protein FliL [Ahrensia sp. R2A130]
          Length = 150

 Score =  146 bits (367), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 46/164 (28%), Positives = 74/164 (45%), Gaps = 16/164 (9%)

Query: 8   SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVR 67
           +   +       +  FV+ T IG   G+ G       F GQK+   +  I          
Sbjct: 2   AAEKKKGGVLGTIIMFVMVTAIGAGMGFGG-----LWFQGQKKVAVEPEI---------- 46

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAY 127
            V  G+      L +  LQPI+TN  +    W+RL+++L+  D  D    E + QD+ A 
Sbjct: 47  -VAKGEKPEPATLHVHDLQPILTNIAAPKDVWVRLELSLLTVDAIDAKLAEEIGQDLFAL 105

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +RT+ + Q+ G  GF   +  I++R K R    V  V+FRT ++
Sbjct: 106 MRTIRLDQMEGPSGFLALRHAIDQRAKFRGGEMVERVLFRTLVL 149


>gi|158422253|ref|YP_001523545.1| flagellar basal body-associated protein [Azorhizobium caulinodans
           ORS 571]
 gi|158329142|dbj|BAF86627.1| flagellar basal body-associated protein [Azorhizobium caulinodans
           ORS 571]
          Length = 176

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 78/164 (47%), Gaps = 13/164 (7%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVH 70
              N  K  +   ++ T +G+  G   G+ +          K ++  +        +  +
Sbjct: 22  KEQNGTKGLILAILILTVLGVATGGGLGVQLATTVEKVVAAKAKEEPVKKEQ----QLFY 77

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLE-TLHQDIMAY 127
            G+T+      +  ++P+I N  S P  W+R++ + + K   + +    E TL +D+M+Y
Sbjct: 78  AGNTM------MQPMKPVIVNLASPPNTWVRIESSFVFKNGALANPALTESTLREDMMSY 131

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +RT+++ Q  G    +  +ED+ ER ++RS+G V  +I  T ++
Sbjct: 132 LRTLTLSQFEGPSALQQLREDLNERARVRSEGRVDELIIETLVV 175


>gi|121602600|ref|YP_989395.1| flagellar basal body-associated protein FliL [Bartonella
           bacilliformis KC583]
 gi|120614777|gb|ABM45378.1| flagellar basal body-associated protein FliL [Bartonella
           bacilliformis KC583]
          Length = 165

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 70/167 (41%), Gaps = 14/167 (8%)

Query: 7   TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSV 66
            +   + N  K  +   ++ T I    GW   +               + I      +  
Sbjct: 9   EATVNKDNSVKTLLIVGLILTLIAGAAGWFLSL------------WVSQEIRQTSGASKD 56

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLETLHQDI 124
            S+    +  +       L P++TN  S  K W+R++IALI K  +      +  +  D 
Sbjct: 57  SSIAIPASKIMADTHTVVLPPLVTNMASPEKAWIRVEIALIVKSGETISSTEVANISSDF 116

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +A++R ++I Q+ G  G  + + D+ +R K+RS   +S+++    +I
Sbjct: 117 LAFLRQITIDQVKGPSGLMHLRSDLFDRAKIRSGDKISNILISNLVI 163


>gi|90422615|ref|YP_530985.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisB18]
 gi|90104629|gb|ABD86666.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisB18]
          Length = 147

 Score =  137 bits (346), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 40/159 (25%), Positives = 78/159 (49%), Gaps = 19/159 (11%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFA--GQKEEKYQKFILNNFYDNSVRSVHTGDTI 75
            ++  F+V T +    G L  + +L         ++K +     + +  S R        
Sbjct: 2   QWLVVFLVLTAVSAAAGVLSSLHVLSAVQHTADTQQKVEPPPAASAFSPSAR-------- 53

Query: 76  SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK---VFLETLHQDIMAYIRTVS 132
                 +  + P++TN  S P  W+R++ ++I   + D+   V +  + +D+++Y+RT+S
Sbjct: 54  ------LRKMAPVVTNMASPPGAWIRVEASVITDQVDDEQANVLIARVGEDVVSYLRTIS 107

Query: 133 IKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             QI GA+G +Y +ED+ ER  +RS G V  +I  T ++
Sbjct: 108 PTQIEGARGLQYLREDLNERAAIRSSGKVRELIIETLVV 146


>gi|319405406|emb|CBI79025.1| Flagellar basal body-associated protein FliL [Bartonella sp. AR
           15-3]
          Length = 166

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 76/175 (43%), Gaps = 15/175 (8%)

Query: 1   MSYDDTTSQYI--RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +    + I  + +  K+F+    V T + +  GW         F G    +      
Sbjct: 1   MAEEPKKEKNIVQQESSLKIFLVVVFVLTLVAVASGW---------FLGAWVSREMAPTS 51

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD--KVF 116
           +NF +  +    T + +      I  L PI+TN       W+R++++L+ K   +     
Sbjct: 52  SNFKE--LPVTKTSENLIAADSHIVILPPIVTNIAVPENAWIRMEVSLVIKPDENIAATL 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
              +  D +A++R  +I QI G  G    + D+ +R ++RS   VS+++  + ++
Sbjct: 110 TADISNDFLAFLRQATIDQIKGPSGLMNLRADLLDRARIRSGNKVSNILISSLVV 164


>gi|27381979|ref|NP_773508.1| flagellar protein [Bradyrhizobium japonicum USDA 110]
 gi|27355149|dbj|BAC52133.1| flagellar protein [Bradyrhizobium japonicum USDA 110]
          Length = 148

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 73/157 (46%), Gaps = 15/157 (9%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
             +   V  T + I  G L G+ +    A ++    +K          + S + G     
Sbjct: 3   RLIAAIVALTLVAIGAGALAGLHL--FAAAERVADAKKSPT----PPPLASSYAGSA--- 53

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK---VFLETLHQDIMAYIRTVSIK 134
              ++  L PI+TN  +   +W R++ +++   + D+   +    + +DI+ Y+R+ S  
Sbjct: 54  ---RLRKLSPIVTNLAAPANNWARVEASMVTDSMSDEDAGILAAHISEDIVTYLRSASAA 110

Query: 135 QITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           Q  G++G ++ ++D+ ER  +RS G V  +I  T +I
Sbjct: 111 QFEGSRGLQHLRDDLAERANVRSSGKVRELIIETLVI 147


>gi|182680543|ref|YP_001834689.1| flagellar basal body-associated protein FliL [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182636426|gb|ACB97200.1| flagellar basal body-associated protein FliL [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 167

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/171 (19%), Positives = 62/171 (36%), Gaps = 14/171 (8%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
               S           +   V  T      G   G  ++      K       I      
Sbjct: 7   PALPSNPSLSQSKLHRLGVLVGLTLFAGAVGASVGYYLVLSIK-AKLADTMSTIEKENSP 65

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFLETL 120
           + +             +  + L PII N    P  W+RL+  ++         +V    L
Sbjct: 66  SKLG----------ANVNAWPLPPIIANLADPPNSWIRLETVMLFDSKIVPKPEVLSMQL 115

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             D++ Y++T+S+ Q+ G  GF+  ++D+ ER  +RS G +  ++ +  +I
Sbjct: 116 TTDVLGYLKTLSVAQLAGPSGFQNLRDDLNERAHIRSNGAIQELVIQALVI 166


>gi|239834437|ref|ZP_04682765.1| flagellar basal body-associated protein FliL [Ochrobactrum
           intermedium LMG 3301]
 gi|239822500|gb|EEQ94069.1| flagellar basal body-associated protein FliL [Ochrobactrum
           intermedium LMG 3301]
          Length = 167

 Score =  131 bits (328), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 68/169 (40%), Gaps = 10/169 (5%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           DTT+    G       T       + +  G  G  +   + A Q          +     
Sbjct: 6   DTTTTETDGKAKSSLTTLLAAVAVLTVIAGGGGWYLGGMISADQLASAKVSGKEDKPKKG 65

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLETLHQ 122
              S   G         +  LQPI+TN       W+RL+ +L+ K           ++  
Sbjct: 66  DFESRSIG--------TVVPLQPIVTNLGIPQDTWVRLEASLVAKPGHEIPAALAASVGD 117

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           D ++++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 118 DFLSFLRSVNLMQLQGAAGLAYLRADLEERARLRSEGAVDRVFISALVV 166


>gi|328545500|ref|YP_004305609.1| flagellar basal body-associated protein FliL [polymorphum gilvum
           SL003B-26A1]
 gi|326415241|gb|ADZ72304.1| Flagellar basal body-associated protein FliL [Polymorphum gilvum
           SL003B-26A1]
          Length = 169

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/178 (19%), Positives = 69/178 (38%), Gaps = 17/178 (9%)

Query: 1   MSYDDTTSQYIR----GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKF 56
           M+         R    G     FV      T +    G + G+ +               
Sbjct: 1   MADTAFPGSTRRVRASGGSSAGFVGMLAFLTLLACGVGAVAGLHLAETVRE--------- 51

Query: 57  ILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPD 113
                      +      +     ++  L+P++TN  +    W+RL  +++  D      
Sbjct: 52  -AAAREARGASASAPAAPVYAVNARLRGLKPLVTNLAAPRDAWIRLQASIVLDDGDVEEA 110

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +    + +D++AY+RT+++ Q+ GA G ++ +ED+ ER   RS G V  +I  + +I
Sbjct: 111 GMLAGRIEEDVVAYLRTITLSQVEGAAGLQHLREDLNERAVARSGGRVRELILESLVI 168


>gi|153011519|ref|YP_001372733.1| flagellar basal body-associated protein FliL [Ochrobactrum anthropi
           ATCC 49188]
 gi|151563407|gb|ABS16904.1| flagellar basal body-associated protein FliL [Ochrobactrum anthropi
           ATCC 49188]
          Length = 164

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/174 (24%), Positives = 70/174 (40%), Gaps = 14/174 (8%)

Query: 1   MSYDDTTSQYIRGNQHKL-FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           MS    T +  +        +    V T I    G      M+        +   K    
Sbjct: 1   MSDTTVTEKDGKAKGSLTGLLAAVAVLTVIAGGGG-WYLGGMISADQLASAKPSGKEDKP 59

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFL 117
              D   RS+ T          +  LQPIITN       W+RL+ +L+ K          
Sbjct: 60  KQGDFESRSIGT----------VVPLQPIITNLGIPQNTWVRLEASLVAKPGHEIPAAVA 109

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            ++  D ++++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 110 ASVGDDFLSFLRSVNLMQLQGAAGLAYLRSDLEERARLRSEGAVERVFISALVV 163


>gi|217976230|ref|YP_002360377.1| flagellar basal body-associated protein FliL [Methylocella
           silvestris BL2]
 gi|217501606|gb|ACK49015.1| flagellar basal body-associated protein FliL [Methylocella
           silvestris BL2]
          Length = 168

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/170 (21%), Positives = 63/170 (37%), Gaps = 15/170 (8%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           +  S    G     F       T + +  G   G  +  +   Q          +     
Sbjct: 10  EAASTRPAGASLAAFAGLMAALTIVAMISGGALGARLGAVVKTQLAGAPGSARADA---- 65

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP---DKVFLETLH 121
                    +     + +  L PII N       W+RL   L+          V    + 
Sbjct: 66  --------QSAYSGGVNLQDLPPIIANLAEPSDAWVRLQATLVLDRPASGKPDVLAAQIA 117

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +DI+ ++RT ++ QI GA G ++ +ED+ ER  +RS G V  +I +T ++
Sbjct: 118 EDILGFMRTATLSQIAGASGLQHLREDLNERAMIRSDGRVRELILQTLVV 167


>gi|17989426|ref|NP_542059.1| flagellar protein FliL [Brucella melitensis bv. 1 str. 16M]
 gi|17985303|gb|AAL54323.1| flagellar protein flil [Brucella melitensis bv. 1 str. 16M]
          Length = 124

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 58/131 (44%), Gaps = 10/131 (7%)

Query: 43  FLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRL 102
            + AGQ+         +     S  S   G         +  LQPIITN       W+RL
Sbjct: 1   MISAGQQASAKPSGKEDKPKPGSFESRSIG--------AVVPLQPIITNLGIPQTTWVRL 52

Query: 103 DIALICKD--IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF 160
           + +L+ K            +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G 
Sbjct: 53  EASLVAKPGHEIPPAMAANVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGA 112

Query: 161 VSSVIFRTFII 171
           V  V     ++
Sbjct: 113 VDRVFISALVV 123


>gi|188579872|ref|YP_001923317.1| flagellar basal body-associated protein FliL [Methylobacterium
           populi BJ001]
 gi|179343370|gb|ACB78782.1| flagellar basal body-associated protein FliL [Methylobacterium
           populi BJ001]
          Length = 160

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 65/150 (43%), Gaps = 9/150 (6%)

Query: 31  IFCGWLGGIVMLFLFAGQKEEKYQK------FILNNFYDNSVRSVHTGDTISLKKLQIFS 84
              GW+G + ++ L A                   +                  +L + S
Sbjct: 10  GGKGWIGALALVTLVAVGTGGGLGVYLLGSVEKSVDLKKREEADKAVKVLNYTGELSLRS 69

Query: 85  LQPIITNFDSSPKDWLRLDIALICKD---IPDKVFLETLHQDIMAYIRTVSIKQITGAQG 141
           +  ++ N       W+R++ +++ K        V L  +  D +AY+RT+S+ QI GA G
Sbjct: 70  VGSVVANLAEPTDSWVRIESSVVFKTGTLPNPDVTLAEIRADALAYLRTLSMAQIEGASG 129

Query: 142 FRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            ++ +ED+ ERV +R++G V  +I  + ++
Sbjct: 130 LQHLREDLNERVAIRTKGAVRELIVESLVV 159


>gi|118589976|ref|ZP_01547380.1| flagellar basal body-associated protein FliL [Stappia aggregata IAM
           12614]
 gi|118437473|gb|EAV44110.1| flagellar basal body-associated protein FliL [Stappia aggregata IAM
           12614]
          Length = 166

 Score =  124 bits (311), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 35/147 (23%), Positives = 72/147 (48%), Gaps = 8/147 (5%)

Query: 33  CGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN-----SVRSVHTGDTISLKKLQIFSLQP 87
            G++  +V+L L  G       K++ +   +        +   T         ++  L+P
Sbjct: 19  SGFVAAMVLLTLIGGGAGAGLAKYVADYTEEEVHGRLRQQQSFTDTLPFSPSTRLQRLEP 78

Query: 88  IITNFDSSPKDWLRLDIALICKDIPDK---VFLETLHQDIMAYIRTVSIKQITGAQGFRY 144
           ++TN  S    W+R+  +++ +D PD    V  + +  D + Y+RT+++  + G  G ++
Sbjct: 79  LVTNLASPQDAWIRVQASILLEDDPDGDAGVLKKKVEDDFLGYMRTLTLSHLEGGIGLQH 138

Query: 145 FKEDIEERVKLRSQGFVSSVIFRTFII 171
            +ED+ ER + R++G VS VI  + +I
Sbjct: 139 LREDLTERAQTRTRGQVSEVILESVVI 165


>gi|218528671|ref|YP_002419487.1| flagellar basal body-associated protein FliL [Methylobacterium
           chloromethanicum CM4]
 gi|218520974|gb|ACK81559.1| flagellar basal body-associated protein FliL [Methylobacterium
           chloromethanicum CM4]
          Length = 160

 Score =  124 bits (310), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 62/150 (41%), Gaps = 9/150 (6%)

Query: 31  IFCGWLGGIVMLFLFAGQKEEKYQK------FILNNFYDNSVRSVHTGDTISLKKLQIFS 84
              GW+G + ++ L A                   +                   L + S
Sbjct: 10  GGKGWIGALALVTLIAVGTGGGLGVYLLGTVEKSVDLKQREEAGKAVKALNYTGDLSLRS 69

Query: 85  LQPIITNFDSSPKDWLRLDIALICKD---IPDKVFLETLHQDIMAYIRTVSIKQITGAQG 141
           +  ++ N       W+R++ +++          V L  +  D +AY+RT+S+ QI GA G
Sbjct: 70  VGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVTLAEIRADALAYLRTLSMAQIEGANG 129

Query: 142 FRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            ++ +ED+ ERV  R++G V  +I  + ++
Sbjct: 130 LQHLREDLNERVATRTKGAVRELIVESLVV 159


>gi|254501481|ref|ZP_05113632.1| flagellar basal body-associated protein FliL [Labrenzia alexandrii
           DFL-11]
 gi|222437552|gb|EEE44231.1| flagellar basal body-associated protein FliL [Labrenzia alexandrii
           DFL-11]
          Length = 160

 Score =  123 bits (309), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 33/149 (22%), Positives = 69/149 (46%), Gaps = 8/149 (5%)

Query: 31  IFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDT-----ISLKKLQIFSL 85
               +L  ++++ L          K + +         +    T           ++  L
Sbjct: 11  AKSNFLAALILISLIGAGAGAGLAKIVSDMTETAVHGRIRDAQTFSQTLPFSPSTRLQRL 70

Query: 86  QPIITNFDSSPKDWLRLDIALICKDIPD---KVFLETLHQDIMAYIRTVSIKQITGAQGF 142
           +P++TN  + P  W+R+   L+ +D PD    V  + +  D ++++RT+++  + G  G 
Sbjct: 71  EPLVTNLATPPSTWIRVQATLLLEDEPDTDVSVLRKRIEDDFLSFLRTLTLAHLEGGVGL 130

Query: 143 RYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           ++ +ED+ ER K+RS+G V  VI  + +I
Sbjct: 131 QHLREDLNERAKVRSKGMVREVILESVVI 159


>gi|163850068|ref|YP_001638111.1| flagellar basal body-associated protein FliL [Methylobacterium
           extorquens PA1]
 gi|163661673|gb|ABY29040.1| flagellar basal body-associated protein FliL [Methylobacterium
           extorquens PA1]
          Length = 160

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 62/150 (41%), Gaps = 9/150 (6%)

Query: 31  IFCGWLGGIVMLFLFAGQKEEKYQK------FILNNFYDNSVRSVHTGDTISLKKLQIFS 84
              GW+G + ++ L A                   +                   L + S
Sbjct: 10  GGKGWIGALALVTLIAVGTGGGLGVYLLGTVEKSVDLKQREEAGKAVKVLNYTGDLSLRS 69

Query: 85  LQPIITNFDSSPKDWLRLDIALICKD---IPDKVFLETLHQDIMAYIRTVSIKQITGAQG 141
           +  ++ N       W+R++ +++          V L  +  D +AY+RT+S+ QI GA G
Sbjct: 70  VGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVTLAEIRADALAYLRTLSLAQIEGANG 129

Query: 142 FRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            ++ +ED+ ERV  R++G V  +I  + ++
Sbjct: 130 LQHLREDLNERVATRTKGAVRELIVESLVV 159


>gi|254559214|ref|YP_003066309.1| flagellar basal body-associated protein FliL [Methylobacterium
           extorquens DM4]
 gi|254266492|emb|CAX22256.1| Flagellar basal body-associated protein FliL [Methylobacterium
           extorquens DM4]
          Length = 160

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 62/150 (41%), Gaps = 9/150 (6%)

Query: 31  IFCGWLGGIVMLFLFAGQKEEKYQK------FILNNFYDNSVRSVHTGDTISLKKLQIFS 84
              GW+G + ++ L A                   +                   L + S
Sbjct: 10  GGKGWIGALALVTLIAVGTGGGLGVYLLGTVEKSVDLKQREEAGKAVKVLNYTGDLSLRS 69

Query: 85  LQPIITNFDSSPKDWLRLDIALICKD---IPDKVFLETLHQDIMAYIRTVSIKQITGAQG 141
           +  ++ N       W+R++ +++          V L  +  D +AY+RT+S+ QI GA G
Sbjct: 70  VGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVTLAEIRADALAYLRTLSMAQIEGANG 129

Query: 142 FRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            ++ +ED+ ERV  R++G V  +I  + ++
Sbjct: 130 LQHLREDLNERVATRTKGAVRELIVESLVV 159


>gi|240137202|ref|YP_002961671.1| Flagellar basal body-associated protein FliL [Methylobacterium
           extorquens AM1]
 gi|240007168|gb|ACS38394.1| Flagellar basal body-associated protein FliL [Methylobacterium
           extorquens AM1]
          Length = 160

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/162 (21%), Positives = 70/162 (43%), Gaps = 13/162 (8%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
               K ++    + T I +     G    L ++     EK            +V+ ++  
Sbjct: 8   KKSGKGWIGALALVTLIAV-----GTGGGLGVYLLGTVEKSVDLKQREEAGKAVKVLN-- 60

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFLETLHQDIMAYIR 129
                  L + S+  ++ N       W+R++ +++          V L  +  D +AY+R
Sbjct: 61  ---YTGDLSLRSVGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVTLAEIRADALAYLR 117

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           T+S+ QI GA G ++ +ED+ ERV  R++G V  +I  + ++
Sbjct: 118 TLSMAQIEGANGLQHLREDLNERVATRTKGAVRELIVESLVV 159


>gi|170748102|ref|YP_001754362.1| flagellar basal body-associated protein FliL [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654624|gb|ACB23679.1| flagellar basal body-associated protein FliL [Methylobacterium
           radiotolerans JCM 2831]
          Length = 160

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/143 (25%), Positives = 66/143 (46%), Gaps = 13/143 (9%)

Query: 32  FCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITN 91
             G   G+ M+       +E+          D  VR V    T   +   + SL  ++TN
Sbjct: 27  GVGAASGLHMIARVEKALDER------RKAQDEQVRPV----TAYAENDTLTSLGTVVTN 76

Query: 92  FDSSPKDWLRLDIALICKD---IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKED 148
                  W+RL+ ++I +       +  +  + QDI+ Y+RT+S+ QI G  G  + +ED
Sbjct: 77  LAGPGDVWVRLESSVIVRPGTFANPQAMVAEIRQDIVGYLRTLSVAQIEGPSGLSHLRED 136

Query: 149 IEERVKLRSQGFVSSVIFRTFII 171
           + ERV++RS G + +    T ++
Sbjct: 137 LTERVQIRSNGQIRTFFIETLVV 159


>gi|296445180|ref|ZP_06887140.1| flagellar basal body-associated protein FliL [Methylosinus
           trichosporium OB3b]
 gi|296257354|gb|EFH04421.1| flagellar basal body-associated protein FliL [Methylosinus
           trichosporium OB3b]
          Length = 191

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/190 (22%), Positives = 77/190 (40%), Gaps = 19/190 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLF--LFAGQKEEKYQKFIL 58
           M+    +S     +     V   VV T + +  G   G  ++     A    ++ ++   
Sbjct: 1   MAGPSASSSPAPSSSSMQTVVALVVATLLAVGGGVFLGSTLVGDKPQAPAHGDEVKESAA 60

Query: 59  NNFYDNSVRSVH--------------TGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDI 104
                 +  +                        K ++  L PI+TN   S   W+RL  
Sbjct: 61  APAKPAAEPANKSHGGGHGSAAGAKEAPAPAPTPKWKLKELAPIVTNLSESEAGWVRLQA 120

Query: 105 ALICK--DIPDK-VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFV 161
           A+I     +P+  + +  +  DI+AY+RT+++  I GA G R   ED+ ER  +RS+G V
Sbjct: 121 AIIYDMAALPEPDMLVSQVTADIVAYLRTMTLASIQGADGLRRLHEDLSERAAIRSEGHV 180

Query: 162 SSVIFRTFII 171
             +I +  ++
Sbjct: 181 RELIIQALVV 190


>gi|170741216|ref|YP_001769871.1| flagellar basal body-associated protein FliL [Methylobacterium sp.
           4-46]
 gi|168195490|gb|ACA17437.1| flagellar basal body-associated protein FliL [Methylobacterium sp.
           4-46]
          Length = 163

 Score =  116 bits (291), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 42/171 (24%), Positives = 72/171 (42%), Gaps = 16/171 (9%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
            D+T+   +G   K ++    V          L                       +   
Sbjct: 5   PDSTTAPKKG---KGWLLALAV----------LTLGAGGTGGGLGYYLLTTVEKAVDKKK 51

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFLETL 120
              ++           L   S+ P++TN   S + W+RL+ ++I +        V +  +
Sbjct: 52  TEEQARAEKVLTYTGDLSTRSVGPLVTNLVDSGEMWVRLEGSIIYRTGAVANPDVAVAEI 111

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            QDI+AY+RTVS+ Q+ GA G  + +ED+ ERV LR++G V  ++  T II
Sbjct: 112 RQDILAYLRTVSLAQLQGASGLMHLREDLNERVMLRTKGAVRELVVETLII 162


>gi|323136549|ref|ZP_08071630.1| flagellar basal body-associated protein FliL [Methylocystis sp.
           ATCC 49242]
 gi|322397866|gb|EFY00387.1| flagellar basal body-associated protein FliL [Methylocystis sp.
           ATCC 49242]
          Length = 185

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 50/131 (38%), Gaps = 3/131 (2%)

Query: 44  LFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLD 103
                   ++     +                 L   ++  L  I+TN       W+RL 
Sbjct: 54  NPPPDAGSEHADAHGDPHKKGGGHGDAKKKAPDLASFEVKELPAIVTNLAQPESSWIRLQ 113

Query: 104 IALICKD---IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF 160
            A++         +  +  L  DI A++RT SI  + G+ G R  +E++ ER  +RS+  
Sbjct: 114 AAIVYDPKELPHAEKLIAELTADITAFLRTASISSLEGSDGLRRLQEELGERATIRSERK 173

Query: 161 VSSVIFRTFII 171
           V   I  T ++
Sbjct: 174 VKEFIIETMVV 184


>gi|114706621|ref|ZP_01439522.1| flagellar protein [Fulvimarina pelagi HTCC2506]
 gi|114538013|gb|EAU41136.1| flagellar protein [Fulvimarina pelagi HTCC2506]
          Length = 193

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/182 (20%), Positives = 73/182 (40%), Gaps = 19/182 (10%)

Query: 8   SQYIRGNQHKLFVTWFVVYTFIGIFCG----WLGGIVMLFLFAGQKEEKYQKFILNNFY- 62
               +G      +   V+ T IG   G     + G  +    A  K E            
Sbjct: 12  GTKKKGGGMMPLIAALVLVTLIGGGGGAAMGVMLGGGLSGEEATDKAETASDDTKAETGG 71

Query: 63  ----------DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP 112
                     +    S+        K L++ +L+P++TN  +    W+R++ ++I KD  
Sbjct: 72  EHDTAEAGLGEGGEDSIAEIAEEEEKPLRVVALKPVLTNLSNPSTSWIRIEASVIVKDDA 131

Query: 113 DK---VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTF 169
           +    +    +  D +A+ R++ I QI G +G  + ++D+ ER KLRS   V   + +  
Sbjct: 132 ETDPDILAAEIEADTLAFARSLQIAQIEGTRGLLHLRDDLRERAKLRSP-AVVDYLIQAM 190

Query: 170 II 171
           ++
Sbjct: 191 VV 192


>gi|312115244|ref|YP_004012840.1| flagellar basal body-associated protein FliL [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220373|gb|ADP71741.1| flagellar basal body-associated protein FliL [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 144

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 3/110 (2%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK-DIPDKV-FLETLH 121
               SV    T++++  ++  L PI+ N  +     +RL+ A++ K DI D       + 
Sbjct: 35  QPAPSVTPNQTVTIR-NEVRVLAPIVANLANGSDLSVRLEAAVVLKPDIADAAEICAKIS 93

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            D++ +++TVSI++I G  GF+  K D+  R      G    ++  TF++
Sbjct: 94  DDLVTFLKTVSIREIEGPTGFQLLKNDLRTRASRVGNGATLDLLILTFVV 143


>gi|300024601|ref|YP_003757212.1| flagellar basal body-associated protein FliL [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526422|gb|ADJ24891.1| flagellar basal body-associated protein FliL [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 170

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/166 (19%), Positives = 63/166 (37%), Gaps = 9/166 (5%)

Query: 8   SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVR 67
           S           V   +    +GI  G   G   + +             +      SV 
Sbjct: 11  SAPSAAPSTGDLVKSMIAAVVLGIAGGGAFGYFAVPVGPA-------PAPVEEAKPASVA 63

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALIC--KDIPDKVFLETLHQDIM 125
                           S+  II +    PK  +RLD++++         V    + +DI+
Sbjct: 64  PEAPSAGRFPSDALEISIPSIIVDLSGEPKSRVRLDVSIVAVHGTSEASVLKNEVREDII 123

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           AY++ +++  I G +G +  +E +E+R K+R +G +  ++   F+I
Sbjct: 124 AYLKGLTVADIQGVRGLQNLREQLEDRAKIRGRGAILGLLIGGFVI 169


>gi|254473297|ref|ZP_05086694.1| flagellar basal body-associated protein FliL [Pseudovibrio sp.
           JE062]
 gi|211957413|gb|EEA92616.1| flagellar basal body-associated protein FliL [Pseudovibrio sp.
           JE062]
          Length = 56

 Score = 67.5 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 32/54 (59%)

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           + + QD++ Y RT+  +Q+ G +G    ++D+ ER K+R   FV  ++  + +I
Sbjct: 2   KQVEQDLLLYARTLGPRQLEGTRGLLRLRDDLNERAKMRGGKFVKELVLESVVI 55


>gi|260432136|ref|ZP_05786107.1| flagellar basal body-associated protein FliL [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415964|gb|EEX09223.1| flagellar basal body-associated protein FliL [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 165

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/175 (13%), Positives = 54/175 (30%), Gaps = 15/175 (8%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+          G   K  +   +V    G   G+      L      K EK  +     
Sbjct: 1   MTDATAEQAEAPGKSGKTGLIIGIVLALAGAAGGYFLTTSGLLPIGATKTEKSAEHTPGE 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIAL---ICKDIPDKVFL 117
              +++  V           +   L P+I + ++S    L+    L          +   
Sbjct: 61  SPVSALPVV-----------EFVDLPPVIVSVNTSDSRHLKFHAQLEVEAAHAAEVEAMK 109

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
             +   +  Y+R + +  +  +      +  +  R+  +  +G V  V+   F++
Sbjct: 110 PRIMDVMNTYLRAIDLSDLQDSLALMRIRGHLHRRIGMVVGEGRVRDVLVMEFVL 164


>gi|77464891|ref|YP_354395.1| flagellar synthesis protein [Rhodobacter sphaeroides 2.4.1]
 gi|126463733|ref|YP_001044847.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides ATCC 17029]
 gi|77389309|gb|ABA80494.1| possible flagellar synthesis protein [Rhodobacter sphaeroides
           2.4.1]
 gi|126105397|gb|ABN78075.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 162

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/176 (14%), Positives = 53/176 (30%), Gaps = 20/176 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+            +  L +   VV   +    G+      L L A    E         
Sbjct: 1   MADAGADQIETTKKRSLLPLILGVVLALVLGGGGFYATWSGLILGASGGHEAETAHEAPA 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL-ICKDIPDKV--F 116
                           L  +    + PI+ +         LR    L + K    +V   
Sbjct: 61  A---------------LPDIAFVPIDPIVISLGRGSDLSHLRFAAQLEVAKANAAEVTML 105

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           +  +   I  Y+R V++ ++         +  +  R+++   +G V  ++   F++
Sbjct: 106 MPRIVDVINGYLRAVAVSRLEDPTALVELRAQMLRRIQIVTGEGRVRDLLVTEFVL 161


>gi|56695123|ref|YP_165470.1| flagellar basal body-associated protein FliL [Ruegeria pomeroyi
           DSS-3]
 gi|56676860|gb|AAV93526.1| flagellar basal body-associated protein FliL [Ruegeria pomeroyi
           DSS-3]
          Length = 168

 Score = 57.1 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 59/179 (32%), Gaps = 20/179 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+              K  +   +V   +G   G+   +  L     Q      +    +
Sbjct: 1   MTDATADEVEPEKKSGKKGLIVGLVLALVGAGGGFYATVSGLIPLGAQ----PAEEHGES 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITN-FDSSPKDWLRLDIALICKDIPDKVFL-- 117
             D+            L  +    LQPI+ +      +  LR    L   ++P++     
Sbjct: 57  GGDHGAVVPDA-----LPNVAYVDLQPIMVSLLGEGGQRHLRFHAQL---EVPEQYLADV 108

Query: 118 ETLHQDIM----AYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           E +   I+     Y+R + I  ++        +  ++ R+ +   +G V  V+   F++
Sbjct: 109 EKIRPRIVDVLNGYLRAIEISDLSDPLALTRLRGHMQRRINIVAGEGRVKDVLVMEFVL 167


>gi|322421725|ref|YP_004200948.1| flagellar basal body-associated protein FliL [Geobacter sp. M18]
 gi|320128112|gb|ADW15672.1| flagellar basal body-associated protein FliL [Geobacter sp. M18]
          Length = 174

 Score = 57.1 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 32/178 (17%), Positives = 61/178 (34%), Gaps = 12/178 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+      +    N  KLF+    V   + I          +     +K  +  K     
Sbjct: 1   MAEPAKAQETPEKNNKKLFIIIGAVVGVLAIGG---AAAFFMGGSKKEKAPEGAKVEAKA 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD-WLRLDIAL-----ICKDIPDK 114
              +   +   G+  +     I+ L+P I N     +  +L+L +         K   D 
Sbjct: 58  EGGHGAPA-KEGEGGAAVGGTIYPLEPFIVNIYDGQELRYLKLKVEFEMANPQAKGELDA 116

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
                L   I+  + T ++++I   QG    +E I   V K+     ++ V F  F++
Sbjct: 117 KM-APLRDAILILLTTKTMQEIQDLQGKNQLREQILAAVSKVVPPSKITKVYFTDFVV 173


>gi|99082788|ref|YP_614942.1| flagellar basal body-associated protein FliL [Ruegeria sp. TM1040]
 gi|99039068|gb|ABF65680.1| Flagellar fliL protein [Ruegeria sp. TM1040]
          Length = 174

 Score = 54.8 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 52/175 (29%), Gaps = 11/175 (6%)

Query: 4   DDTTSQYIRGNQHK--LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           D            K  + +   +V    G   G+      L  F           +    
Sbjct: 3   DAVADVETDQPAKKSKMPLIIGLVLGIAGAGGGFYAVQSGLLPFGN----TPAPEMAQAT 58

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIAL-ICKDIPDKVFL 117
            +             +  L    ++PI+   + +    +   R  + +        +  L
Sbjct: 59  KEAPEGVDKGESAEEIANLAFIEMEPIVVTLNRASGVQQLRFRAQLEVNQADQDEVETVL 118

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
             +   + +Y+R + ++ +T        +  +  R+ +   QG V  ++   F++
Sbjct: 119 PRVVDVLNSYLRALELEDLTDPMALPKLRAQMLRRINIVTGQGRVRDLLIMDFVL 173


>gi|332559790|ref|ZP_08414112.1| FliL2 [Rhodobacter sphaeroides WS8N]
 gi|332277502|gb|EGJ22817.1| FliL2 [Rhodobacter sphaeroides WS8N]
          Length = 162

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 54/176 (30%), Gaps = 20/176 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+            +  L +   VV   +    G+      L L A              
Sbjct: 1   MADAGADQIETTKKRSLLPLILGVVLALVLGGGGFYATWSGLILGASG------------ 48

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL-ICKDIPDKV--F 116
                          +L  +    + PI+ +         LR    L + K    +V   
Sbjct: 49  ---GHEAEPAHEAPAALPDIAFVPIDPIVISLGRGSDLSHLRFAAQLEVAKANAAEVTML 105

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
           +  +   I  Y+R V++ ++         +  +  R+++ + +G V  ++   F++
Sbjct: 106 MPRIVDVINGYLRAVAVSRLEDPTALVELRAQMLRRIQIVTGEGRVRDLLVTEFVL 161


>gi|221640812|ref|YP_002527074.1| Flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides KD131]
 gi|221161593|gb|ACM02573.1| Flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides KD131]
          Length = 162

 Score = 54.4 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 54/176 (30%), Gaps = 20/176 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+            +  L +   VV   +    G+      L L A              
Sbjct: 1   MADAGADQIETTKKRSLLPLILGVVLALVLGGGGFYATWSGLILGASG------------ 48

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL-ICKDIPDKV--F 116
                          +L  +    + PI+ +         LR    L + K    +V   
Sbjct: 49  ---GHEAEPAHEAPAALPDIAFVPIDPIVISLGRGSDLSHLRFAAQLEVPKANAAEVTML 105

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
           +  +   I  Y+R V++ ++         +  +  R+++ + +G V  ++   F++
Sbjct: 106 MPRIVDVINGYLRAVAVSRLEDPTALVELRAQMLRRIQIVTGEGRVRDLLVTEFVL 161


>gi|163738047|ref|ZP_02145463.1| flagellar basal body-associated protein FliL [Phaeobacter
           gallaeciensis BS107]
 gi|163742557|ref|ZP_02149943.1| flagellar basal body-associated protein FliL [Phaeobacter
           gallaeciensis 2.10]
 gi|161384142|gb|EDQ08525.1| flagellar basal body-associated protein FliL [Phaeobacter
           gallaeciensis 2.10]
 gi|161388663|gb|EDQ13016.1| flagellar basal body-associated protein FliL [Phaeobacter
           gallaeciensis BS107]
          Length = 174

 Score = 54.0 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 25/172 (14%), Positives = 61/172 (35%), Gaps = 13/172 (7%)

Query: 7   TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSV 66
           T Q     + KL +   VV   +G   G+      L  F     +      ++       
Sbjct: 8   TEQDAPAKKSKLPLIIGVVLALVGAGGGFFAVQSGLLPF----GQSAAPEGVDATEVAPE 63

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKD-----WLRLDIALICKDIPDKVFLETLH 121
              +      +  L    ++PI+     +          +L++ L  +   +K+    + 
Sbjct: 64  GVDNGESAEDIANLAFIEMEPIVITLRKASGLKHLRFRSQLEVDLAHRAEVEKILPRVV- 122

Query: 122 QDIM-AYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
            D++ +Y+R + ++ +T        +  +  R+ +   QG V  ++   F++
Sbjct: 123 -DVLNSYLRALELEDLTDPMALPKLRAQMLRRINIAAGQGRVRDLLIMDFVL 173


>gi|222053612|ref|YP_002535974.1| flagellar basal body-associated protein FliL [Geobacter sp. FRC-32]
 gi|221562901|gb|ACM18873.1| flagellar basal body-associated protein FliL [Geobacter sp. FRC-32]
          Length = 166

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/177 (14%), Positives = 67/177 (37%), Gaps = 18/177 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +   + N+    +    V   I I    +   +M+    G+K  K Q+     
Sbjct: 1   MAEQKEEAVPAKDNKKLFIIIGAAVLALIVIA---VIVAMMMGGGKGEKPAKAQEAKAEK 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKVFL 117
             +   ++             ++ L+P I N     +     ++++  +   +I  ++  
Sbjct: 58  KGEGGEKASAA---------TVYPLEPFIVNIYDGQELRYLKIKVEFEMAAAEIKTEIDA 108

Query: 118 ET--LHQDIMAYIRTVSIKQITGAQGFRYFKED-IEERVKLRSQGFVSSVIFRTFII 171
           +   L   ++  + T +++++   QG    +++ +   VK+   G V  V F  F++
Sbjct: 109 QQSALRDAVLVLLTTKTMREVQDLQGKNQLRDEILSTTVKILGPGKVIKVYFTDFVV 165


>gi|75675316|ref|YP_317737.1| flagellar basal body-associated protein FliL [Nitrobacter
           winogradskyi Nb-255]
 gi|74420186|gb|ABA04385.1| Flagellar basal body-associated protein FliL [Nitrobacter
           winogradskyi Nb-255]
          Length = 162

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 28/185 (15%), Positives = 62/185 (33%), Gaps = 38/185 (20%)

Query: 1   MSYDDTTSQYIRGNQ------HKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQ 54
           M+ +D T +   G+        KL          +     W     M     G++  + Q
Sbjct: 1   MAENDQTGKAADGDAPPARKRFKLIAAIGAALFLVTGGSIW---FFMFHHSVGEQHAEAQ 57

Query: 55  KFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-LDIALICKDIPD 113
                +F                       +  ++ N   +P + ++ L + L+ +   +
Sbjct: 58  PPKPPSF---------------------VDVPDMLVNLVGAPGERVQYLKLKLVLEVKEE 96

Query: 114 KVFLE------TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIF 166
               +       +      Y+R +    + G+ G    KE++  RV  + S   V++V+F
Sbjct: 97  PQVEKIRPALPRVTDLFQTYMRELRPSDLNGSAGLFRLKEELTRRVNAVLSPDHVNAVLF 156

Query: 167 RTFII 171
           +  +I
Sbjct: 157 KEVVI 161


>gi|254510615|ref|ZP_05122682.1| flagellar basal body-associated protein FliL [Rhodobacteraceae
           bacterium KLH11]
 gi|221534326|gb|EEE37314.1| flagellar basal body-associated protein FliL [Rhodobacteraceae
           bacterium KLH11]
          Length = 176

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/175 (13%), Positives = 52/175 (29%), Gaps = 15/175 (8%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+              K  +   +    +G   G+      L  FA Q+  K        
Sbjct: 12  MTDATADEAEATKKSGKKGLVLGLFLALVGGVGGYFITASGLLPFANQEVAKDADKKGEG 71

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFL 117
                +  V               L P+I + ++S    L+    L          +   
Sbjct: 72  ASVKGLPDVA-----------FVDLPPVIISVNTSDSRHLKFHAQLEVNAGYTADIEKMQ 120

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
             +   + +Y+R V +  +  +      +  +  R+ +   +G V  V+   F++
Sbjct: 121 PRIMDVLNSYLRAVELTDLEDSLALVRIRGHLLRRIGIVVGEGRVRDVLVMEFVL 175


>gi|296283226|ref|ZP_06861224.1| flagellar basal body-associated protein [Citromicrobium
           bathyomarinum JL354]
          Length = 183

 Score = 51.3 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 57/176 (32%), Gaps = 10/176 (5%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +  +  ++  R ++ K  +        +G   G     +M      + +E          
Sbjct: 9   AKPEEGAKPPRFSKKKKIIAAAGAVLLVGGGAG---AFLMGGGSDAEAKESGDHSGKEAK 65

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNF--DSSPKDWLRLDIALICKDIPDKVFLET 119
            D        G         +  + P++ N   +     +L+L I L      D   +E 
Sbjct: 66  KDAGHGEKSGGGHGEEGGSGLVEVAPLMVNLRTNDGQARFLKLRIMLAPGSPEDATTIEE 125

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-VKLRSQGFVSSVIFRTFI 170
               +      ++R +  + + G+      KE++  R      +G V+ V+ +  +
Sbjct: 126 NLPMIIDRYQPFLRELRPEDLAGSAAVYRLKEELILRAADTVGEGVVADVLIQDMV 181


>gi|326404074|ref|YP_004284156.1| flagellar FliL protein [Acidiphilium multivorum AIU301]
 gi|325050936|dbj|BAJ81274.1| flagellar FliL protein [Acidiphilium multivorum AIU301]
          Length = 170

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 60/179 (33%), Gaps = 33/179 (18%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCG-WLGGIVMLFLFAGQKEEKYQKFILN 59
           +          + ++ KLFV    V   + +  G W+ GI  L    GQ+          
Sbjct: 16  LPEAGAEEAPAKSSRRKLFVIGGAVAAIMLLVVGLWITGI--LPHLLGQR---------- 63

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP--KDWLRLDIALICKDIPDKVFL 117
                        +   L       +  I+ N +       +++L+  +   D       
Sbjct: 64  -------------NHHKLAGPVYVKVPEIVANLNVPSGQDSYVKLEATIELADPKSAKIA 110

Query: 118 ET----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-VSSVIFRTFII 171
            T    +      Y+R +   ++ GA G    +E +  RVK+ +    V  ++F+  I+
Sbjct: 111 MTDMPRVVDVFETYLRAMRPDELRGASGTYRLREALINRVKIATAPAIVKDILFQELIV 169


>gi|254476693|ref|ZP_05090079.1| flagellar basal body-associated protein FliL [Ruegeria sp. R11]
 gi|214030936|gb|EEB71771.1| flagellar basal body-associated protein FliL [Ruegeria sp. R11]
          Length = 156

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 22/161 (13%), Positives = 56/161 (34%), Gaps = 13/161 (8%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           + +   VV    G   G+      L  F     +      +           +      +
Sbjct: 1   MPLIIGVVLAIAGAGGGFFAVQSGLLPF----GQSAAPEGVKATEVAPEGVDNGESAEDI 56

Query: 78  KKLQIFSLQPIITNFDSSPKD-----WLRLDIALICKDIPDKVFLETLHQDIM-AYIRTV 131
             L    ++PII +   +          +L++ L  +   +K+    +  D++ +Y+R +
Sbjct: 57  ANLAFIEMEPIIISLRKASGLQHLRFRSQLEVDLAHQAEVEKILPRIV--DVLNSYLRAL 114

Query: 132 SIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
            ++ +T        +  +  R+ +   QG V  ++   F++
Sbjct: 115 ELEDLTDPMALPKLRAQMLRRINIAAGQGRVRDLLIMDFVL 155


>gi|46201207|ref|ZP_00055553.2| COG1580: Flagellar basal body-associated protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 181

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 24/173 (13%), Positives = 60/173 (34%), Gaps = 18/173 (10%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           + S   +    K+ +    +   +G   G      +L    G+K+E              
Sbjct: 19  SDSPSKKPPIKKILMIVLPILLLVGAGAGVYFSG-LLDKLTGKKDEHAPAAEAAPPP--- 74

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSP------KDWLRLDIALICKDIPDKVFLET 119
                     +++      L  ++ N  ++       K  + L++  +      +  L  
Sbjct: 75  -------PPKAVQAASFMDLPEMLVNLQTTGRKQAFLKLRVALELEAVTDQPRVEQMLPR 127

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
           +  +   Y+R + ++ + GA G    +E++  RV        V+ V+F+  ++
Sbjct: 128 IIDNFQIYLRELRVEDLQGASGMHLLREELLTRVNAAVKPVKVNDVLFKEMLV 180


>gi|296531736|ref|ZP_06894562.1| flagellar basal body-associated protein FliL [Roseomonas cervicalis
           ATCC 49957]
 gi|296267935|gb|EFH13736.1| flagellar basal body-associated protein FliL [Roseomonas cervicalis
           ATCC 49957]
          Length = 177

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 100 LRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK- 154
           LRL IA+     P     ++    ++  ++ Y+RT+   ++ GA      + D+  R + 
Sbjct: 100 LRLRIAVEINGDPALLQPELLSPRIYDSLLLYLRTLREGEMEGALAMDRLRGDLHRRFEL 159

Query: 155 LRSQGFVSSVIFRTFIIA 172
           L   G V  V+   F++A
Sbjct: 160 LLGPGKVRDVLITGFVVA 177


>gi|254466464|ref|ZP_05079875.1| flagellar basal body-associated protein FliL [Rhodobacterales
           bacterium Y4I]
 gi|206687372|gb|EDZ47854.1| flagellar basal body-associated protein FliL [Rhodobacterales
           bacterium Y4I]
          Length = 174

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 60/174 (34%), Gaps = 14/174 (8%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           DT +           +   VV    G   G+    V   L    ++   +          
Sbjct: 7   DTEADAPAKKGKLPLII-GVVLALAGAGGGFFA--VQSGLLPFGQKAAPEPAHAAEEAPE 63

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD-----WLRLDIALICKDIPDKVFLET 119
            V +  T + I    L    + PI+     +          +L++ L  +   +K+    
Sbjct: 64  GVDTGETAEDI--ANLAFIEMDPIVITLSKASGIKHLRFRAQLEVDLAHQAEVEKILPRV 121

Query: 120 LHQDIM-AYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
           +  D++ +Y+R + ++ +T        +  +  R+ +   QG V  ++   F++
Sbjct: 122 V--DVLNSYLRALELEDLTDPMALPKLRAQMLRRINIATGQGRVRDLLIMDFVL 173


>gi|92116938|ref|YP_576667.1| flagellar basal body-associated protein FliL [Nitrobacter
           hamburgensis X14]
 gi|91799832|gb|ABE62207.1| flagellar basal body-associated protein FliL [Nitrobacter
           hamburgensis X14]
          Length = 190

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 59/178 (33%), Gaps = 34/178 (19%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +  D        ++ KL V    V   +G    W                         F
Sbjct: 38  AEGDAPPAPR--SRLKLIVAAVAVLCLVGGAGTWF------------------------F 71

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWL---RLDIALICKDIPDKVFLE 118
           +          +    K      +  ++ N   +P + +   ++ + L  KD P    ++
Sbjct: 72  FFRHHGDESHAEAPPPKPPAFVDVPEMLVNLVGAPGERVQYLKVKVVLEVKDEPQVETIK 131

Query: 119 ----TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
                +      Y+R +    + G+ G    KE++ +RV    S G V++V+F+  +I
Sbjct: 132 PALPRVTDLFQTYMRELRPSDLNGSAGLFRLKEELTKRVNTAISPGHVNAVLFKEVVI 189


>gi|146278779|ref|YP_001168938.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145557020|gb|ABP71633.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 161

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/176 (13%), Positives = 53/176 (30%), Gaps = 21/176 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+            +  + +    V        G+      L L                
Sbjct: 1   MADAAADQVETGKKRSLMPLIGGAVLALALGGVGFYATWSGLILSPTG------------ 48

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL-ICKDIPDKV--F 116
              +   +V  G  + L  +    + PI+ +         LR    L + K     V   
Sbjct: 49  ---HGGPTVEAGP-VPLPDIAFVPVDPIVISLGRDTTLSHLRFTAQLEVAKANAADVALL 104

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +  +   I  Y+R V++ ++         +  +  R++ +  +G V  ++   F++
Sbjct: 105 MPRIIDVINGYLRAVAVSRLENPGALVELRAQMLRRIQMVTGEGRVRDLLVTEFVL 160


>gi|90423019|ref|YP_531389.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisB18]
 gi|90105033|gb|ABD87070.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisB18]
          Length = 159

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 64/176 (36%), Gaps = 32/176 (18%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           +D   +    ++ KLF+    V   + I  G      M F   G +E    + +   F  
Sbjct: 7   EDKDGEAAPKSKRKLFIIVGAVVGVLLIGGG---TWFMFFRGHGAEETHKVEVVKPVF-- 61

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLH-- 121
                                +  +  N    P + ++     +  ++ D+  +E +   
Sbjct: 62  -------------------IDVPEMTINLAGMPGERIQYLRVKVVLEVKDEKAVEQIKPT 102

Query: 122 ----QDIM-AYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
                DI   Y+R +    I+G+ G    KE++  RV L  + G V+ V+F+  +I
Sbjct: 103 MPRVTDIFQTYLRELRSSDISGSAGLFRLKEEMLRRVNLAVAPGVVNVVLFKEVVI 158


>gi|288958673|ref|YP_003449014.1| flagellar basal body-associated protein [Azospirillum sp. B510]
 gi|288910981|dbj|BAI72470.1| flagellar basal body-associated protein [Azospirillum sp. B510]
          Length = 185

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/173 (13%), Positives = 63/173 (36%), Gaps = 7/173 (4%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     +    K  V + V+   + I  G       L      KE+  ++       +  
Sbjct: 12  TEGLPRKKFSGKKLVLFVVLPLVLLIGAGAGVYFSGLLDGLLGKEKPAEEGEQAAAKEGD 71

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPDKVFLE----T 119
             +       +      + L  ++ N ++  K   +L++ I++      D   +E     
Sbjct: 72  HGAEAGKGDAAHAAPIFYDLPDMLVNLNTGNKRPAFLKIKISIQLSKPEDVGAVEHVLPR 131

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
           +  +   Y+R + ++ + G+ G    ++++  R+   +    V  V+F+  ++
Sbjct: 132 IIDNFQVYLRELRLEDLRGSAGMYRLRQELLLRITAAAYPVKVKDVLFKEMLV 184


>gi|302037614|ref|YP_003797936.1| flagellar basal body-associated protein FliL [Candidatus Nitrospira
           defluvii]
 gi|300605678|emb|CBK42011.1| Flagellar basal body-associated protein FliL [Candidatus Nitrospira
           defluvii]
          Length = 178

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 53/179 (29%), Gaps = 10/179 (5%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS               + +   +V   + +  G    +  +   A  ++   +      
Sbjct: 1   MSEAAEEKAPAAPAGIPMKMVIIIVAGVLVLGLGGAFAMFKMMGGASGEKAHGENGGEKQ 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-LDIALICKDIPDKVFLE- 118
                      G         I  L P I N   +P+  +R L + L  +        + 
Sbjct: 61  AAHGEAEDKGGGHGAVADASAIADLDPFIVNLADTPE--IRYLKVTLKVEADNSNTVEQI 118

Query: 119 -----TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
                 +   I+  +  +        QG    +EDI +R+  L  +  V S  F  F+I
Sbjct: 119 KARTPQIRDAILVLLTGLDSATARSPQGKHKLREDITDRINGLLPKKSVKSTYFTEFVI 177


>gi|89069805|ref|ZP_01157140.1| flagellar basal body-associated protein FliL [Oceanicola granulosus
           HTCC2516]
 gi|89044606|gb|EAR50722.1| flagellar basal body-associated protein FliL [Oceanicola granulosus
           HTCC2516]
          Length = 162

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/173 (12%), Positives = 51/173 (29%), Gaps = 22/173 (12%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWL---GGIVMLFLFAGQKEEKYQKFIL 58
           +  D  +   +    KL +   VV    G   G+     G++     A +  E      L
Sbjct: 6   AEPDADAPPKKS---KLPLLVGVVLALAGAGGGFFIVSSGMIGGGARATESAEPAAPEPL 62

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLE 118
                  +  +            +          +  P+     ++A +    P      
Sbjct: 63  APVAFLPLDPIVISLPPRSGGGHLK----FTAQLEVPPE-----ELAQVAAIQP------ 107

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFI 170
            +   +  Y+R V +  +         +  +  R+ +   +G V+ ++   F+
Sbjct: 108 RIVDVLNGYLRAVDLGDLEDPAMLIRLRAQMLHRIGVVAGEGRVNDLLIMEFV 160


>gi|84502562|ref|ZP_01000698.1| hypothetical protein OB2597_21141 [Oceanicola batsensis HTCC2597]
 gi|84389374|gb|EAQ02171.1| hypothetical protein OB2597_21141 [Oceanicola batsensis HTCC2597]
          Length = 166

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 60/169 (35%), Gaps = 20/169 (11%)

Query: 18  LFVTWFVVYTFIG---IFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDT 74
           + +    +   IG      G+   + +         E   +   N+    +  S  + +T
Sbjct: 2   VLIAVVGLVALIGGLVAAMGFDDALALATGGGSDTHEAAPEVTKNDSVAITHSSQKSAET 61

Query: 75  ISLKKLQIFSLQPIITNFDSSPKD------WLRLDIALICKD-IPDKVFLET----LHQD 123
           +      +   + II N  ++         +L+L+ AL+  + +P    +E     +   
Sbjct: 62  VV-----VAPFKEIIVNIHATTATGRQTTRFLKLNAALVYDETLPGAAHVEERMVFVRDA 116

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFV-SSVIFRTFII 171
              Y+R +S + + G+ G    K ++  R +  S       ++    I+
Sbjct: 117 FQDYLRQLSERDVQGSAGITILKAELLRRARSVSDSEAPREILISDLIV 165


>gi|83594173|ref|YP_427925.1| flagellar basal body-associated protein FliL [Rhodospirillum rubrum
           ATCC 11170]
 gi|83577087|gb|ABC23638.1| Flagellar basal body-associated protein FliL [Rhodospirillum rubrum
           ATCC 11170]
          Length = 196

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 54/145 (37%), Gaps = 7/145 (4%)

Query: 34  GWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD 93
           G + G     LF        ++         +      G          + L  ++ + +
Sbjct: 51  GGVAGAYFAGLFDSSTPPTAEEGAAPPAGTPAAGEGEKGAPPVAAGPVFYDLDQVVVDLN 110

Query: 94  SSPK--DWLRLDIALICKDIPDKVFLET----LHQDIMAYIRTVSIKQITGAQGFRYFKE 147
           SS +   +L+L ++L      D   +E     +    +A++R + ++ + G  G    +E
Sbjct: 111 SSGRRRSYLQLRLSLQLASSLDIPRVEEAMPRIMDTFIAFLRELRLEDLQGTAGMYRIQE 170

Query: 148 DIEERV-KLRSQGFVSSVIFRTFII 171
           ++  RV    +   V  V+F+  +I
Sbjct: 171 ELLIRVNAAAAPARVEDVLFKEMLI 195


>gi|197120189|ref|YP_002140616.1| flagellar basal body-associated protein FliL [Geobacter
           bemidjiensis Bem]
 gi|197089549|gb|ACH40820.1| flagellar basal body-associated protein FliL [Geobacter
           bemidjiensis Bem]
          Length = 174

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 31/177 (17%), Positives = 60/177 (33%), Gaps = 10/177 (5%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+           +  KLF+    V   + I     G  + L    G+K  +  K     
Sbjct: 1   MAEQAKAQDAPPKDNKKLFIIIGAVVAVLAIGG---GAALFLGGKKGEKAPEGAKVEAKA 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-----LRLDIALICKDIPDKV 115
                      G+  +     I+ L+P I N     +       +  ++A        + 
Sbjct: 58  EGGGHGAPAKEGEGAAAGA-TIYPLEPFIVNIYDGAELRYLKVKVEFEMANPQVKPELEA 116

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
            +  L   I+  + T ++++I   QG    +E I   V K+     ++ V F  F++
Sbjct: 117 KMAPLRDAILILLTTKTMQEIQDLQGKNQLREQILAAVSKVVPPSKITKVYFTDFVV 173


>gi|110677674|ref|YP_680681.1| flagellar basal body-associated protein FliL [Roseobacter
           denitrificans OCh 114]
 gi|109453790|gb|ABG29995.1| flagellar basal body-associated protein FliL [Roseobacter
           denitrificans OCh 114]
          Length = 163

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/178 (11%), Positives = 47/178 (26%), Gaps = 23/178 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+              KL +    V   IG   G+                     I   
Sbjct: 1   MTDATNEESAEAPKSGKLPLIVGAVLAIIGGGGGFYA--------------ASSGMIFAT 46

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD-----WLRLDIALICKDIPD-K 114
                        +     +    L+P+                 R ++ +  +   D K
Sbjct: 47  ESKKETVEEEKETSNEFSDISFLPLEPMT--ISMPRDSAYKHLRFRGELEVPKEYAEDIK 104

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
                +   +  Y+R + +  I         +  +  R+++ +  G V+ ++   F++
Sbjct: 105 KVTPRIIDVLNGYLRALQVADIEEPASLTRLRSQMLRRIQIVAGPGRVNDLLIMEFVL 162


>gi|163732485|ref|ZP_02139930.1| flagellar basal body-associated protein FliL [Roseobacter litoralis
           Och 149]
 gi|161393845|gb|EDQ18169.1| flagellar basal body-associated protein FliL [Roseobacter litoralis
           Och 149]
          Length = 163

 Score = 49.0 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/176 (11%), Positives = 50/176 (28%), Gaps = 19/176 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+              KL +    V   IG   G+                     I   
Sbjct: 1   MTDATNEESTEPPKSGKLPLIIGAVLALIGGGGGFYA--------------ASSGMIFAT 46

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK---DWLRLDIALICKDIPDKVFL 117
                V       +     +    L+P+  +            R ++ +  +   D   +
Sbjct: 47  ESKEEVVEEEKKSSSEFSDISFLPLEPMTISMPRGSAYKHLRFRGELEVPKEYAEDVKKV 106

Query: 118 ETLHQDIM-AYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
                D++  Y+R + +  I         +  +  R+++ +  G V+ ++   F++
Sbjct: 107 TPRVIDVLNGYLRALQVSDIEEPASLTRLRSQMLRRIQIVAGPGRVNDLLIMEFVL 162


>gi|126730037|ref|ZP_01745849.1| flagellar basal body-associated protein FliL [Sagittula stellata
           E-37]
 gi|126709417|gb|EBA08471.1| flagellar basal body-associated protein FliL [Sagittula stellata
           E-37]
          Length = 173

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/176 (14%), Positives = 57/176 (32%), Gaps = 19/176 (10%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           D   Q  +       +   VV    G   G+    V   L  G  +   +       +  
Sbjct: 7   DEDGQEEKKPSKLPMII-GVVLALAGAGGGFFA--VQSGLLGGGSDAHAEDAAAGADHAE 63

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLETLH-- 121
               V   +T +L K+    +  ++ +         LR   +L       + +   +   
Sbjct: 64  DQEHV---ETPALPKVSFIEVPQVMVSLGPGGHSQHLRFRASL----EVPEQYAADVEVI 116

Query: 122 ----QDIM-AYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
               QD++ +Y+R +  + I         +  +  RV+L   +  +  ++   F++
Sbjct: 117 LPRVQDVLNSYLRALEARDIEAPGALVRLRGQMLRRVRLVAGEDRIRDLLVLEFVL 172


>gi|189426343|ref|YP_001953520.1| flagellar basal body-associated protein FliL [Geobacter lovleyi SZ]
 gi|189422602|gb|ACD97000.1| flagellar basal body-associated protein FliL [Geobacter lovleyi SZ]
          Length = 183

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 27/167 (16%), Positives = 69/167 (41%), Gaps = 8/167 (4%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
           G++ KLF+        + I    +  ++       +  +     +    +  +  +   G
Sbjct: 16  GSKKKLFIIIGAAALVLVIAGVVVFMMMGKGDKKKEGADAQGAPVAEGGHGAAPPAAGGG 75

Query: 73  DTISLKK--LQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKVF--LETLHQDIM 125
              +       +FSL+P I N     +     +++++ ++   +  ++   L  +   I+
Sbjct: 76  HGGAAAPGVSTVFSLEPFIVNIYDGQELRYLKVKVELEMVSAAVKPELEGRLAAIRDAIL 135

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
             + T +++++   QG    +E+I   + K+ +QG VS V F  F++
Sbjct: 136 VVLTTKTLQEVQDVQGKNQLREEILTAISKIVAQGKVSKVYFTDFVV 182


>gi|299131783|ref|ZP_07024978.1| flagellar basal body-associated protein FliL [Afipia sp. 1NLS2]
 gi|298591920|gb|EFI52120.1| flagellar basal body-associated protein FliL [Afipia sp. 1NLS2]
          Length = 166

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 27/171 (15%), Positives = 61/171 (35%), Gaps = 17/171 (9%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           + +        G +    +   VV T      GW   +         KEE      +   
Sbjct: 11  TEEVAAEAAPSGKRKIFMIAGAVVLTLAVSALGWYVFLRGGHDGQHAKEEAKAAPPVFLD 70

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLH 121
             + + ++ +     ++ L++ ++  +              +  L+ K  P    +  L 
Sbjct: 71  VPDVLVNLASNPGERIQYLKVKAVLELK-------------EAPLVEKVKPAMPRVTDLF 117

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           Q    Y+R +    + G+ G    KE++ +RV    +   V++V+F+  +I
Sbjct: 118 Q---TYLRELRANDLNGSIGLFRMKEELTKRVNAAIAPEHVNAVLFKEVVI 165


>gi|126734119|ref|ZP_01749866.1| flagellar basal body-associated protein FliL [Roseobacter sp. CCS2]
 gi|126716985|gb|EBA13849.1| flagellar basal body-associated protein FliL [Roseobacter sp. CCS2]
          Length = 164

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 59/177 (33%), Gaps = 18/177 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D   ++       KL + +  V   +G   G+    V   + +G       +    +
Sbjct: 1   MTADADVAEDAPRKASKLPLVFGFVLAILGAGGGFYA--VQSGVLSGSDSSDAAEKESAS 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKD---IPDKVF 116
              N+   V              ++ P++ +      +D LR    L  +       +  
Sbjct: 59  ETSNTELDVA-----------FVAIDPLVISLPGQGGRDHLRFAAQLEVRPDHAAEVEAI 107

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFIIA 172
              +   +  Y+R + I  +         +  +  R+++ +  G V  ++   F+++
Sbjct: 108 RPRIVDVLNGYLRAIDIASLEDPATLPRLRAQMLRRIQVVTGPGRVDDILIMEFVLS 164


>gi|114797942|ref|YP_758972.1| flagellar basal body-associated protein FliL [Hyphomonas neptunium
           ATCC 15444]
 gi|114738116|gb|ABI76241.1| flagellar basal body-associated protein FliL [Hyphomonas neptunium
           ATCC 15444]
          Length = 171

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/174 (11%), Positives = 57/174 (32%), Gaps = 14/174 (8%)

Query: 4   DDTTSQYIRGNQHKLF--VTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
            DT       +  K    +   ++     +   +     +       +          + 
Sbjct: 5   PDTNESGQTESGKKSGGGIAGLLIVAAASLASSFGLFYFLTPP---AQTPAAACPPAGSE 61

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET-- 119
                 +    D + ++  +I     +IT   +    +L+L+I+++          +   
Sbjct: 62  TAAPAVAPLAQDQVYIEMKEI-----LITIGSAPADRYLKLNISIVTGKDNAAKVKQAEP 116

Query: 120 -LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSS-VIFRTFII 171
            L      Y+R++ +K +     + + +E +  R +L      S+ V+   F++
Sbjct: 117 MLIDAFNNYLRSIELKDLEEPGFYPHLREQLARRSELVVGSAASNGVLITEFLL 170


>gi|260574388|ref|ZP_05842392.1| flagellar basal body-associated protein FliL [Rhodobacter sp. SW2]
 gi|259023284|gb|EEW26576.1| flagellar basal body-associated protein FliL [Rhodobacter sp. SW2]
          Length = 161

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 15/100 (15%), Positives = 42/100 (42%), Gaps = 5/100 (5%)

Query: 77  LKKLQIFSLQPIITNF-DSSPKDWLRLDIAL-ICKDIPDKV--FLETLHQDIMAYIRTVS 132
           L  +    ++P++ +   ++    LR+   L + K    +V   +  +   +  Y+R V 
Sbjct: 61  LPDIAFVPIEPVVISLGAAAQNAHLRMTAQLEVAKPYEAEVVLLMPRVLDVLNGYLRAVE 120

Query: 133 IKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
           + Q+         +  +  R+++ +  G V  ++   F++
Sbjct: 121 VAQLEDPAALVRLRAQMLRRIQIVTGDGRVRDLLITEFVL 160


>gi|83944185|ref|ZP_00956641.1| Flagellar basal body-associated protein FliL [Sulfitobacter sp.
           EE-36]
 gi|83845052|gb|EAP82933.1| Flagellar basal body-associated protein FliL [Sulfitobacter sp.
           EE-36]
          Length = 212

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 22/186 (11%), Positives = 56/186 (30%), Gaps = 30/186 (16%)

Query: 15  QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT--- 71
             K+ +   ++   + +  G+          A   E +Y+    +        +      
Sbjct: 27  SRKMLIAAALMC-VVSLGGGFFLARAAYVKDAEAFEPEYKSEEADQTDTKDDHADTEDHG 85

Query: 72  --------------GDTISLKKLQIFSLQPIITNF------DSSPKDW--LRLDIALICK 109
                          D        +  L  ++TN        +    +  + L +A    
Sbjct: 86  KDDHAKDEGDAEDHADNTKAASTGLIDLGEMLTNIQGFDQNGTPTSAFLKVNLMVAYRPD 145

Query: 110 DIPDKVFLET---LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVI 165
           +  DK+ +E    +      Y+R ++   + G  G  Y K ++ +R +          ++
Sbjct: 146 EDADKLMVERQPFMRDLFNGYLRGLTENDVRGMAGILYIKAELLKRARAAVGSDLPQEIL 205

Query: 166 FRTFII 171
            +  I+
Sbjct: 206 IKDLIV 211


>gi|297569681|ref|YP_003691025.1| flagellar basal body-associated protein FliL [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925596|gb|ADH86406.1| flagellar basal body-associated protein FliL [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 157

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/176 (11%), Positives = 59/176 (33%), Gaps = 32/176 (18%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           + D+      + ++   F+   V    +     +     +         E   +      
Sbjct: 7   APDNEEEVPQKKSKTLFFIIVGVALLLLAGGGFFTYTTFLAPPHDEDAREPLGE------ 60

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALIC---KDIPDKVFL 117
                               +F+L+P + N      K +L++ IAL     + + +    
Sbjct: 61  --------------------MFALEPFVVNLADPTGKRYLKVQIALELESERAVENAKRA 100

Query: 118 E-TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
           E  L   ++  +  +S +++   +G    ++++  R  +  +   V ++ F  F++
Sbjct: 101 EPKLRDTVITMLTALSFEEVMTPEGKIRIRDELLGRFNVVMRPDRVRNIYFTEFVV 156


>gi|168699682|ref|ZP_02731959.1| hypothetical protein GobsU_09174 [Gemmata obscuriglobus UQM 2246]
          Length = 170

 Score = 47.1 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 24/183 (13%), Positives = 64/183 (34%), Gaps = 26/183 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+   T +   +     + +   +V     +  G +  + M  +    K+ + +K     
Sbjct: 1   MATAATEAAPKKKGGKLILIIVCLV----ALGGGAVVPMAMGGVPPFGKKAEGEKDKDKA 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDIPDKVFLET 119
                  S             I     ++ N      + +LRL IA++     +K     
Sbjct: 57  PKKKPAESKTA----------IVPFGDVVVNLVEERQQRYLRLKIAVLVDAEAEKEVTAM 106

Query: 120 LHQD-------IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR----SQGFVSSVIFRT 168
           +          ++ ++   S K ++G+ G +  + ++ ER++          + +V+F  
Sbjct: 107 VTAKKAAVKSALIGHLAGKSTKDVSGSVGVQRMQRELLERIEEVLYPDGSSRIRAVLFEE 166

Query: 169 FII 171
           +++
Sbjct: 167 YVV 169


>gi|255261645|ref|ZP_05340987.1| flagellar basal body-associated protein FliL [Thalassiobium sp.
           R2A62]
 gi|255103980|gb|EET46654.1| flagellar basal body-associated protein FliL [Thalassiobium sp.
           R2A62]
          Length = 168

 Score = 46.7 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 56/173 (32%), Gaps = 20/173 (11%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           D TS+       KL +   +V    G   G+L   V        +++       ++    
Sbjct: 9   DATSESASKKSGKLPMIIGLVLAIAGGVGGFLA--VDNGFILNSEQQVVADGYSSDQART 66

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD-----KVFLET 119
            +  V               L+P++ +     +    L  +   + +PD     +     
Sbjct: 67  VLPEVA-----------FVVLEPLVISLPHPTR-RQHLRFSAQLEVVPDYQAQVEAIKPR 114

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
           +   +  Y+R V +  +         +  +  R+++ +    V  ++   FI+
Sbjct: 115 IVDVLNGYLRAVDVADLEDLSALTRLRAQMLRRIQVVTGPEQVRDLLIMEFIL 167


>gi|237752089|ref|ZP_04582569.1| flagellar basal body-associated protein FliL [Helicobacter
           winghamensis ATCC BAA-430]
 gi|229376656|gb|EEO26747.1| flagellar basal body-associated protein FliL [Helicobacter
           winghamensis ATCC BAA-430]
          Length = 178

 Score = 46.7 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/181 (14%), Positives = 73/181 (40%), Gaps = 14/181 (7%)

Query: 1   MSYDDTTSQYI---RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ ++     +   + N+  LF+   VV   + I   ++   +++F    + E+      
Sbjct: 1   MAEEEKKPSKLEGLKQNKMILFIIIGVVALLLII---FIVVGILIFSGGNESEQAGVAPQ 57

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP------KDWLRLDIALICKDI 111
                 N   + +   ++      ++ L   I N  +S       K  + L++++     
Sbjct: 58  TQQSAANKGSTANPNSSLLSVGP-MYPLDQFIVNLLASGGGKRYLKTSIALELSIPEMQA 116

Query: 112 PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
              +  + L   ++  + + + +++  A+G +  KE++ ER+      G V ++ F  F+
Sbjct: 117 ELDIKRDVLRDTVITILSSKTFEEVQTAKGKQKLKEEMMERINEFLVDGRVVNMFFTEFV 176

Query: 171 I 171
           +
Sbjct: 177 V 177


>gi|115523558|ref|YP_780469.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisA53]
 gi|115517505|gb|ABJ05489.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisA53]
          Length = 164

 Score = 46.3 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 56/179 (31%), Gaps = 38/179 (21%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           +D  +   +G    + +        +     W                          + 
Sbjct: 12  EDGAATAPKGKLKLIIIAGAAAVLLLVGGGVWFV------------------------FF 47

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWL---RLDIALICKDIPDKVFLETL 120
            +    H    + + K     +  +  N    P + +   R+   L  K   D   +E +
Sbjct: 48  RAPAEHHEPVAVVVPKPVFIDVPDMTINLAGQPGERIQYLRVKAVLEVK---DDKMVEQI 104

Query: 121 -------HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
                        Y+R +    I+G+ G    KE++  RV L  + G V++V+F+  +I
Sbjct: 105 KPAMPRVTDTFQTYLRELRSSDISGSAGLFRLKEEMLRRVNLTVAPGQVTTVLFKEIVI 163


>gi|159045803|ref|YP_001534597.1| flagellar basal body-associated protein FliL [Dinoroseobacter
           shibae DFL 12]
 gi|157913563|gb|ABV94996.1| flagellar basal body-associated protein FliL [Dinoroseobacter
           shibae DFL 12]
          Length = 166

 Score = 46.3 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/112 (11%), Positives = 34/112 (30%), Gaps = 5/112 (4%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICK---DIPDKVFLETL 120
                         ++    L P++          +LR    L  +   +         +
Sbjct: 54  ETAETEPEPRDQGPEVAFVPLDPLVVTLGENGRNSYLRFTAELEVESRYETEVAHLRPRV 113

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
              +  Y+R V  + +         +  +  RV++   +G V  ++   F++
Sbjct: 114 LDVLNGYLRAVQAQDLEAPAALARLRSQMLHRVQIVTGEGRVRDLLVTEFVL 165


>gi|307945663|ref|ZP_07660999.1| flagellar basal body-associated protein FliL [Roseibium sp.
           TrichSKD4]
 gi|307771536|gb|EFO30761.1| flagellar basal body-associated protein FliL [Roseibium sp.
           TrichSKD4]
          Length = 169

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/164 (16%), Positives = 51/164 (31%), Gaps = 23/164 (14%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
            +  +      +   +        G    FLF G + E           +     V    
Sbjct: 22  KKKLILFGAIGLVVLLAAG-----GAAYFFLFMGGEPEAPAGEPGQPVPEVQEPVVF--- 73

Query: 74  TISLKKLQIFSLQPIITNFD-SSPKDWLRLDIALICKDIPDKVFLE----TLHQDIMAYI 128
                    + L  +  N        +L++ IAL  KD      +E     +      Y+
Sbjct: 74  ---------YDLPEMTVNLSTDGRTTYLKVRIALEVKDEETVAQIEPFLPRILDAFQIYL 124

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
           R +    + G+ G    KE++  R+ L      V  V+F+  ++
Sbjct: 125 RELRPADLEGSAGLFRLKEELLRRINLSVYPARVDGVLFKEILV 168


>gi|83955114|ref|ZP_00963770.1| Flagellar basal body-associated protein FliL [Sulfitobacter sp.
           NAS-14.1]
 gi|83840443|gb|EAP79616.1| Flagellar basal body-associated protein FliL [Sulfitobacter sp.
           NAS-14.1]
          Length = 212

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/187 (13%), Positives = 57/187 (30%), Gaps = 32/187 (17%)

Query: 15  QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF------------- 61
             K+ +   ++   + +  G+          A   E +Y+    +               
Sbjct: 27  SRKMLIAAALMC-VVSLGGGFFLARAAYVKDAEAFEPEYKSEEADQTDTKDDHADTEDHG 85

Query: 62  -----YDNSVRSVHTGDTISLKKLQIFSLQPIITNF------DSSPKDW--LRLDIALIC 108
                 D      H  DT       +  L  ++TN        +    +  + L +A   
Sbjct: 86  KDDHAKDEGDAEDHADDT-KAASTGLIDLGEMLTNIQGFDQNGTPTSAFLKVNLMVAYRP 144

Query: 109 KDIPDKVFLET---LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSV 164
               DK+ +E    +      Y+R ++   + G  G  Y K ++ +R +          +
Sbjct: 145 DAGADKLMVERQPFMRDLFNGYLRGLTENDVRGMAGILYIKAELLKRARAAVGSDLPQEI 204

Query: 165 IFRTFII 171
           + +  I+
Sbjct: 205 LIKDLIV 211


>gi|117926843|ref|YP_867460.1| flagellar basal body-associated protein FliL [Magnetococcus sp.
           MC-1]
 gi|117610599|gb|ABK46054.1| flagellar basal body-associated protein FliL [Magnetococcus sp.
           MC-1]
          Length = 166

 Score = 45.5 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 70/177 (39%), Gaps = 18/177 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ + T  Q   G    + +   VV   IG+  G+  G ++        EE+ Q      
Sbjct: 1   MAEEGTQEQEGGGGGGLMKIIIPVVALLIGVGGGYFLGDMLASKSV---EEQKQAEPTET 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKVFL 117
                +R++            +F L+  + N +    +      +++ L  +++  +V  
Sbjct: 58  KKPEDIRAMVG---------DVFPLEDFLVNLNEGRGNRYLKATIELELDTEELRPEVER 108

Query: 118 E--TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
               +   I++ + + S K++  ++G    +E+I  R+  +   G V  V F  F+I
Sbjct: 109 RQPQIRDVILSLLGSKSAKELMDSEGKFRLREEILSRINAVLVNGNVKRVYFTAFVI 165


>gi|220903652|ref|YP_002478964.1| flagellar basal body-associated protein FliL [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219867951|gb|ACL48286.1| flagellar basal body-associated protein FliL [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 212

 Score = 45.5 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/199 (10%), Positives = 54/199 (27%), Gaps = 31/199 (15%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVY--TFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +       + ++ K  V    +   T  G   G    + +     G      +    +  
Sbjct: 13  EGQAESPKKKSRLKRIVIILAILLMTLSGAGLGGYWWLYLRTPANGAAASSPEAAGGDRP 72

Query: 62  YDNSVR----------------SVHTGDTISLKKLQ--------IFSLQPIITNFDSSP- 96
            ++                       G  + +++          +  L P+  N      
Sbjct: 73  VESGAPSGAASGGHAAAGLPGGQPAPGTDVRIERQSDLPRSGGMVLPLPPVTVNLADPSG 132

Query: 97  KDWLRLDIALICKDIPDKVFLET---LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV 153
           + +L++ + +                +   I+  +   S   I    G    K ++  R+
Sbjct: 133 RRYLKMGMEVEVNADVSAALQANNARIRDAIIMLLAGKSYADIASPDGKVLLKAEVAARL 192

Query: 154 -KLRSQGFVSSVIFRTFII 171
            ++     V  V F  F++
Sbjct: 193 NQILGAQRVVRVFFTDFVV 211


>gi|42522630|ref|NP_968010.1| flagellar protein FliL [Bdellovibrio bacteriovorus HD100]
 gi|39575162|emb|CAE79003.1| flagellar protein FliL [Bdellovibrio bacteriovorus HD100]
          Length = 168

 Score = 45.5 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/175 (15%), Positives = 56/175 (32%), Gaps = 17/175 (9%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           +   +     N   LF   F V     +  G      M++      E            +
Sbjct: 3   EAQETSAKPKNTAMLFQIIFAVLNLAVMGAG----GYMVYASTMGWESP------KITEE 52

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALI------CKDIPDKVFL 117
           +  R + +    +     ++++     N    PK  +RL+I L        +++ +    
Sbjct: 53  DVDRELASVSDETDLAPLVYTMDKFTVNLGGEPKRTIRLEINLQMLGKEGFEEVMEPENR 112

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
                 I+  +       +   QG  + K+ I   V  +  +G V  V F  F++
Sbjct: 113 AKARDRIVRLLNEKPFSDLDSIQGKLFLKDKIAGEVNGILRRGVVKDVFFSDFVV 167


>gi|261855320|ref|YP_003262603.1| flagellar basal body-associated protein FliL [Halothiobacillus
           neapolitanus c2]
 gi|261835789|gb|ACX95556.1| flagellar basal body-associated protein FliL [Halothiobacillus
           neapolitanus c2]
          Length = 185

 Score = 45.5 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 51/149 (34%), Gaps = 8/149 (5%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           +G    + +   V+   +    G   G ++L      +              ++      
Sbjct: 15  KGGSKLMLILMIVIIVLLLAAVG--VGAMLLLKKPAAESANAAATTEQTTEGHANGDQKA 72

Query: 72  GDTISLKKLQIFSL-QPIITNFDSSPKD-WLRLDIALICKDIPDKVFL----ETLHQDIM 125
           GD+         SL QPI  N         L++++ LI  D   +  +      +  +IM
Sbjct: 73  GDSEKHGAPITVSLGQPITVNLAEPNDAKLLQVELDLITYDPDAEAMVKTNRAEIINNIM 132

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVK 154
             +  V+  ++   QG    ++ ++E V 
Sbjct: 133 LVLSDVNAAKLRTRQGKEDLQKQLKEAVN 161


>gi|144897830|emb|CAM74694.1| flagellar basal body-associated protein FliL [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 182

 Score = 45.5 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 29/181 (16%), Positives = 66/181 (36%), Gaps = 28/181 (15%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGI------FCGWLGGIVMLFLFAGQKEEKYQKFI 57
           +D  S   +    K  +   +    +        F G L G++       +   +  K  
Sbjct: 16  EDLPSSSSKKPPIKKILMIVLPILLLLGAGAGLFFSGVLDGLMGKGDHKAEAPVEAPKGD 75

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS--PKDWLRLDIALICKDIPDK- 114
                  +                 ++L  ++ N  S+   + +L++ +AL  +   D+ 
Sbjct: 76  APKAIGPA---------------HFYNLPEMLVNLQSNGRKQAFLKILVALELESPLDEP 120

Query: 115 ---VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-FVSSVIFRTFI 170
              V L  +      Y+R + ++ + GA G    +E++  RV+   +   V+ V+FR  +
Sbjct: 121 KVQVVLPRIVDSFQVYLRELRVEDLQGAAGMHLLREELLTRVQAAVKPVKVNDVLFREML 180

Query: 171 I 171
           +
Sbjct: 181 V 181


>gi|163794149|ref|ZP_02188122.1| Flagellar basal body-associated protein [alpha proteobacterium
           BAL199]
 gi|159180763|gb|EDP65282.1| Flagellar basal body-associated protein [alpha proteobacterium
           BAL199]
          Length = 175

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/115 (16%), Positives = 47/115 (40%), Gaps = 7/115 (6%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSS--PKDWLRLDIALICKDIPDK----VFL 117
                         ++   F +  +I N +++     +L++ IAL  +   D       L
Sbjct: 60  EEEGHAPAPVAPVQQRAFFFEVPDLIVNLNTNGRKSTFLKIKIALELEGPQDVDRINEVL 119

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-FVSSVIFRTFII 171
             +  +   Y+R + +  + G+ G    +E++  RV + ++   V  V+F+  ++
Sbjct: 120 PRIFDNFQVYLRELRVDDLNGSAGMYRLREELLRRVNIAARPIKVRDVLFKEMLV 174


>gi|253827891|ref|ZP_04870776.1| flagellar basal body-associated protein [Helicobacter canadensis
           MIT 98-5491]
 gi|253511297|gb|EES89956.1| flagellar basal body-associated protein [Helicobacter canadensis
           MIT 98-5491]
          Length = 177

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 30/174 (17%), Positives = 65/174 (37%), Gaps = 7/174 (4%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           D   +  +    K       +   +      +  +V + +F+G  E + Q          
Sbjct: 3   DEEQKESKLASLKQNKMILFIIIGVVALLLIILIVVGILIFSGGDETQSQDANQPTQSSA 62

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSP------KDWLRLDIALICKDIPDKVFLE 118
           S  SV   ++  L    ++ L   I N  S+       K  + L++++          + 
Sbjct: 63  SKSSVANPNSSLLNVGPMYPLDQFIVNLVSTGGGKRYLKTAIALEMSIAEMQPELDTKVN 122

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            L   I+  + + + ++I   +G +  KE+I  R+      G +S+V F  F++
Sbjct: 123 ILRDTIITILASKTFEEIQTTRGKQKLKEEIIARLNEFLVDGRISNVFFTEFVV 176


>gi|85859176|ref|YP_461378.1| flagellar basal body-associated protein [Syntrophus aciditrophicus
           SB]
 gi|85722267|gb|ABC77210.1| flagellar basal body-associated protein [Syntrophus aciditrophicus
           SB]
          Length = 164

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 40/96 (41%), Gaps = 6/96 (6%)

Query: 82  IFSLQPIITNFDSSPKDW-----LRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQI 136
           ++ ++P + N   S  D      ++++++                  I+  + + S K++
Sbjct: 68  LWPMEPFVVNLADSTGDRYLKAVIQIEVSDQENTAALDQLKPKFRDSILDILSSKSYKEL 127

Query: 137 TGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
               G +  +EDI  ++    S+G +  V F  F+I
Sbjct: 128 MEVSGKQRLREDIAFKLNSFLSKGRIMRVYFTEFVI 163


>gi|146341902|ref|YP_001206950.1| flagellar basal body-associated protein FliL [Bradyrhizobium sp.
           ORS278]
 gi|146194708|emb|CAL78733.1| Flagellar basal body-associated protein FliL [Bradyrhizobium sp.
           ORS278]
          Length = 164

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 83  FSLQPIITNFDSSPKDWLR-LDIALICKDIPDKVF------LETLHQDIMAYIRTVSIKQ 135
             +  ++ N   +P D ++ L + ++ +   +K        L  +      Y+R +    
Sbjct: 67  VEVPDLLVNLVGNPGDRVQYLKVKIVLEVKEEKQIEHIKPTLPRVTDIFQTYLRELRPSD 126

Query: 136 ITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           + G+ G    KE++ +RV +  +   V++V+F+  +I
Sbjct: 127 LNGSAGLFRLKEELTKRVNVALAPNQVNAVLFKEIVI 163


>gi|74055040|gb|AAZ95845.1| FliL [Aeromonas hydrophila]
          Length = 171

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 27/181 (14%), Positives = 63/181 (34%), Gaps = 21/181 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D+  +        K  +   V    I +  G    +++        E   +      
Sbjct: 1   MADDNELTLKDPAAGKKKKLIMVVALAVIVLGGGAGAWLMLSGGDKPAAEAAAEGKDAKP 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
             +    S++ G             +P + N     +D  +++ I L+ +   D+   + 
Sbjct: 61  KEEAVQPSLYVGMP-----------RPFVFNVSGGQRDRLVQIKIQLMVRGAADETLAKQ 109

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKED-IEE--RV--KLRSQGFVSSVIFRTFI 170
               +   ++      + +Q+   +G    ++D +EE  RV   L S   +  V+F  F+
Sbjct: 110 NIPLIEGTLLRVFSAATSEQLMTFEGKEKLRKDSLEECRRVLNDLVSSPVIEQVLFTGFV 169

Query: 171 I 171
           +
Sbjct: 170 M 170


>gi|89068712|ref|ZP_01156098.1| flagellar M-ring protein [Oceanicola granulosus HTCC2516]
 gi|89045675|gb|EAR51737.1| flagellar M-ring protein [Oceanicola granulosus HTCC2516]
          Length = 169

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/156 (12%), Positives = 48/156 (30%), Gaps = 13/156 (8%)

Query: 28  FIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQP 87
             G     L  +         +   +     ++    +        T +  +  +  L  
Sbjct: 14  VAGAGLDGLRALASGDAPPADEAADHGAEPADD-GHGTQDGYGGTGTGTGAEQALHHLDE 72

Query: 88  IITNFDSSPKD------WLRLDIALICKDIPDKVFLET-----LHQDIMAYIRTVSIKQI 136
           +I N  S+         +L++++A++                 L      Y+R +S  ++
Sbjct: 73  MIVNVTSASASGRLTTRFLKVNVAIVYDPAAPGADELEARTLFLRDTFQDYLRQLSETEL 132

Query: 137 TGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            G+ G    K ++  R + +        ++    II
Sbjct: 133 EGSLGLHRLKAELLRRARAVVGGDAPQEILVSDLII 168


>gi|148256790|ref|YP_001241375.1| flagellar basal body-associated protein FliL [Bradyrhizobium sp.
           BTAi1]
 gi|146408963|gb|ABQ37469.1| Flagellar basal body-associated protein FliL [Bradyrhizobium sp.
           BTAi1]
          Length = 164

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 83  FSLQPIITNFDSSPKDWLR-LDIALICKDIPDKVF------LETLHQDIMAYIRTVSIKQ 135
             +  ++ N   +P D ++ L + ++ +   +K        L  +      Y+R +    
Sbjct: 67  VEVPDLLVNLVGNPGDRVQYLKVKIVLEVKEEKQVEHIKPTLPRVTDIFQTYLRELRPSD 126

Query: 136 ITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           + G+ G    KE++ +RV +  +   V++V+F+  ++
Sbjct: 127 LNGSAGLFRLKEELTKRVNVALAPNQVNAVLFKEIVV 163


>gi|20807878|ref|NP_623049.1| flagellar basal body-associated protein [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516442|gb|AAM24653.1| Flagellar basal body-associated protein [Thermoanaerobacter
           tengcongensis MB4]
          Length = 135

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 43/108 (39%), Gaps = 6/108 (5%)

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET----LHQDI 124
            H   T  +           ITN       ++++ + L   D      LE     +   I
Sbjct: 28  AHPNKTPEVTYYNYSPGGEFITNL-KGDGKFIKVVVELQVTDPKVLKKLEENTPQIRDAI 86

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDI-EERVKLRSQGFVSSVIFRTFII 171
           +  +R+ + +++ G QG    K DI  E  K+  +G V +V F  FI+
Sbjct: 87  IQILRSKTAQEVEGPQGQEMLKNDIKNEINKIIGEGKVVNVYFNDFIV 134


>gi|329888224|ref|ZP_08266822.1| flagellar fliL protein [Brevundimonas diminuta ATCC 11568]
 gi|328846780|gb|EGF96342.1| flagellar fliL protein [Brevundimonas diminuta ATCC 11568]
          Length = 220

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 55/186 (29%), Gaps = 18/186 (9%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWL-----------GGIVMLFLFAGQKEEK 52
           +D  +   +     LF+        +G                  G         +KE+K
Sbjct: 34  EDGEAAPAKKKIPLLFIIIPAALVVLGGGGATAFLLMKPKSAEAAGDHAAPAKEEKKEKK 93

Query: 53  YQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF--DSSPKDWLRLDIALICKD 110
                     +                +  ++L  +I N         +L+L + L  KD
Sbjct: 94  EGGGHGGGAKEGEAAEGAGKIAAGPDGVTFYTLPDMIVNIQSADGRPTYLKLRLTLEMKD 153

Query: 111 IPDK----VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVI 165
                        +      ++R +  + + G+ G    + +I  RV  + + G V +V+
Sbjct: 154 AAVASHLQAEAPRMQDMFQGFLRELRPEDLAGSAGSYQLRAEILRRVNLIAAPGKVDAVL 213

Query: 166 FRTFII 171
               ++
Sbjct: 214 IEEMLV 219


>gi|83312596|ref|YP_422860.1| flagellar basal body-associated protein [Magnetospirillum
           magneticum AMB-1]
 gi|82947437|dbj|BAE52301.1| Flagellar basal body-associated protein [Magnetospirillum
           magneticum AMB-1]
          Length = 181

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 40/98 (40%), Gaps = 7/98 (7%)

Query: 81  QIFSLQPIITNFDSSP------KDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIK 134
               L  ++ N  ++       K  + L++  +      +  L  +  +   Y+R + ++
Sbjct: 83  SFMDLPEMLVNLQTTGRKQAFLKLRVALELEAVTDQPRVEQMLPRIIDNFQIYLRELRVE 142

Query: 135 QITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
            + GA G    +E++  RV        V+ V+F+  ++
Sbjct: 143 DLQGASGMHLLREELLTRVNAAVKPVKVNDVLFKEMLV 180


>gi|209964206|ref|YP_002297121.1| flagellar basal body-associated protein FliL [Rhodospirillum
           centenum SW]
 gi|209957672|gb|ACI98308.1| flagellar basal body-associated protein FliL [Rhodospirillum
           centenum SW]
          Length = 173

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/178 (11%), Positives = 55/178 (30%), Gaps = 24/178 (13%)

Query: 2   SYDDTTSQYIRGNQHKLFVTW-FVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           +  +   + + G +  LF+    +V         + G +        ++EE +       
Sbjct: 11  TEQELPRKKLSGKKIVLFIVLPILVIGAAAAGVVFSGILHKGDEEHAEEEETHAAPPAEC 70

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP------KDWLRLDIALICKDIPDK 114
               +                      ++ N ++        K  ++L++          
Sbjct: 71  KGPPAF----------------VDFPDVLVNLNTKERRPQFLKLNIKLELCSALDVPAVT 114

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
             L  +      Y+R + +  + G+ G    +E++  RV   +    V  V+ +  ++
Sbjct: 115 AVLPRITDTFQVYLRELRVDDLNGSAGVYRLREELLMRVNTAAYPTRVQDVLIQEILV 172


>gi|259417047|ref|ZP_05740966.1| flagellar basal body-associated protein FliL [Silicibacter sp.
           TrichCH4B]
 gi|259345953|gb|EEW57767.1| flagellar basal body-associated protein FliL [Silicibacter sp.
           TrichCH4B]
          Length = 185

 Score = 44.4 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 19/172 (11%), Positives = 50/172 (29%), Gaps = 10/172 (5%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           D  +           +   V+         +     +L         K    +     + 
Sbjct: 18  DVETDEPAKKSKMPLIIGLVLGIAGAGGGFFAVQSGLLPFG-----NKPAPEVAQVTKEA 72

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL---ICKDIPDKVFLETL 120
                       +  L    ++PI+   + +     LR    L          +  L  +
Sbjct: 73  PEGVDKGESAEEIANLAFIEMEPIVVTLNRASGVQQLRFRAQLEVNQADQAEVETVLPRV 132

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
              + +Y+R + ++ +T        +  +  R+ + + QG V  ++   F++
Sbjct: 133 VDVLNSYLRALELEDLTDPMALPKLRAQMLRRINIVTGQGRVRDLLIMDFVL 184


>gi|83858804|ref|ZP_00952326.1| hypothetical protein OA2633_04856 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853627|gb|EAP91479.1| hypothetical protein OA2633_04856 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 198

 Score = 44.0 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 57/164 (34%), Gaps = 10/164 (6%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           LF+   V+   +    G L  +      A  + E  +     +   +           + 
Sbjct: 33  LFIGLPVILVILAGVAGALFFLGGGDEEAAAEGEHGEAHGEASADGHGDGHGGGDGHEAP 92

Query: 78  KKLQIFSLQ-PIITNFDSSPKDWLRLDI--ALICKDIPDKVFLET------LHQDIMAYI 128
              ++F  + P+I +        + L++  AL   D      L        L  + + + 
Sbjct: 93  HLAELFQFEEPLIVDMSGPDNRSVLLEVRIALAFSDPEVGEMLHREDVQMLLRDEYVEFF 152

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           R + ++ I G+ G    + ++  R  L  +   V  V+  +F++
Sbjct: 153 RALRVEDIDGSTGSHRIRMELIRRTNLVLAPKTVDGVLLPSFVM 196


>gi|34558258|ref|NP_908073.1| flagellar basal body-associated protein FliL [Wolinella
           succinogenes DSM 1740]
 gi|34483977|emb|CAE10973.1| HYPOTHETICAL PROTEIN-Flagellar basal body associated protein
           [Wolinella succinogenes]
          Length = 178

 Score = 44.0 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 25/177 (14%), Positives = 67/177 (37%), Gaps = 6/177 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++  +    G ++KL +        + +  G +    ML      +    Q     +
Sbjct: 1   MADENKETAQAEGKKNKLIIFIIAGVIALLLIIGGVVVYFMLSSNPEPQAASAQASQSTS 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-----KDWLRLDIALICKDIPDKV 115
               +  +  +G    L    +++L   I N  +       K  + ++++          
Sbjct: 61  GGAKAGGASRSGGGNFLSVGPMYALDQFIVNLTTQSGRRYLKTSINVELSQPNLTAELDT 120

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               +   +++ + + SI++I+  +G    KE++ ER+      G + ++ F  F++
Sbjct: 121 KRAVIRDTVISILSSKSIEEISTMKGKEKLKEELIERLNEFLVDGRIVNLFFTDFVV 177


>gi|325917741|ref|ZP_08179928.1| flagellar basal body-associated protein [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325536040|gb|EGD07849.1| flagellar basal body-associated protein [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 206

 Score = 44.0 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 24/167 (14%), Positives = 53/167 (31%), Gaps = 33/167 (19%)

Query: 17  KLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQK-EEKYQKFILNNFYDNSVRSVHTGDTI 75
            L +   VV         W         F G K +EK  K       +    + +     
Sbjct: 58  LLLIAIGVVVLAAAGGGAW--------FFLGHKGDEKGGKHDAPKVAEVPKPAQY----- 104

Query: 76  SLKKLQIFSLQP-IITNFDSSPKD--WLRLDIALICKDIPDKVFLET----LHQDIMAYI 128
                  F + P I+ N         +L++++ L+ +D  +   +      +   ++  +
Sbjct: 105 -------FPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLL 157

Query: 129 RTVSIKQITGAQGFRYF-KEDIEERVKLRSQGF----VSSVIFRTFI 170
                  +    G +   K  + E  K+ +       V  ++F +F+
Sbjct: 158 SQTKAADVADLAGKQKLQKAALTEAQKVMTSETGKKCVEELLFTSFV 204


>gi|27365286|ref|NP_760814.1| flagellar basal body-associated protein FliL [Vibrio vulnificus
           CMCP6]
 gi|37680659|ref|NP_935268.1| flagellar basal body-associated protein FliL [Vibrio vulnificus
           YJ016]
 gi|320155670|ref|YP_004188049.1| flagellar biosynthesis protein FliL [Vibrio vulnificus MO6-24/O]
 gi|27361433|gb|AAO10341.1| Flagellar biosynthesis protein fliL [Vibrio vulnificus CMCP6]
 gi|37199408|dbj|BAC95239.1| flagellar basal body-associated protein FliL [Vibrio vulnificus
           YJ016]
 gi|319930982|gb|ADV85846.1| flagellar biosynthesis protein FliL [Vibrio vulnificus MO6-24/O]
          Length = 165

 Score = 44.0 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 60/181 (33%), Gaps = 27/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +    +     + KL +    V   +    G      ++     ++E   Q      
Sbjct: 1   MAEELQNGEEAPKGKSKLLIIIIAVVVLLAGGGG--AAFFLMGSDPAEEEAAAQVQAQPV 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
               +  ++                QP + N     ++  +++ + L+ +   ++     
Sbjct: 59  EAPIAYVNIA---------------QPFVFNVTGDNRNRMVQIKVQLMVRGTENENLARY 103

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKE---DIEERVKLRSQGF--VSSVIFRTFI 170
               +   +++   + +++Q+    G    ++   D  +    +S G   +  V+F  F+
Sbjct: 104 HSPLIESSLLSTFASATVEQLRSPTGRTELRDKATDDIKAALTKSVGQPVIEKVLFTDFV 163

Query: 171 I 171
           I
Sbjct: 164 I 164


>gi|117620848|ref|YP_855910.1| flagellar basal body-associated protein FliL [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117562255|gb|ABK39203.1| flagellar basal body-associated protein FliL [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 172

 Score = 43.6 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 62/181 (34%), Gaps = 20/181 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D+  +        K  +   +    I +  G  G   ML        E   +     
Sbjct: 1   MADDNELTLKDPAAGKKKKLIMIIALAVIVLGGGGAGAWFMLSGGDKPAAEAAGEGKDAK 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
             + +              L +   +P + N     +D  +++ I L+ +   D+   + 
Sbjct: 61  PKEAA----------PQPSLYVGMPRPFVFNVSGGQRDRLVQIKIQLMVRGTADETLAKQ 110

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKED-IEE--RV--KLRSQGFVSSVIFRTFI 170
               +   ++      + +Q+   +G    ++D +EE  RV   L S   +  V+F  F+
Sbjct: 111 NIPLIEGTLLRVFSAATSEQLMTFEGKEKLRKDSLEECRRVLNDLVSSPVIEQVLFTGFV 170

Query: 171 I 171
           +
Sbjct: 171 M 171


>gi|254485967|ref|ZP_05099172.1| flagellar basal body-associated protein FliL [Roseobacter sp.
           GAI101]
 gi|214042836|gb|EEB83474.1| flagellar basal body-associated protein FliL [Roseobacter sp.
           GAI101]
          Length = 161

 Score = 43.6 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 53/175 (30%), Gaps = 21/175 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +      + K+ +   +V   +G   G+        L  G K E         
Sbjct: 1   MTDTPEDTAEASPKKSKMPLILSLVLALVGGGGGFYLSW--SGLIMGDKPETDVAE---- 54

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD---WLRLDIALICKDIPD-KVF 116
                     T     +       + P++ +     +      R  + +  + + D +  
Sbjct: 55  ----------TDGPAPIGDFVYVPIDPLVISLRQPAQSKHLRFRAQMEVPSRYVADVEKL 104

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
           L  +   +  Y+R V ++ +         +  +  R++ +     V  ++   F+
Sbjct: 105 LPRVTDVLNGYLRAVKVEDLESPAILVRLRSQMLHRIEVVVGPDRVKDLLIMEFV 159


>gi|85715054|ref|ZP_01046039.1| Flagellar basal body-associated protein FliL [Nitrobacter sp.
           Nb-311A]
 gi|85698251|gb|EAQ36123.1| Flagellar basal body-associated protein FliL [Nitrobacter sp.
           Nb-311A]
          Length = 163

 Score = 43.6 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 42/97 (43%), Gaps = 8/97 (8%)

Query: 83  FSLQPIITNFDSSPKDWLR-LDIALICKDIPDKVFLE------TLHQDIMAYIRTVSIKQ 135
             +  ++ N   +P + ++ L + ++ +   +    +       +      Y+R +    
Sbjct: 66  VDIPDMLVNLVGAPGERVQYLKVKVVLEVKEEPQAEKIRPALPRVTDLFQTYMRELRPSD 125

Query: 136 ITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           + G+ G    KE++  RV  + S   +++V+F+  +I
Sbjct: 126 LNGSAGLFRLKEELTRRVNEVISPDHINAVLFKEVVI 162


>gi|163744329|ref|ZP_02151689.1| Flagellar basal body-associated protein [Oceanibulbus indolifex
           HEL-45]
 gi|161381147|gb|EDQ05556.1| Flagellar basal body-associated protein [Oceanibulbus indolifex
           HEL-45]
          Length = 177

 Score = 43.6 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/157 (13%), Positives = 55/157 (35%), Gaps = 16/157 (10%)

Query: 29  IGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPI 88
           + +  G  G + M  L   +  E+  +   N   + +    H     +  K+ +     I
Sbjct: 22  VTLAIGPSGLLKMAGLGGDEAAEETVETADNAHGEEAADDGHGDKPKAEVKMPVMPFPEI 81

Query: 89  ITNF------DSSPKDWLRLDIALICKDI---PDKVFLETL--HQDIMAYIRTVSIKQIT 137
           I N             +L+L++ ++  +     D++    +        ++R + +  + 
Sbjct: 82  IVNVTDTGPQGGQTSRFLKLNMLMVYDETVEGADRLVAREIYLRDSFQDFLRQLHVSDLN 141

Query: 138 GAQGFRYFKEDIEERVKLRSQGFVS---SVIFRTFII 171
           G+ G    K ++  R   R+ G       ++    ++
Sbjct: 142 GSYGLAMLKTELLRRA--RAVGHTDAPHEILIADMVV 176


>gi|118588709|ref|ZP_01546117.1| flagellar basal body-associated protein FliL [Stappia aggregata IAM
           12614]
 gi|118438695|gb|EAV45328.1| flagellar basal body-associated protein FliL [Stappia aggregata IAM
           12614]
          Length = 170

 Score = 43.6 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 28/168 (16%), Positives = 56/168 (33%), Gaps = 29/168 (17%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCG--WLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSV 69
           R  +  LF    +V        G  +L G        G  E   +      FYD      
Sbjct: 23  RKKKLILFGGIGLVVLLAAGGAGYYFLMGSSAPAPVPGDAESPQEVQKPVVFYD------ 76

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKV--FLETLHQDI 124
                          L  +  N  +  +     +R+ + +  + + D++  +L  +    
Sbjct: 77  ---------------LPEMTVNLATEGRTTYLKVRIALEVENRAMIDQIQPYLPRILDAF 121

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
             Y+R +    + G+ G    KE++  R+ L      V  V+F+  ++
Sbjct: 122 QIYLRELRPADLEGSAGLFRLKEELLRRINLSVYPARVEGVLFKEILV 169


>gi|170742327|ref|YP_001770982.1| flagellar basal body-associated protein FliL [Methylobacterium sp.
           4-46]
 gi|168196601|gb|ACA18548.1| flagellar basal body-associated protein FliL [Methylobacterium sp.
           4-46]
          Length = 166

 Score = 43.6 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 28/166 (16%), Positives = 50/166 (30%), Gaps = 28/166 (16%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVH 70
            RG    L     VV    G   G++                             V    
Sbjct: 23  KRGKTLALVAGALVVLLLAGGGYGFV--------------------KYRAGKTEEVAEAK 62

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKV----FLETLHQDIMA 126
              T    +  + +L P   +       +++L +AL   D          +  +      
Sbjct: 63  PAITFLDVRDLVMNLTP---DVGQPNVRFIKLKVALEVHDPKTAAEIQPLMPRIEDAFQV 119

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
           YIR +      G+ G    +E++  RV +      V +V+F+ F+I
Sbjct: 120 YIREMRPADFDGSIGTYRLREELLRRVNVAVYPARVDAVLFKEFVI 165


>gi|317151984|ref|YP_004120032.1| flagellar basal body-associated protein FliL [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316942235|gb|ADU61286.1| flagellar basal body-associated protein FliL [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 165

 Score = 43.6 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 17/177 (9%), Positives = 54/177 (30%), Gaps = 19/177 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D   Q  +      ++   V    +G+   +   + +      Q  E         
Sbjct: 1   MADEDLV-QEGKKGGKLKWIIIAVALIVLGVGGYFGYTMFLAAPDEAQTAESGAGEEGAG 59

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKVFL 117
               S+              ++  L   + N           L +++ +  +     +  
Sbjct: 60  VPTESLEG------------KLVPLPMFLVNLADPLGRRYLKLGMEVEVRDEKAEQALLK 107

Query: 118 --ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
               +   ++    + +   ++  +     K++I +R+ ++  +G +  V     +I
Sbjct: 108 YEAKIKDTLLLLFSSKTYDDLSTMKAKVELKQEIVDRLNQIVGKGAILRVYITEMVI 164


>gi|94264050|ref|ZP_01287850.1| Flagellar basal body-associated protein FliL [delta proteobacterium
           MLMS-1]
 gi|94269367|ref|ZP_01291444.1| Flagellar basal body-associated protein FliL [delta proteobacterium
           MLMS-1]
 gi|93451248|gb|EAT02145.1| Flagellar basal body-associated protein FliL [delta proteobacterium
           MLMS-1]
 gi|93455561|gb|EAT05748.1| Flagellar basal body-associated protein FliL [delta proteobacterium
           MLMS-1]
          Length = 196

 Score = 43.2 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 18/110 (16%), Positives = 48/110 (43%), Gaps = 6/110 (5%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIPDKVFLET----LHQ 122
           +    +    +   + SL+P I N      K +L++ + +  +        E     L  
Sbjct: 86  APVADEDAPEEMGYVLSLEPFIINLADPTGKRYLKIQVEIELESERAWERAERNIPRLRD 145

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
           +++  I ++S +++   +G    +++++ER  +  +   V +V F  F++
Sbjct: 146 NVIMLISSLSFEEVMTPEGKIRIRDELQERFNVVMRPDRVRNVYFSEFVV 195


>gi|145298352|ref|YP_001141193.1| flagellar basal body-associated protein FliL [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142851124|gb|ABO89445.1| Flagellar basal body-associated protein [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 172

 Score = 43.2 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 60/181 (33%), Gaps = 20/181 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D+  +        K  +   +    I +  G  G   ML                  
Sbjct: 1   MADDNELTLKDPAAGKKKKLIMIIALAVIVLAGGGAGAWFML----------SGSDKPAA 50

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
                       DT     L +   +P + N     +D  +++ + L+ +   D+   + 
Sbjct: 51  DAAAEGADAKPKDTAPKPSLYVGMPRPFVFNVSGGQRDRLVKIKVQLMVRGTADENLAKQ 110

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKED-IEE--RV--KLRSQGFVSSVIFRTFI 170
               +   ++      + +Q+   +G    ++D +EE  RV   L S   +  V+F  F+
Sbjct: 111 NIPLIEGTLLRIFSAATSEQLMTFEGKEKLRKDSLEECRRVLGDLVSSPVIEQVLFTGFV 170

Query: 171 I 171
           +
Sbjct: 171 M 171


>gi|682649|gb|AAA62448.1| FliL [Caulobacter crescentus CB15]
          Length = 204

 Score = 43.2 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 51/119 (42%), Gaps = 9/119 (7%)

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
               + R   +GD      +  ++L  I+ N  ++      L + L   ++PD+   + L
Sbjct: 86  AEKGAERRWDSGDQGGPDGVVFYTLPDIVVNMQTADGKSTFLKLKLTF-ELPDEETADEL 144

Query: 121 H------QDIM-AYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
                  QD+   ++R +  + + G+QG    + ++  RV L  +   V++V+    +I
Sbjct: 145 TPNLPRLQDMFQTFLRELRPEDLNGSQGTYQLRVELLRRVNLVAAPAKVNAVLIEEMLI 203


>gi|78047548|ref|YP_363723.1| flagellar basal body-associated protein FliL [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|78035978|emb|CAJ23669.1| flagellar basal body-associated protein FliL [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
          Length = 183

 Score = 43.2 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 53/165 (32%), Gaps = 31/165 (18%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +   VV         W         F G K E           +   +          
Sbjct: 36  LLIAIGVVVLAAAGGGAW--------FFLGHKGE-----------EKGGKHDAPKVAEVP 76

Query: 78  KKLQIFSLQP-IITNFDSSPKD--WLRLDIALICKDIPDKVFLET----LHQDIMAYIRT 130
           K  Q F + P I+ N         +L++++ L+ +D  +   +      +   ++  +  
Sbjct: 77  KPAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQ 136

Query: 131 VSIKQITGAQGFRYF-KEDIEERVKLRSQGF----VSSVIFRTFI 170
           V   ++    G +   K  + E  K+ +       V  ++F +F+
Sbjct: 137 VKAAEVADLAGKQKLQKSALAEAQKVMTSETGKKCVEELLFTSFV 181


>gi|21231368|ref|NP_637285.1| flagellar biosynthesis protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768579|ref|YP_243341.1| flagellar biosynthesis protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188991611|ref|YP_001903621.1| Flagellar fliL protein. [Xanthomonas campestris pv. campestris str.
           B100]
 gi|21113031|gb|AAM41209.1| flagellar biosynthesis protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573911|gb|AAY49321.1| flagellar biosynthesis protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167733371|emb|CAP51572.1| Flagellar fliL protein [Xanthomonas campestris pv. campestris]
          Length = 172

 Score = 42.8 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 52/165 (31%), Gaps = 31/165 (18%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +   VV         W         F G K E           +   +          
Sbjct: 25  LLIAIGVVVLAAAGGGAW--------FFLGHKGE-----------EKDGKHAAPKVAEVP 65

Query: 78  KKLQIFSLQP-IITNFDSSPKD--WLRLDIALICKDIPDKVFLET----LHQDIMAYIRT 130
           K  Q F + P I+ N         +L++++ L+ +D  +   +      +   ++  +  
Sbjct: 66  KPAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQ 125

Query: 131 VSIKQITGAQGFRYF-KEDIEERVKLRSQGF----VSSVIFRTFI 170
           V    +    G +   K  + E  K+ +       V  ++F +F+
Sbjct: 126 VKAADVADLPGKQKLQKSALAEAQKVMTSETGKKCVEELLFTSFV 170


>gi|254470097|ref|ZP_05083501.1| flagellar basal body-associated protein FliL [Pseudovibrio sp.
           JE062]
 gi|211960408|gb|EEA95604.1| flagellar basal body-associated protein FliL [Pseudovibrio sp.
           JE062]
          Length = 165

 Score = 42.8 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 30/177 (16%), Positives = 59/177 (33%), Gaps = 19/177 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  +    G   K  +    +   + +  G  G  VM ++  G             
Sbjct: 1   MADAELQNTEDEGKSGKRKIVIGAIAGVLLLTLGVGGAYVMDWINLGDTATVK------- 53

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD-SSPKDWLRLDIALICKDIPDKVFLE- 118
                 R+  T + I  K +  + L  +  N        +L++ IAL  +       +E 
Sbjct: 54  ------RADGTVEQIETKPVVFYDLPEMTVNLSTQGRTTYLKVRIALEVESDSMVSQVEP 107

Query: 119 ---TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
               +      Y+R +    + G+ G    KE +  R+        V  V+F+  +I
Sbjct: 108 YLPRILDAFQIYLRELRPADLEGSAGLFRLKEQLLRRINSAIYPAKVEGVLFKEILI 164


>gi|166712026|ref|ZP_02243233.1| flagellar protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 174

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 55/179 (30%), Gaps = 32/179 (17%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           DD   +   G +  L V   VV         W         F G K +           +
Sbjct: 14  DDKGEKKNGGKKPILLVAIGVVVLAAAGGGAW--------FFLGHKADDKGDKHAPKVAE 65

Query: 64  NSVRSVHTGDTISLKKLQIFSLQP-IITNFDSSPKD--WLRLDIALICKDIPDKVFLET- 119
               + +            F + P I+ N         +L++++ L+ ++  +   +   
Sbjct: 66  VPKPAQY------------FPMDPAIVVNLADPGDGPHYLQVEVQLVTREPEELKLITEN 113

Query: 120 ---LHQDIMAYIRTVSIKQITGAQGFRYF-KEDIEERVKLRSQGF----VSSVIFRTFI 170
              +   ++  +       +    G +   K  + E  K+ +       V  ++F +F+
Sbjct: 114 APAIRAHLLMLLSQTKATDVADLAGKQKLQKAALAETQKVMTSETGKKCVEELLFTSFV 172


>gi|289666106|ref|ZP_06487687.1| flagellar basal body-associated protein FliL [Xanthomonas
           campestris pv. vasculorum NCPPB702]
          Length = 209

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 24/165 (14%), Positives = 53/165 (32%), Gaps = 31/165 (18%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L V   VV         W       F F  + +EK  K       +    + +       
Sbjct: 62  LLVAIGVVVLAAAGGGAW-------FFFGHKDDEKDGKHAAPKVAEVPKPAQY------- 107

Query: 78  KKLQIFSLQP-IITNFDSSPKD--WLRLDIALICKDIPDKVFLET----LHQDIMAYIRT 130
                F + P I+ N         +L++++ L+ +D  +   +      +   ++  +  
Sbjct: 108 -----FPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQ 162

Query: 131 VSIKQITGAQGFRYF-KEDIEERVKLRSQGF----VSSVIFRTFI 170
                +    G +   K  + E  K+ +       V  ++F +F+
Sbjct: 163 TKATDVADLAGKQKLQKAALAEAQKVMTSETGKKCVEELLFTSFV 207


>gi|21242692|ref|NP_642274.1| flagellar protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|21108165|gb|AAM36810.1| flagellar protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 175

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 52/165 (31%), Gaps = 31/165 (18%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +   VV         W         F G K E           +   +          
Sbjct: 28  LLIAIGVVVLAAAGGGAW--------FFLGHKGE-----------EKGGKHDAPKVAEVP 68

Query: 78  KKLQIFSLQP-IITNFDSSPKD--WLRLDIALICKDIPDKVFLET----LHQDIMAYIRT 130
           K  Q F + P I+ N         +L++++ L+ +D  +   +      +   ++  +  
Sbjct: 69  KPAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQ 128

Query: 131 VSIKQITGAQGFRYF-KEDIEERVKLRSQGF----VSSVIFRTFI 170
           V    +    G +   K  + E  K+ +       V  ++F +F+
Sbjct: 129 VKATDVADLAGKQKLQKSALAEAQKVMTSETGKKCVEELLFTSFV 173


>gi|254500959|ref|ZP_05113110.1| flagellar basal body-associated protein FliL [Labrenzia alexandrii
           DFL-11]
 gi|222437030|gb|EEE43709.1| flagellar basal body-associated protein FliL [Labrenzia alexandrii
           DFL-11]
          Length = 169

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 50/160 (31%), Gaps = 31/160 (19%)

Query: 21  TWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKL 80
              VV   +G            FLF G               +     V           
Sbjct: 31  IGLVVLLAVGGGA-------YYFLFMGDSMPAPAPGEDAPPQEAQRPVVF---------- 73

Query: 81  QIFSLQPIITNFD-SSPKDWLRLDIALICKDIPDKVFLETLH-------QDIMAYIRTVS 132
             + L  +  N        +L++ IAL   ++ ++  ++ +             Y+R + 
Sbjct: 74  --YDLPEMTVNLATEGRTTYLKVRIAL---EVENRAMIDQIQPYLPRILDAFQIYLRELR 128

Query: 133 IKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
              + G+ G    KE++  R+ L      V  V+F+  ++
Sbjct: 129 PADLEGSAGLFRLKEELLRRINLSVYPAKVEGVLFKEILV 168


>gi|154253005|ref|YP_001413829.1| flagellar basal body-associated protein FliL [Parvibaculum
           lavamentivorans DS-1]
 gi|154156955|gb|ABS64172.1| flagellar basal body-associated protein FliL [Parvibaculum
           lavamentivorans DS-1]
          Length = 167

 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 23/106 (21%), Positives = 49/106 (46%), Gaps = 12/106 (11%)

Query: 75  ISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIPDKVFLETLHQD-------IMA 126
           ++      + L   + N    P + +L+L +AL   ++P K  +  L  +          
Sbjct: 64  VAAPAPVFYDLPDFLVNLSGPPPQHYLKLRVAL---EVPSKETVARLEAEMPRVLDGFQT 120

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-FVSSVIFRTFII 171
           ++R +  + + G+QG    KE++  R+ L +Q   V+ V+F+  I+
Sbjct: 121 FLRELRPEDLEGSQGMLNLKEELMRRLALATQEPLVTDVLFKEIIV 166


>gi|294678999|ref|YP_003579614.1| flagellar basal body-associated protein FliL [Rhodobacter
           capsulatus SB 1003]
 gi|294477819|gb|ADE87207.1| flagellar basal body-associated protein FliL-1 [Rhodobacter
           capsulatus SB 1003]
          Length = 164

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 13/93 (13%), Positives = 37/93 (39%), Gaps = 4/93 (4%)

Query: 83  FSLQPIITNFDSSPKDWLRLDIAL---ICKDIPDKVFLETLHQDIMAYIRTVSIKQITGA 139
            +L P++ +        LR    L   + K    ++    +   +  ++R V ++ +   
Sbjct: 71  VALDPMVISLTEGKARHLRFSAQLEVPLLKQKEVELLKPRVMDVLNGFLRAVEVRDLEDP 130

Query: 140 QGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
                 +  +  RV++   +G V+ ++   F++
Sbjct: 131 AALLRLRAQMLRRVQIVVGEGMVNDLLVIEFVM 163


>gi|325928695|ref|ZP_08189867.1| flagellar basal body-associated protein [Xanthomonas perforans
           91-118]
 gi|325540927|gb|EGD12497.1| flagellar basal body-associated protein [Xanthomonas perforans
           91-118]
          Length = 183

 Score = 42.0 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 52/165 (31%), Gaps = 31/165 (18%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +   VV         W         F G K E           +   +          
Sbjct: 36  LLIAIGVVVLAAAGGGAW--------FFLGHKGE-----------EKGGKHDAPKVAEVP 76

Query: 78  KKLQIFSLQP-IITNFDSSPKD--WLRLDIALICKDIPDKVFLET----LHQDIMAYIRT 130
           K  Q F + P I+ N         +L++++ L+ +D  +   +      +   ++  +  
Sbjct: 77  KPAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQ 136

Query: 131 VSIKQITGAQGFRYF-KEDIEERVKLRSQGF----VSSVIFRTFI 170
           V    +    G +   K  + E  K+ +       V  ++F +F+
Sbjct: 137 VKATDVADLAGKQKLQKSALAEAQKVMTSETGKKCVEELLFTSFV 181


>gi|78358625|ref|YP_390074.1| flagellar protein FliL [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78221030|gb|ABB40379.1| flagellar protein FliL [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 158

 Score = 42.0 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 18/171 (10%), Positives = 49/171 (28%), Gaps = 23/171 (13%)

Query: 7   TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSV 66
                +      ++   VV   +     +             + ++  K           
Sbjct: 4   EKTQEKKGGKLKWIIMIVVLLLLAGGGAFAYFTFFAGSSDPAQTDQTTKAEE-------- 55

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDK--VFLETLH 121
                      K +Q+ +L   + N           + LD+ +I   + ++       + 
Sbjct: 56  ---------VPKDVQVVTLPTFLVNLSDPLGRRYLKMTLDVEVINPKVAEELNKSTARVQ 106

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
             ++  + + S   +   +     K +I +R+ ++     V  V F   +I
Sbjct: 107 DAMILLLSSKSYADLAPLENKLLLKNEIVDRLNQILGGSKVRQVYFTEMVI 157


>gi|303246795|ref|ZP_07333072.1| flagellar basal body-associated protein FliL [Desulfovibrio
           fructosovorans JJ]
 gi|302491812|gb|EFL51692.1| flagellar basal body-associated protein FliL [Desulfovibrio
           fructosovorans JJ]
          Length = 190

 Score = 42.0 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 62/189 (32%), Gaps = 18/189 (9%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+      +  + +    +V   V+   +G    +      +       E+  ++     
Sbjct: 1   MADAPEAPEEKKKSGFLKYVILVVLLLLLGGGGFFAYQYFFVAKPPATAEQAKEQAQAEE 60

Query: 61  FYDNSVRSVHT--------------GDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIA 105
                  +                 G         + +L   + N      + +L++ ++
Sbjct: 61  KKAEEQHAPAEEKKAEGGHGEAQKGGHGGKEAPSNLVALPAFVVNLADPNARRYLKIVLS 120

Query: 106 LICKDIPD--KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVS 162
           +     P+  +     +   ++  + T + + ++  +G    +++I +R+ +   Q  V+
Sbjct: 121 VEMTGNPELLEANQAKIRDALLMLLSTKTSQDLSTLEGKILLRKEIVDRLNQAIGQAKVA 180

Query: 163 SVIFRTFII 171
            V F  F+I
Sbjct: 181 RVYFTDFVI 189


>gi|167645398|ref|YP_001683061.1| flagellar basal body-associated protein FliL [Caulobacter sp. K31]
 gi|167347828|gb|ABZ70563.1| flagellar basal body-associated protein FliL [Caulobacter sp. K31]
          Length = 203

 Score = 42.0 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 44/96 (45%), Gaps = 9/96 (9%)

Query: 84  SLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLH------QDIM-AYIRTVSIKQI 136
           +L  I+ N  ++      L + L   ++PD+   E L       QD+   ++R +  + +
Sbjct: 108 TLPDIVVNMQAADGRSTFLKLKLTF-ELPDEETAENLTPNLPRLQDMFQTFLRELRPEDL 166

Query: 137 TGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
            G+QG    + ++  RV L  +   V++V+    +I
Sbjct: 167 NGSQGSYQLRAELLRRVNLVAAPSKVNAVLIEEMLI 202


>gi|220924580|ref|YP_002499882.1| flagellar basal body-associated protein FliL [Methylobacterium
           nodulans ORS 2060]
 gi|219949187|gb|ACL59579.1| flagellar basal body-associated protein FliL [Methylobacterium
           nodulans ORS 2060]
          Length = 221

 Score = 42.0 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 38/89 (42%), Gaps = 5/89 (5%)

Query: 88  IITNFDSSPKDWLRLDIALICKDIPDKV----FLETLHQDIMAYIRTVSIKQITGAQGFR 143
           + ++   S   +++L +AL  +D          +  +      YIR +      G+ G  
Sbjct: 132 LTSDIGQSQTRFIKLKVALEVRDAKVAAEIQPLMPRVEDAFQVYIRELRPTDFEGSMGTY 191

Query: 144 YFKEDIEERVKL-RSQGFVSSVIFRTFII 171
             +E++  RV +      V +V+F+ F+I
Sbjct: 192 RLREELLRRVNVAVYPAKVDAVLFKEFVI 220


>gi|90579933|ref|ZP_01235741.1| flagellar basal body-associated protein [Vibrio angustum S14]
 gi|90438818|gb|EAS64001.1| flagellar basal body-associated protein [Vibrio angustum S14]
          Length = 160

 Score = 41.7 bits (96), Expect = 0.038,   Method: Composition-based stats.
 Identities = 18/169 (10%), Positives = 52/169 (30%), Gaps = 23/169 (13%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
           G +  + ++   V   +    G+                       +     +V+     
Sbjct: 4   GKKKLMLISAVAVIVILAAGIGF-------------WLLNGDDTKESPQVAATVQESTAS 50

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET----LHQDIMAY 127
               +    +   QP   N     +D  +++ + L+ +   ++   +     +   ++  
Sbjct: 51  PAPVMSAYYVVLPQPFTFNVTGDTRDRVVQIKVQLMVRGDKNEALAKQHIPLIESTLLQA 110

Query: 128 IRTVSIKQITGAQGFRYFKEDIEE-----RVKLRSQGFVSSVIFRTFII 171
               +++Q+    G    ++   E      VK+     V  V+F  F++
Sbjct: 111 FGVATVEQLRSPNGRDQLRQQALEAVKATMVKVAGTPAVERVLFTGFVM 159


>gi|328543158|ref|YP_004303267.1| flagellar basal body-associated protein FliL [polymorphum gilvum
           SL003B-26A1]
 gi|326412904|gb|ADZ69967.1| Flagellar basal body-associated protein FliL [Polymorphum gilvum
           SL003B-26A1]
          Length = 167

 Score = 41.3 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 46/126 (36%), Gaps = 13/126 (10%)

Query: 52  KYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALIC 108
              +       D ++R                 L  +  N  +  +     +R+ + +  
Sbjct: 48  SSSEPPPMVGEDGAIREAQKPVVFY-------DLPEMTVNLSTEGRTTYLKVRIALEVQD 100

Query: 109 KDIPDKV--FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVI 165
           K++ +++  FL  +      Y+R +    + G+ G    KE++  R+ L      V  V+
Sbjct: 101 KEMIERIKPFLPRIMDAFQIYLRELRPADLEGSAGLFRLKEELLRRINLSVHPARVDGVL 160

Query: 166 FRTFII 171
           F+  ++
Sbjct: 161 FKEILV 166


>gi|149203112|ref|ZP_01880083.1| possible flagellar synthesis protein [Roseovarius sp. TM1035]
 gi|149143658|gb|EDM31694.1| possible flagellar synthesis protein [Roseovarius sp. TM1035]
          Length = 167

 Score = 41.3 bits (95), Expect = 0.046,   Method: Composition-based stats.
 Identities = 19/181 (10%), Positives = 46/181 (25%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGW---------LGGIVMLFLFAGQKEE 51
           M     T         K  +   +V   +G   G+         LGG             
Sbjct: 1   MPETGDTETAPEAKPSKRPLMIGIVLALLGAAAGFYTMWSGLIPLGGGHGSIAQGPAAGA 60

Query: 52  KYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI 111
                 + +     V  V         +  +     +                       
Sbjct: 61  AASDMPMGDLVFVPVVPVVVSVGQGAARSHLRFAAELEVKAAHKSDV------------- 107

Query: 112 PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFI 170
             +  +  +      Y+R + +  I  AQ     +  +  R+++   +G ++ ++   F+
Sbjct: 108 --ENLMPRIVDVTNTYLRALKLADIEDAQSLIRLRAQLLRRMQVVTGEGRINDLLIMEFV 165

Query: 171 I 171
           +
Sbjct: 166 L 166


>gi|209884528|ref|YP_002288385.1| flagellar basal body-associated protein FliL [Oligotropha
           carboxidovorans OM5]
 gi|209872724|gb|ACI92520.1| flagellar basal body-associated protein FliL [Oligotropha
           carboxidovorans OM5]
          Length = 167

 Score = 41.3 bits (95), Expect = 0.047,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 57/161 (35%), Gaps = 30/161 (18%)

Query: 19  FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLK 78
            +   VV   +    GW   +                      +D +  +      +   
Sbjct: 28  MIAGAVVLALMVGALGWFVFL--------------------RSHDETQHADAAAAKVVPP 67

Query: 79  KLQIFSLQPIITNFDSSPKDWL---RLDIALICKDIP--DKVFLE--TLHQDIMAYIRTV 131
                 +  I+ N  S+P + +   ++   L  K+ P  DKV      +      Y+R +
Sbjct: 68  VF--LDVPDILVNLASNPGERIQYLKVKAVLELKEAPLVDKVKPSMPRVTDLFQTYLREL 125

Query: 132 SIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
               + G+ G    KE++ +RV +  +   V++V+F+  +I
Sbjct: 126 RANDLNGSVGLFRMKEELTKRVNVAIAPERVNAVLFKEVVI 166


>gi|15642126|ref|NP_231758.1| flagellar basal body-associated protein FliL [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|147673204|ref|YP_001217649.1| flagellar basal body-associated protein FliL [Vibrio cholerae O395]
 gi|153803036|ref|ZP_01957622.1| flagellar protein FliL, putative [Vibrio cholerae MZO-3]
 gi|153818970|ref|ZP_01971637.1| flagellar protein FliL, putative [Vibrio cholerae NCTC 8457]
 gi|153822902|ref|ZP_01975569.1| flagellar protein FliL, putative [Vibrio cholerae B33]
 gi|153828598|ref|ZP_01981265.1| putative flagellar protein FliL [Vibrio cholerae 623-39]
 gi|227082252|ref|YP_002810803.1| putative flagellar protein FliL [Vibrio cholerae M66-2]
 gi|229507788|ref|ZP_04397293.1| flagellar biosynthesis protein FliL [Vibrio cholerae BX 330286]
 gi|229511975|ref|ZP_04401454.1| flagellar biosynthesis protein FliL [Vibrio cholerae B33]
 gi|229519111|ref|ZP_04408554.1| flagellar biosynthesis protein FliL [Vibrio cholerae RC9]
 gi|229522080|ref|ZP_04411497.1| flagellar biosynthesis protein FliL [Vibrio cholerae TM 11079-80]
 gi|229524129|ref|ZP_04413534.1| flagellar biosynthesis protein FliL [Vibrio cholerae bv. albensis
           VL426]
 gi|229607333|ref|YP_002877981.1| flagellar basal body-associated protein FliL [Vibrio cholerae
           MJ-1236]
 gi|254849212|ref|ZP_05238562.1| flagellar basal body-associated protein FliL [Vibrio cholerae MO10]
 gi|255745134|ref|ZP_05419083.1| flagellar biosynthesis protein FliL [Vibrio cholera CIRS 101]
 gi|262153476|ref|ZP_06028606.1| flagellar biosynthesis protein FliL [Vibrio cholerae INDRE 91/1]
 gi|262167486|ref|ZP_06035192.1| flagellar biosynthesis protein FliL [Vibrio cholerae RC27]
 gi|297582025|ref|ZP_06943944.1| flagellar basal body-associated protein FliL [Vibrio cholerae
           RC385]
 gi|298497851|ref|ZP_07007658.1| flagellar basal body-associated protein FliL [Vibrio cholerae MAK
           757]
 gi|9656677|gb|AAF95272.1| flagellar protein FliL, putative [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|124121434|gb|EAY40177.1| flagellar protein FliL, putative [Vibrio cholerae MZO-3]
 gi|126510465|gb|EAZ73059.1| flagellar protein FliL, putative [Vibrio cholerae NCTC 8457]
 gi|126519598|gb|EAZ76821.1| flagellar protein FliL, putative [Vibrio cholerae B33]
 gi|146315087|gb|ABQ19626.1| putative flagellar protein FliL [Vibrio cholerae O395]
 gi|148875869|gb|EDL74004.1| putative flagellar protein FliL [Vibrio cholerae 623-39]
 gi|227010140|gb|ACP06352.1| putative flagellar protein FliL [Vibrio cholerae M66-2]
 gi|227014023|gb|ACP10233.1| putative flagellar protein FliL [Vibrio cholerae O395]
 gi|229337710|gb|EEO02727.1| flagellar biosynthesis protein FliL [Vibrio cholerae bv. albensis
           VL426]
 gi|229341005|gb|EEO06010.1| flagellar biosynthesis protein FliL [Vibrio cholerae TM 11079-80]
 gi|229343800|gb|EEO08775.1| flagellar biosynthesis protein FliL [Vibrio cholerae RC9]
 gi|229351940|gb|EEO16881.1| flagellar biosynthesis protein FliL [Vibrio cholerae B33]
 gi|229355293|gb|EEO20214.1| flagellar biosynthesis protein FliL [Vibrio cholerae BX 330286]
 gi|229369988|gb|ACQ60411.1| flagellar biosynthesis protein FliL [Vibrio cholerae MJ-1236]
 gi|254844917|gb|EET23331.1| flagellar basal body-associated protein FliL [Vibrio cholerae MO10]
 gi|255736964|gb|EET92360.1| flagellar biosynthesis protein FliL [Vibrio cholera CIRS 101]
 gi|262024058|gb|EEY42753.1| flagellar biosynthesis protein FliL [Vibrio cholerae RC27]
 gi|262030713|gb|EEY49347.1| flagellar biosynthesis protein FliL [Vibrio cholerae INDRE 91/1]
 gi|297533720|gb|EFH72562.1| flagellar basal body-associated protein FliL [Vibrio cholerae
           RC385]
 gi|297542184|gb|EFH78234.1| flagellar basal body-associated protein FliL [Vibrio cholerae MAK
           757]
          Length = 167

 Score = 41.3 bits (95), Expect = 0.048,   Method: Composition-based stats.
 Identities = 20/172 (11%), Positives = 55/172 (31%), Gaps = 20/172 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D  ++  +G +  L +    V    G        +      A    E+  + +   
Sbjct: 1   MAEEDLGTEAPKGKKKLLIIIIAAVVLLAGGGGAAFFMMGSGGDEAAADAEQKTEQVAAP 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
               S  ++                QP + N     KD  +++ + L+ +   ++     
Sbjct: 61  TDPVSYVNIA---------------QPFVFNVTGDAKDRLVQIKVQLMVRGSENENLARY 105

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFR 167
               +   ++A   + +++Q+    G    ++   + +K      V   +  
Sbjct: 106 HSPLVESSLLATFASATVEQLRTPNGRIELRDKATDDIKAALNQAVGKPVIE 157


>gi|121586822|ref|ZP_01676604.1| flagellar protein FliL, putative [Vibrio cholerae 2740-80]
 gi|121727185|ref|ZP_01680352.1| flagellar protein FliL, putative [Vibrio cholerae V52]
 gi|153213254|ref|ZP_01948666.1| flagellar protein FliL, putative [Vibrio cholerae 1587]
 gi|153825619|ref|ZP_01978286.1| flagellar protein FliL, putative [Vibrio cholerae MZO-2]
 gi|254291363|ref|ZP_04962156.1| flagellar protein FliL, putative [Vibrio cholerae AM-19226]
 gi|262191376|ref|ZP_06049566.1| flagellar biosynthesis protein FliL [Vibrio cholerae CT 5369-93]
 gi|121548989|gb|EAX59028.1| flagellar protein FliL, putative [Vibrio cholerae 2740-80]
 gi|121630430|gb|EAX62823.1| flagellar protein FliL, putative [Vibrio cholerae V52]
 gi|124116054|gb|EAY34874.1| flagellar protein FliL, putative [Vibrio cholerae 1587]
 gi|149740770|gb|EDM54869.1| flagellar protein FliL, putative [Vibrio cholerae MZO-2]
 gi|150422693|gb|EDN14647.1| flagellar protein FliL, putative [Vibrio cholerae AM-19226]
 gi|262032751|gb|EEY51299.1| flagellar biosynthesis protein FliL [Vibrio cholerae CT 5369-93]
          Length = 167

 Score = 41.3 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 20/172 (11%), Positives = 55/172 (31%), Gaps = 20/172 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D  ++  +G +  L +    V    G        +      A    E+  + +   
Sbjct: 1   MAEEDLGTEAPKGKKKLLIIIIAAVVLLAGGGGAAFFMMGSGGEEAAADAEQKTEQVAAP 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
               S  ++                QP + N     KD  +++ + L+ +   ++     
Sbjct: 61  TDPVSYVNIA---------------QPFVFNVTGDAKDRLVQIKVQLMVRGSENENLARY 105

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFR 167
               +   ++A   + +++Q+    G    ++   + +K      V   +  
Sbjct: 106 HSPLVESSLLATFASATVEQLRTPNGRIELRDKATDDIKAALNQAVGKPVIE 157


>gi|261209863|ref|ZP_05924164.1| flagellar biosynthesis protein FliL [Vibrio sp. RC341]
 gi|260841049|gb|EEX67574.1| flagellar biosynthesis protein FliL [Vibrio sp. RC341]
          Length = 167

 Score = 41.3 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 21/172 (12%), Positives = 54/172 (31%), Gaps = 20/172 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++  +   +G +  L +    V    G        +      A  + E+  +     
Sbjct: 1   MAEEEQVADAPKGKKKLLIIIIAAVVLLAGGGGAAFFMMGSGGEEAAAQAEQKTEQAA-- 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
                        T +     +   QP + N     KD  +++ + L+ +   ++     
Sbjct: 59  -------------TPADPVSYVNIAQPFVFNVTGDAKDRMVQIKVQLMVRGSENENLARY 105

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFR 167
               +   ++A   + +++Q+    G    ++   E +K      V   I  
Sbjct: 106 HSPLVESTLLATFASATVEQLRTPNGRIELRDKATEDIKAALNQAVGKPIIE 157


>gi|148266213|ref|YP_001232919.1| flagellar basal body-associated protein FliL [Geobacter
           uraniireducens Rf4]
 gi|146399713|gb|ABQ28346.1| flagellar basal body-associated protein FliL [Geobacter
           uraniireducens Rf4]
          Length = 166

 Score = 41.3 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 46/127 (36%), Gaps = 6/127 (4%)

Query: 51  EKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALI 107
            K  K         +                ++ L P I N     +     ++++  + 
Sbjct: 39  SKDGKAEKVAKAPEAKSEKKGEGGEKGTSSTVYPLDPFIVNIYDGQEIRYLKIKVEFEMA 98

Query: 108 CKDIPDKVFLET--LHQDIMAYIRTVSIKQITGAQGFRYFKED-IEERVKLRSQGFVSSV 164
             ++  ++      L   I+  + T +++++   QG    +++ +    K+ S G V+ V
Sbjct: 99  GPEVKPEIDARQSALRDAILVLLTTKTMREVQDLQGKNQLRDEILATTGKILSVGRVTKV 158

Query: 165 IFRTFII 171
            F  F++
Sbjct: 159 YFTDFVV 165


>gi|58582230|ref|YP_201246.1| flagellar protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84624123|ref|YP_451495.1| flagellar protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188576790|ref|YP_001913719.1| flagellar basal body-associated protein FliL [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188576982|ref|YP_001913911.1| flagellar basal body-associated protein FliL [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|58426824|gb|AAW75861.1| flagellar protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368063|dbj|BAE69221.1| flagellar protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188521242|gb|ACD59187.1| flagellar basal body-associated protein FliL [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188521434|gb|ACD59379.1| flagellar basal body-associated protein FliL [Xanthomonas oryzae
           pv. oryzae PXO99A]
          Length = 174

 Score = 41.3 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 22/165 (13%), Positives = 50/165 (30%), Gaps = 32/165 (19%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L V   VV         W         F G K +           +    + +       
Sbjct: 28  LLVAIGVVVLAAAGGGAW--------FFLGHKADDKGDKHAPKVAEVPKPAQY------- 72

Query: 78  KKLQIFSLQP-IITNFDSSPKD--WLRLDIALICKDIPDKVFLET----LHQDIMAYIRT 130
                F + P I+ N         +L++++ L+ +D  +   +      +   ++  +  
Sbjct: 73  -----FPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQ 127

Query: 131 VSIKQITGAQGFRYF-KEDIEERVKLRSQGF----VSSVIFRTFI 170
                +    G +   K  + E  K+ +       V  ++F +F+
Sbjct: 128 TKATDVADLAGKQKLQKAALAETQKVMTSETGKKCVEELLFTSFV 172


>gi|124516302|gb|EAY57810.1| putative flagellar basal body-associated protein FliL
           [Leptospirillum rubarum]
 gi|206603145|gb|EDZ39625.1| Putative flagellar basal body-associated protein FliL
           [Leptospirillum sp. Group II '5-way CG']
          Length = 168

 Score = 41.3 bits (95), Expect = 0.055,   Method: Composition-based stats.
 Identities = 30/166 (18%), Positives = 54/166 (32%), Gaps = 27/166 (16%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
           N  KL +    V   +G    +                        +  D+ V       
Sbjct: 21  NIKKLVLAGVAVLALLGGGAFFF-------------------LKHGHKNDSQVAMTPKEM 61

Query: 74  TISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKVFLE------TLHQDIMA 126
              +K   I  L+P + N   +S ++   L + +  K    +V  E       +   I+ 
Sbjct: 62  EKMIKAHPIIDLKPFVVNLNTASAENSRYLKVRIAFKLDNPQVAKEVDYRMPEIQNIILI 121

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
            + + +   +    G    +  I  RV  + + G VSSV F  F+I
Sbjct: 122 LLGSETADDLGTTGGKLALRNQIRHRVNSILTLGRVSSVYFTEFVI 167


>gi|114765264|ref|ZP_01444396.1| flagellar motor switch protein M [Pelagibaca bermudensis HTCC2601]
 gi|114542399|gb|EAU45427.1| flagellar motor switch protein M [Roseovarius sp. HTCC2601]
          Length = 196

 Score = 40.9 bits (94), Expect = 0.060,   Method: Composition-based stats.
 Identities = 20/138 (14%), Positives = 44/138 (31%), Gaps = 14/138 (10%)

Query: 46  AGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD------W 99
           A    E   +         +  +   G  +  + + +   Q II N  ++         +
Sbjct: 60  AAASGEDAVEDHAAGDGHGAAPATPAG--LPGEHIVVTPFQEIIVNITATTATGRQTTRF 117

Query: 100 LRLDIALICKDIPDKVFLET-----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK 154
           L+L++AL   +              L      Y+R ++   + G+ G    K ++  R +
Sbjct: 118 LKLNLALAYDNRVSGAENIESRKLFLRDSFQEYLRQLNENDLQGSIGLVRLKSELLRRAR 177

Query: 155 LRSQ-GFVSSVIFRTFII 171
             S        +    I+
Sbjct: 178 AISDSDAPQEFLIADLIV 195


>gi|88858102|ref|ZP_01132744.1| flagellar basal body-associated protein [Pseudoalteromonas tunicata
           D2]
 gi|88819719|gb|EAR29532.1| flagellar basal body-associated protein [Pseudoalteromonas tunicata
           D2]
          Length = 179

 Score = 40.9 bits (94), Expect = 0.065,   Method: Composition-based stats.
 Identities = 19/183 (10%), Positives = 59/183 (32%), Gaps = 17/183 (9%)

Query: 1   MSYD-DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ + D   +   G   K+      V   I    G         +       + +    N
Sbjct: 1   MADEKDLQIEEGGGKSKKMLFIIIAVVVLIAGGGG-----AFFMMSGDDTPAQEETLAEN 55

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQ-PIITNFDSSPKDW-LRLDIALICKDIPDKVFL 117
              D +        +  +       +  P + N   + +D  +++ + L+ +   ++   
Sbjct: 56  ASADGAKSEAADKSSAEMGSALYVGMPRPFVFNVPGASRDRLVQIKVQLLVRGDVNEEAA 115

Query: 118 ET----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRT 168
           +     +   +++   T +  +++ + G    +    + V+     +     V  ++F  
Sbjct: 116 KKHIPLIEGTLLSVFSTSNADELSTSAGKETLRTKALKNVQDTLTEIEGNKVVERILFTG 175

Query: 169 FII 171
           F++
Sbjct: 176 FVM 178


>gi|296135697|ref|YP_003642939.1| flagellar basal body-associated protein FliL [Thiomonas intermedia
           K12]
 gi|295795819|gb|ADG30609.1| flagellar basal body-associated protein FliL [Thiomonas intermedia
           K12]
          Length = 189

 Score = 40.9 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 50/155 (32%), Gaps = 22/155 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  ++   G + KL +   VV   +    G     +M                   
Sbjct: 1   MAEQEAKAKEKGGGKTKLIIIILVVVIVLMAGGGAAAFFLMKP----------------K 44

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKV----- 115
               +            K ++  S++P +TN  S+      L + +  K     V     
Sbjct: 45  AAPTAAELAAEAAAEKAKNMRFISMEPFVTNLQSTDGTVHYLQVKIDLKTYDPSVEGKVK 104

Query: 116 -FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDI 149
                L  +I+  +   SI ++   +G  + +EDI
Sbjct: 105 LMTPELRNNILRILAAQSIDKVDSVEGRDHLREDI 139


>gi|260429247|ref|ZP_05783224.1| flagellar basal body-associated protein FliL [Citreicella sp. SE45]
 gi|260419870|gb|EEX13123.1| flagellar basal body-associated protein FliL [Citreicella sp. SE45]
          Length = 185

 Score = 40.5 bits (93), Expect = 0.075,   Method: Composition-based stats.
 Identities = 26/177 (14%), Positives = 53/177 (29%), Gaps = 15/177 (8%)

Query: 7   TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSV 66
             +  +    KL +   VV   +G   G+      L  F G  +         +      
Sbjct: 11  EDEEPKKKSSKLPLIIGVVLALVGGGGGFYAAFSGLLPFGGGGDHTAPADGHGDTAAAGA 70

Query: 67  RSVHT----GDTISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICKDIPDKVFLE--- 118
              H     G  +    +    +  +I +   S     LR   +L   ++P     E   
Sbjct: 71  HDPHAADDHGAPLPDANVAFIEMPQLIISMGPSSDMHHLRFLASL---EVPPSHMAEVES 127

Query: 119 ---TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
               +   +  Y+R +    I         +  +  RV+L   +  V  ++   F++
Sbjct: 128 LKPRVVDVLNNYLRALHPSDIEAPGALIRIRSQMLRRVQLVAGEDRVRDLLIMEFVL 184


>gi|254418238|ref|ZP_05031962.1| flagellar basal body-associated protein FliL [Brevundimonas sp.
           BAL3]
 gi|196184415|gb|EDX79391.1| flagellar basal body-associated protein FliL [Brevundimonas sp.
           BAL3]
          Length = 225

 Score = 40.5 bits (93), Expect = 0.080,   Method: Composition-based stats.
 Identities = 28/201 (13%), Positives = 63/201 (31%), Gaps = 32/201 (15%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLF---------------- 45
           + +       +     LF+   V    +G   G     +M                    
Sbjct: 25  AAEGEEGAPKKKKLPMLFIIAPVALLVLG-GGGAAAFFLMKPKPAEAHGEEAAAAGHGEE 83

Query: 46  -AGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQ-------IFSLQPIITNF--DSS 95
            A +K    ++        +   +       +L K+         ++L  ++ N      
Sbjct: 84  KAEEKGGHGKEEKKAEGGGHGAPAEGGEADPALGKISEGPDGVTFYTLPDMVMNIQSADG 143

Query: 96  PKDWLRLDIALICKDIPDKVFLE----TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEE 151
              +L+L + L   D      L+     L      ++R +  + ++G+ G    + +I  
Sbjct: 144 RPTFLKLKLTLEMHDAEVATHLQSEMPRLQDMFTGFVRELRPEDLSGSAGTYQLRAEILR 203

Query: 152 RVKLR-SQGFVSSVIFRTFII 171
           RV L  + G V +V+    ++
Sbjct: 204 RVNLVAAPGKVDAVLIEEMLV 224


>gi|229528861|ref|ZP_04418251.1| flagellar biosynthesis protein FliL [Vibrio cholerae 12129(1)]
 gi|229332635|gb|EEN98121.1| flagellar biosynthesis protein FliL [Vibrio cholerae 12129(1)]
 gi|327484655|gb|AEA79062.1| Flagellar biosynthesis protein FliL [Vibrio cholerae LMA3894-4]
          Length = 167

 Score = 40.5 bits (93), Expect = 0.082,   Method: Composition-based stats.
 Identities = 20/172 (11%), Positives = 55/172 (31%), Gaps = 20/172 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D  ++  +G +  L +    V    G        +      A    E+  + +   
Sbjct: 1   MAEEDLGTEAPKGKKKLLIIIIAAVVLLAGGGGAAFFMMGSGDDEAAADAEQKTEQVAAP 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
               S  ++                QP + N     KD  +++ + L+ +   ++     
Sbjct: 61  TDPVSYVNIA---------------QPFVFNVTGDAKDRLVQIKVQLMVRGSENENLARY 105

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFR 167
               +   ++A   + +++Q+    G    ++   + +K      V   +  
Sbjct: 106 HSPLVESSLLATFASATVEQLRTPNGRIELRDKATDDIKAALNQAVGKPVIE 157


>gi|262404473|ref|ZP_06081028.1| flagellar biosynthesis protein FliL [Vibrio sp. RC586]
 gi|262349505|gb|EEY98643.1| flagellar biosynthesis protein FliL [Vibrio sp. RC586]
          Length = 167

 Score = 40.5 bits (93), Expect = 0.084,   Method: Composition-based stats.
 Identities = 20/172 (11%), Positives = 54/172 (31%), Gaps = 20/172 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++  +   +G +  L +    V    G        +      A  + E+  +     
Sbjct: 1   MAEEEQAADAPKGKKKLLIIIIAAVVLLAGGGGAAFFMMGSGDGEAAAQAEQKTEQAA-- 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
                        T +     +   QP + N     KD  +++ + L+ +   ++     
Sbjct: 59  -------------TPADPVSYVNIAQPFVFNVTGDEKDRLVQIKVQLMVRGSENENLARY 105

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFR 167
               +   ++A   + +++Q+    G    ++   + +K      V   I  
Sbjct: 106 HSPLVESTLLATFASATVEQLRTPNGRIELRDKATDDIKAALNQAVGKPIIE 157


>gi|23009501|ref|ZP_00050525.1| COG1580: Flagellar basal body-associated protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 171

 Score = 40.1 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 48/123 (39%), Gaps = 10/123 (8%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIF-SLQPIITNFD----SSPKDWLRLDIALICKDIPD 113
            N   ++    H  +    K   +F  ++ ++ N      +   + L+L ++L  KD   
Sbjct: 48  KNKAAHADAGEHGAEKAEPKAQAVFLDMRDMLVNLSPDPGTPKANILKLRVSLELKDAKA 107

Query: 114 KV----FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRT 168
           +      +  +      Y+R +    + G+ G    +E++  RV +        +V+F+ 
Sbjct: 108 EAAVKPLMPRVEDTFQTYLRELRASDLAGSAGMYRLREELLRRVNIAIHPAKAEAVLFKD 167

Query: 169 FII 171
            I+
Sbjct: 168 VIV 170


>gi|332994115|gb|AEF04170.1| flagellar basal body-associated protein FliL [Alteromonas sp. SN2]
          Length = 178

 Score = 40.1 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 22/182 (12%), Positives = 62/182 (34%), Gaps = 16/182 (8%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   +     + K+ +   +    +G             LFAG +E    + +   
Sbjct: 1   MAEEELQIEEGGKKKGKMMLIIIIAVVLVGGGA-----AAYFLLFAGGEEPVAAEQLAET 55

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQ-PIITNFDSSPKDW-LRLDIALICKDIPDKVFLE 118
               +  +   G +  +      ++  P + N   + +D  +++ + L+ +   ++   +
Sbjct: 56  DEQAATEAAAPGGSAEVGTALYVAMPRPFVFNVPGTGRDRLVQIKVQLLVRGSDNEELAK 115

Query: 119 T----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTF 169
           T    +   ++    T +   +    G    +E     V      +     V  V+F  F
Sbjct: 116 THIPLIEGTLLQVFSTSNADDLVTEAGKIELREQAVTEVQKVLKDIAGSDVVERVLFTGF 175

Query: 170 II 171
           ++
Sbjct: 176 VM 177


>gi|229513778|ref|ZP_04403240.1| flagellar biosynthesis protein FliL [Vibrio cholerae TMA 21]
 gi|229348959|gb|EEO13916.1| flagellar biosynthesis protein FliL [Vibrio cholerae TMA 21]
          Length = 167

 Score = 40.1 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 20/172 (11%), Positives = 55/172 (31%), Gaps = 20/172 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D  ++  +G +  L +    V    G        +      A    E+  + +   
Sbjct: 1   MAEEDLGTEAPKGKKKLLIIIIAAVVLLAGGGGAAFFMMGSGDDEAVADAEQKTEQVAAP 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
               S  ++                QP + N     KD  +++ + L+ +   ++     
Sbjct: 61  TDPVSYVNIA---------------QPFVFNVTGDAKDRLVQIKVQLMVRGSENENLARY 105

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFR 167
               +   ++A   + +++Q+    G    ++   + +K      V   +  
Sbjct: 106 HSPLVESSLLATFASATVEQLRTPNGRIELRDKATDDIKAALNQAVGKPVIE 157


>gi|221235078|ref|YP_002517514.1| flagellar fliL protein [Caulobacter crescentus NA1000]
 gi|300680947|sp|B8GXB6|FLIL_CAUCN RecName: Full=Flagellar FliL protein
 gi|300680948|sp|P0CG27|FLIL_CAUCR RecName: Full=Flagellar FliL protein
 gi|220964250|gb|ACL95606.1| flagellar fliL protein [Caulobacter crescentus NA1000]
          Length = 205

 Score = 40.1 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 25/145 (17%), Positives = 55/145 (37%), Gaps = 11/145 (7%)

Query: 37  GGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIF--SLQPIITNFDS 94
            G         +KE+K ++       +           I      +   +L  I+ N  +
Sbjct: 61  AGEHGEKKEEKKKEKKKEEKGDKKDAEKGAEGAAGTPVIKEGPDGVVFYTLPDIVVNMQT 120

Query: 95  SPKDWLRLDIALICKDIPDKVFLETLH------QDIM-AYIRTVSIKQITGAQGFRYFKE 147
           +      L + L   ++PD+   + L       QD+   ++R +  + + G+QG    + 
Sbjct: 121 ADGKSTFLKLKLTF-ELPDEETADELTPNLPRLQDMFQTFLRELRPEDLNGSQGTYQLRV 179

Query: 148 DIEERVKLR-SQGFVSSVIFRTFII 171
           ++  RV L  +   V++V+    +I
Sbjct: 180 ELLRRVNLVAAPAKVNAVLIEEMLI 204


>gi|294339868|emb|CAZ88231.1| putative Flagellar basal body-associated protein FliL [Thiomonas
           sp. 3As]
          Length = 189

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 49/155 (31%), Gaps = 22/155 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  ++   G + KL +   V    +    G     +M                   
Sbjct: 1   MAEQEAKAKEKGGGKTKLIIIILVAVIVLMAGGGAAAFFLMKP----------------K 44

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKV----- 115
               +            K ++  S++P +TN  S+      L + +  K     V     
Sbjct: 45  AAPTAAELAAEAAAEKAKNMRFISMEPFVTNLQSTDGTVHYLQVKIDLKTYDPLVEGKVK 104

Query: 116 -FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDI 149
                L  +I+  +   SI ++   +G  + +EDI
Sbjct: 105 LMTPELRNNILRILAAQSIDKVDSVEGRDHLREDI 139


>gi|304321128|ref|YP_003854771.1| flagellar motor protein [Parvularcula bermudensis HTCC2503]
 gi|303300030|gb|ADM09629.1| flagellar motor protein [Parvularcula bermudensis HTCC2503]
          Length = 165

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 27/177 (15%), Positives = 54/177 (30%), Gaps = 19/177 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +    +  +     LF     V      F         +  FA              
Sbjct: 1   MAAETEEVEPKKEGGGFLFTGVLSVVAAASTFG--------MVWFAAAPPPPVDAAACAG 52

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET- 119
           F    +    T + I  +  +  +L+P   +          L +++      D V L   
Sbjct: 53  FTAEPL----TPEEIEARTAKYVALEPFTVSLG-PDAGAKHLRMSVALGRPADAVELSES 107

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               L   ++  +R V +  IT   G    KE + ++ +       V +V+   F++
Sbjct: 108 EHLRLRDKLLERLRKVELTTITDPDGMPALKESLLDQAQATLGPDTVYNVLVTEFVM 164


>gi|89075519|ref|ZP_01161930.1| flagellar basal body-associated protein [Photobacterium sp. SKA34]
 gi|89048791|gb|EAR54362.1| flagellar basal body-associated protein [Photobacterium sp. SKA34]
          Length = 160

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/169 (11%), Positives = 53/169 (31%), Gaps = 23/169 (13%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
           G +  + ++   V   +    G+              + K    +     +N        
Sbjct: 4   GKKKLMLISAVAVIVILAAGIGF--------WLLNGDDAKESPQVAATVQEN-----TAS 50

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLE----TLHQDIMAY 127
               +    +   QP   N     +D  +++ + L+ +   ++   +     +   ++  
Sbjct: 51  PAPVMSAYYVVLPQPFTFNVTGDTRDRVVQIKVQLMVRGDKNEALAKLHIPLIESTLLQA 110

Query: 128 IRTVSIKQITGAQGFRYFKEDIEE-----RVKLRSQGFVSSVIFRTFII 171
               +++Q+    G    ++   E      VK+     V  V+F  F++
Sbjct: 111 FGVATVEQLRSPNGRDQLRQQALEAVKATMVKVAGTPAVERVLFTGFVM 159


>gi|295688786|ref|YP_003592479.1| flagellar basal body-associated protein FliL [Caulobacter segnis
           ATCC 21756]
 gi|295430689|gb|ADG09861.1| flagellar basal body-associated protein FliL [Caulobacter segnis
           ATCC 21756]
          Length = 202

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 44/96 (45%), Gaps = 9/96 (9%)

Query: 84  SLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLH------QDIM-AYIRTVSIKQI 136
           +L  I+ N  ++      L + L   ++PD+   E L       QD+   ++R +  + +
Sbjct: 107 TLPDIVVNMQTADGKSTFLKLKLTF-ELPDEETAEALTPNLPRLQDMFQTFLRELRPEDL 165

Query: 137 TGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
            G+QG    + ++  RV L  +   V++V+    +I
Sbjct: 166 NGSQGTYQLRVELLRRVNLVAAPAKVNAVLIEEMLI 201


>gi|27380937|ref|NP_772466.1| flagellar basal body-associated protein FliL [Bradyrhizobium
           japonicum USDA 110]
 gi|27354103|dbj|BAC51091.1| flagellar synthesis protein [Bradyrhizobium japonicum USDA 110]
          Length = 166

 Score = 39.4 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 42/97 (43%), Gaps = 8/97 (8%)

Query: 83  FSLQPIITNFDSSPKDWLR-LDIALICKDIPDKVFLE------TLHQDIMAYIRTVSIKQ 135
             +  ++ N   +P + ++ L + ++ +   +K           +      Y+R +    
Sbjct: 69  VEVPDMMVNLAGAPGERVQYLKLKIVLELKEEKQIEAIKPAMPRVTDIFQTYVRELRSSD 128

Query: 136 ITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
           + G+ G    KE++ +RV    +   VS+V+F+  +I
Sbjct: 129 LNGSAGIFRLKEELTKRVNAAVAPVQVSAVLFKEVVI 165


>gi|283850188|ref|ZP_06367477.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           FW1012B]
 gi|283574214|gb|EFC22185.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           FW1012B]
          Length = 149

 Score = 39.4 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 40/94 (42%), Gaps = 4/94 (4%)

Query: 81  QIFSLQPIITN-FDSSPKDWLRLDIALICKDIPDK--VFLETLHQDIMAYIRTVSIKQIT 137
            +  L P+  N   +    +LRL + + C+   +   + L    +D++ ++ +   + + 
Sbjct: 54  GVIDLGPVTVNVLSNRGFRFLRLSMQVQCETNEEAERLTLPDAKEDLVFFLSSKMAEDLL 113

Query: 138 GAQGFRYFKEDIEER-VKLRSQGFVSSVIFRTFI 170
           G  G    + D+ E   K    G V ++ F  F+
Sbjct: 114 GNPGKMILRRDLTELFSKYAGAGKVKNIFFTEFV 147


>gi|302343738|ref|YP_003808267.1| flagellar basal body-associated protein FliL [Desulfarculus baarsii
           DSM 2075]
 gi|301640351|gb|ADK85673.1| flagellar basal body-associated protein FliL [Desulfarculus baarsii
           DSM 2075]
          Length = 189

 Score = 39.4 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 27/165 (16%), Positives = 52/165 (31%), Gaps = 16/165 (9%)

Query: 19  FVTWFVVYTFIGIFCGWLGGI-VMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
            +    V   +    G+     ++    A   E            + +  +         
Sbjct: 28  LIIIVAVGLIVLFGAGFGAWWFLLAGDDAPPPEAAPAAQQGQAPAEGAAPAQGQEGAAQE 87

Query: 78  KKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDIPDKVFLET-------LHQDIMAYIR 129
           K   I  L+P + N      K +L+L +A+   D  D+            +   I+  + 
Sbjct: 88  KPGTIVQLEPFVVNLADPGGKRYLKLTMAV---DAGDEKLKAEIDARLPQIRDSILLLLT 144

Query: 130 TVSIKQITGAQGFRYFKED---IEERVKLRSQGFVSSVIFRTFII 171
           + + + I    G    + +   I  R  L   G V +V F  F+I
Sbjct: 145 SKAYQDIAEVAGKIRLRTEVLAIFNR-YLAGAGSVHAVYFSEFVI 188


>gi|289670555|ref|ZP_06491630.1| flagellar basal body-associated protein FliL [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 175

 Score = 39.4 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 24/165 (14%), Positives = 53/165 (32%), Gaps = 31/165 (18%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L V   VV         W       F F  + +EK  K       +    + +       
Sbjct: 28  LLVAIGVVVLAAAGGGAW-------FFFGHKDDEKDGKHAAPKVAEVPKPAQY------- 73

Query: 78  KKLQIFSLQP-IITNFDSSPKD--WLRLDIALICKDIPDKVFLET----LHQDIMAYIRT 130
                F + P I+ N         +L++++ L+ +D  +   +      +   ++  +  
Sbjct: 74  -----FPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQ 128

Query: 131 VSIKQITGAQGFRYF-KEDIEERVKLRSQGF----VSSVIFRTFI 170
                +    G +   K  + E  K+ +       V  ++F +F+
Sbjct: 129 TKATDVADLAGKQKLQKAALAEAQKVMTSETGKKCVEELLFTSFV 173


>gi|83589635|ref|YP_429644.1| flagellar basal body-associated protein FliL [Moorella
           thermoacetica ATCC 39073]
 gi|83572549|gb|ABC19101.1| Flagellar basal body-associated protein FliL [Moorella
           thermoacetica ATCC 39073]
          Length = 159

 Score = 39.4 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 22/115 (19%), Positives = 41/115 (35%), Gaps = 7/115 (6%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIPDKVFLET- 119
               + +  TG+      LQ  SL  I+ N        +LR  I +   D      L   
Sbjct: 46  NSRGMAAAPTGNNPEPAALQKLSLDSIVVNLADPGLHRYLRAKITMEYSDPKLATELNDK 105

Query: 120 ---LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
              +   I++ +R+     +   +  +  +E +       + G V ++ F  FII
Sbjct: 106 LYRVRDTIISVLRSKKTDDLQNEEALK--RELLTAINSQLTAGQVRALYFEEFII 158


>gi|218778864|ref|YP_002430182.1| flagellar basal body-associated protein FliL [Desulfatibacillum
           alkenivorans AK-01]
 gi|218760248|gb|ACL02714.1| Flagellar basal body-associated protein FliL [Desulfatibacillum
           alkenivorans AK-01]
          Length = 166

 Score = 39.0 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 59/178 (33%), Gaps = 20/178 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D        G    + +   VV   +    G++G ++M      Q            
Sbjct: 1   MADDAQAEGKGGGGLKWILIALIVV---VLGAGGFIGFLLMSGGGDAQ---------PAA 48

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLE-- 118
               +      G+  +     +  +   I N          L   +  +   + V  E  
Sbjct: 49  NVPAAPAPAPAGNPNAGAPGIMVEMDSFIVNLRDREGKRY-LKAKINFEVPTEAVKAEFT 107

Query: 119 ----TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
                +   I+  +   S  +I+  +G    KE++  RV ++ S G VS+V F  F++
Sbjct: 108 TRKAQIRDVILILLSAKSFAEISRLEGKLQLKEELMARVNQVLSSGRVSNVFFTEFVV 165


>gi|307264878|ref|ZP_07546440.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|326389472|ref|ZP_08211039.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           ethanolicus JW 200]
 gi|306920136|gb|EFN50348.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|325994477|gb|EGD52902.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 135

 Score = 39.0 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 1/54 (1%)

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDI-EERVKLRSQGFVSSVIFRTFII 171
            +   I+  +R  + + + G +G    K DI  E  K+  +G + +V F  FI+
Sbjct: 81  QIRDLIIQILRGKTEQDVEGPEGQEKLKNDIKNEINKIIGEGKIVNVYFDEFIV 134


>gi|114764043|ref|ZP_01443282.1| flagellar basal body-associated protein FliL [Pelagibaca
           bermudensis HTCC2601]
 gi|114543401|gb|EAU46416.1| flagellar basal body-associated protein FliL [Roseovarius sp.
           HTCC2601]
          Length = 182

 Score = 39.0 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 18/176 (10%), Positives = 55/176 (31%), Gaps = 13/176 (7%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           +D  +   +G++  + +   +     G           L  F G      +         
Sbjct: 11  EDEGTPKKKGSKLPMLIGLVLALAGGGGGF--YAAWSGLLPFGGGHAPAEEAHGEGGQGA 68

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICKDIPDKVFLE---- 118
                      +    +    L+P++ +  +  +   LR   +L   ++P +   E    
Sbjct: 69  AGGHGGDPALPLPDTNVAFVELEPLVISMGTIAELHHLRFRASL---EVPPQYVAEVETL 125

Query: 119 --TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              +   + +Y+R +    I         +  +  R++ +  +  +  ++   F++
Sbjct: 126 TPRVIDVLNSYLRALRPSDIEAPGALIRLRSQMLRRIQMVAGEDRIRDLLVMEFVL 181


>gi|289578423|ref|YP_003477050.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           italicus Ab9]
 gi|297544699|ref|YP_003677001.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|289528136|gb|ADD02488.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           italicus Ab9]
 gi|296842474|gb|ADH60990.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 131

 Score = 38.6 bits (88), Expect = 0.28,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 42/89 (47%), Gaps = 8/89 (8%)

Query: 89  ITNFDSSPK---DWLRLDIA--LICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFR 143
           ITN     K     ++L +A   I K + ++     +   I+  +R+ + +++ G +G  
Sbjct: 44  ITNLKGEEKFVKATVQLQVADKNILKTLEERN--SEIRDLIIQILRSKTAQEVEGPEGQE 101

Query: 144 YFKEDIEERV-KLRSQGFVSSVIFRTFII 171
             K DI+  + K+  +  + +V F  FI+
Sbjct: 102 KLKNDIKNGINKIIGEEKIINVYFDEFIV 130


>gi|94987084|ref|YP_595017.1| flagellar basal body-associated protein [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731333|emb|CAJ54696.1| Flagellar basal body-associated protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 189

 Score = 38.6 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 16/126 (12%), Positives = 44/126 (34%), Gaps = 6/126 (4%)

Query: 52  KYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD---WLRLDIALIC 108
                  ++  +       +  T     L+  SL  +  N           + +D+ L  
Sbjct: 63  PGTSQEQSDNANKKEGGKGSSPTDPKPLLKPVSLPSVTVNLADPSGSKYLRIGMDVELSS 122

Query: 109 KDIPDKVF--LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVI 165
           ++    +      +   I+  + + +  ++  A+G    K ++  R+ ++  +  V  + 
Sbjct: 123 EEAITNLLTQSARVRDAIILLLSSKTSDELVSAEGKVLLKNEVASRLNQILGEPRVVRIY 182

Query: 166 FRTFII 171
           F  F+I
Sbjct: 183 FTDFVI 188


>gi|28899017|ref|NP_798622.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153836968|ref|ZP_01989635.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|153840526|ref|ZP_01993193.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|153841426|ref|ZP_01993403.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|260365237|ref|ZP_05777794.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus K5030]
 gi|260878787|ref|ZP_05891142.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AN-5034]
 gi|260897382|ref|ZP_05905878.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus Peru-466]
 gi|260899941|ref|ZP_05908336.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ4037]
 gi|4322003|gb|AAD15906.1| polar flagellar protein FliL [Vibrio parahaemolyticus]
 gi|28807236|dbj|BAC60506.1| polar flagellar protein FliL [Vibrio parahaemolyticus RIMD 2210633]
 gi|149745479|gb|EDM56730.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|149745810|gb|EDM56940.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|149749741|gb|EDM60486.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|308088284|gb|EFO37979.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus Peru-466]
 gi|308094199|gb|EFO43894.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AN-5034]
 gi|308107277|gb|EFO44817.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ4037]
 gi|308115425|gb|EFO52965.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus K5030]
 gi|328474446|gb|EGF45251.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus 10329]
          Length = 167

 Score = 38.6 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 22/181 (12%), Positives = 56/181 (30%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +          + KL +    V   +G          ++      +  + +      
Sbjct: 1   MAEEQLQGADAPKGKSKLLIIIIAVVVLLGGGG--AAAFFLMGSDDSAQAAEAESQQTQA 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
              N +  V+               QP I N     +D  +++   L+ +   ++     
Sbjct: 59  AAANPIAYVNLP-------------QPFIFNVTGDRRDRLVQIKAQLMVRGSENEQLARY 105

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFV-----SSVIFRTFI 170
               +   +++   + +++Q+    G    ++   E +K      V       V+F  F+
Sbjct: 106 HSPLVESSLLSTFASATVEQLRSPTGRVELRDRASEDIKAALNAAVGKPVIEKVLFTDFV 165

Query: 171 I 171
           I
Sbjct: 166 I 166


>gi|298530628|ref|ZP_07018030.1| flagellar basal body-associated protein FliL [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510002|gb|EFI33906.1| flagellar basal body-associated protein FliL [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 167

 Score = 38.6 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 15/108 (13%), Positives = 43/108 (39%), Gaps = 6/108 (5%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSS-PKDWLR--LDIALICKDIPDKVFLE--TLHQDI 124
                   +   +  L+P + N      + +LR  L++  + +   +++  +   +   I
Sbjct: 59  APEQDERPRDTVMVELEPFVVNLADPLGRRYLRTTLEVEAVNRSAANELEDQRPQVRDAI 118

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
           +  + + + + +         + +I ER+ ++  Q  V  V F  F++
Sbjct: 119 LLLLSSKTFEDLRTMDRKINLRNEIVERINQVIGQNKVYKVYFTEFVV 166


>gi|313673295|ref|YP_004051406.1| flagellar basal body-associated protein flil [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312940051|gb|ADR19243.1| flagellar basal body-associated protein FliL [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 178

 Score = 38.2 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 56/128 (43%), Gaps = 15/128 (11%)

Query: 53  YQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDI 111
            ++       + + +   +G+     K  ++S+  II N      + +L++ IA+   ++
Sbjct: 56  AKEEKAPAKEEKAKKDKKSGEK---AKTVVYSMGAIIVNLADQGVQRYLKVQIAV---EL 109

Query: 112 PDKVFLET-------LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSS 163
            +    E        +   I++ + + ++  +   QG    K++I +R  +  ++G ++ 
Sbjct: 110 DNPKLEEEVKKREPQIKDIIISVLSSKTVSDVNTPQGKIALKQEILKRANMVLTEGEITD 169

Query: 164 VIFRTFII 171
           + F  FI+
Sbjct: 170 LFFSEFIV 177


>gi|325920568|ref|ZP_08182490.1| flagellar basal body-associated protein [Xanthomonas gardneri ATCC
           19865]
 gi|325548961|gb|EGD19893.1| flagellar basal body-associated protein [Xanthomonas gardneri ATCC
           19865]
          Length = 183

 Score = 38.2 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 23/165 (13%), Positives = 53/165 (32%), Gaps = 31/165 (18%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +   VV         W       F F  + +EK  K       +    + +       
Sbjct: 36  LLIAIGVVVLAAAGGGAW-------FFFGHKGDEKGGKHAAPKVAEVPKPAQY------- 81

Query: 78  KKLQIFSLQP-IITNFDSSPKD--WLRLDIALICKDIPDKVFLET----LHQDIMAYIRT 130
                F + P I+ N         +L++++ L+ +D  +   +      +   ++  +  
Sbjct: 82  -----FPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQ 136

Query: 131 VSIKQITGAQGFRYF-KEDIEERVKLRSQGF----VSSVIFRTFI 170
                +    G +   K  + E  K+ +       V  ++F +F+
Sbjct: 137 TKATDVADLVGKQKLQKAALVEAQKVMTSETGKKCVEELLFTSFV 181


>gi|302383954|ref|YP_003819777.1| flagellar basal body-associated protein FliL [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194582|gb|ADL02154.1| flagellar basal body-associated protein FliL [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 223

 Score = 38.2 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 39/96 (40%), Gaps = 9/96 (9%)

Query: 84  SLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLH------QDIM-AYIRTVSIKQI 136
           +L  ++ N  S       L + L   ++ D     TL       QD+   ++R +  + I
Sbjct: 128 TLPDMVVNIQSPDGKPTFLKLTLTL-EMHDAELATTLQGQMPRMQDMFQGFLRELRPEDI 186

Query: 137 TGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            G+ G    + +I  RV  + +   V +V+    ++
Sbjct: 187 AGSAGTYQLRAEILRRVNLIAAPSRVDAVLIEEMLV 222


>gi|270284189|ref|ZP_05965705.2| conserved hypothetical protein [Bifidobacterium gallicum DSM 20093]
 gi|270277282|gb|EFA23136.1| conserved hypothetical protein [Bifidobacterium gallicum DSM 20093]
          Length = 1730

 Score = 37.8 bits (86), Expect = 0.52,   Method: Composition-based stats.
 Identities = 17/95 (17%), Positives = 35/95 (36%), Gaps = 7/95 (7%)

Query: 41  MLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITN-------FD 93
           +L   A Q  ++  + ++   +  +        TI  +  + ++ QP+ TN         
Sbjct: 745 LLKASANQTNDRTVRMVITGTFKPNALKAGHSVTIPNQGWEQWNNQPVTTNQPPVTIWTP 804

Query: 94  SSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYI 128
           +  K W+RL        + D     T   D M ++
Sbjct: 805 NPDKSWVRLGADGQWDTVIDPKETNTTGADNMVFL 839


>gi|126738565|ref|ZP_01754270.1| flagellar basal body-associated protein FliL [Roseobacter sp.
           SK209-2-6]
 gi|126720364|gb|EBA17070.1| flagellar basal body-associated protein FliL [Roseobacter sp.
           SK209-2-6]
          Length = 175

 Score = 37.8 bits (86), Expect = 0.52,   Method: Composition-based stats.
 Identities = 24/177 (13%), Positives = 60/177 (33%), Gaps = 17/177 (9%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           + +D     +        +   V+    G    +     +L        E   +      
Sbjct: 8   AEEDAP---VAKKSKLPMIIGVVLALVGGGGGFFAAQSGLLPFGQSASSE---EMHAAEV 61

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD-----WLRLDIALICKDIPDKVF 116
               V S  T +   L  L    ++PI+     +          +L++ +  +   +KV 
Sbjct: 62  APEGVDSGETAE--DLANLAFIDMEPIVITLRKASGLKHLRFRAQLEVDIANQAAVEKVL 119

Query: 117 LETLHQDIM-AYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
              +  D++ +Y+R + ++ +T        +  +  R+ +   QG V  ++   F++
Sbjct: 120 PRVV--DVLNSYLRALELEDLTDPMALPKLRAQMLRRINIATGQGRVRDLLIMDFVL 174


>gi|188586030|ref|YP_001917575.1| flagellar basal body-associated protein FliL [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179350717|gb|ACB84987.1| flagellar basal body-associated protein FliL [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 154

 Score = 37.8 bits (86), Expect = 0.59,   Method: Composition-based stats.
 Identities = 18/117 (15%), Positives = 40/117 (34%), Gaps = 8/117 (6%)

Query: 57  ILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVF 116
           I  +       +   G+ +       F L    TN        +   + ++ +       
Sbjct: 33  IAVSVASPDQPTTEKGEEVVSYTGITFPLGEFTTNLADEGARRI-FQVEVVVELSESGAK 91

Query: 117 LE------TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIF 166
            E       +   I   +R++  +++   +G    +E I+E +  R  +G V +V F
Sbjct: 92  SELEEREPQVRDKIYTILRSMKAEELNEQEGMEELREQIKEAIDERIEEGEVVNVYF 148


>gi|46578464|ref|YP_009272.1| flagellar protein FliL [Desulfovibrio vulgaris str. Hildenborough]
 gi|46447875|gb|AAS94531.1| flagellar protein FliL [Desulfovibrio vulgaris str. Hildenborough]
          Length = 171

 Score = 37.8 bits (86), Expect = 0.59,   Method: Composition-based stats.
 Identities = 17/130 (13%), Positives = 44/130 (33%), Gaps = 8/130 (6%)

Query: 49  KEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALIC 108
           ++   Q        D +          +  + ++ +L P + N          L +++  
Sbjct: 42  RQPPAQAEQAATEADKNATKGAGKTDTAKSEGRLTTLPPFLVNLADPAGRRY-LKLSMDV 100

Query: 109 KDIPDKVFLE------TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFV 161
           +        E       +   I+  +   S  ++   +G    K ++ +R+ ++     V
Sbjct: 101 EVNAPAAVKEIEGQTAKVRDAIILLLSGKSYTELAAPEGKLLLKNEVADRLNQILGAPRV 160

Query: 162 SSVIFRTFII 171
           + V F  F+I
Sbjct: 161 TRVYFTEFVI 170


>gi|114777573|ref|ZP_01452554.1| flagellar protein FliL [Mariprofundus ferrooxydans PV-1]
 gi|114552044|gb|EAU54561.1| flagellar protein FliL [Mariprofundus ferrooxydans PV-1]
          Length = 173

 Score = 37.4 bits (85), Expect = 0.68,   Method: Composition-based stats.
 Identities = 27/177 (15%), Positives = 62/177 (35%), Gaps = 13/177 (7%)

Query: 1   MSYDDTTSQYI-RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ ++   +   + +   L +   V+   +    G++   +M         +K       
Sbjct: 1   MADEEKEEKGNGKSSGGLLPIINLVLLLLVLAVGGFIAWKMMSIEQPATDSDKQAVAQTE 60

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLE 118
           +         +TG  I      +  +  I  N   + +   LR  I L  ++   KV + 
Sbjct: 61  DTTIPEAEDENTGPPI------MIDIDDITVNLADADESRFLRAKIKLEVRNDDAKVKVT 114

Query: 119 T----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFI 170
                ++  I+  + +     I   QG    KED+  R+ ++     + ++ F  F+
Sbjct: 115 ENMVKVNDLIITVLASKKFSDIRTPQGKYALKEDLVYRLNRIVGGKPIKNLYFTDFV 171


>gi|117620220|ref|YP_854712.1| flagellar basal body-associated protein FliL [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117561627|gb|ABK38575.1| flagellar basal body-associated protein FliL [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 144

 Score = 37.4 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 42/98 (42%), Gaps = 12/98 (12%)

Query: 85  LQP-IITNFDSSPKD--WLRLDIALICKDIPDKVFLET----LHQDIMAYIRTVSIKQIT 137
           L P IITN+ S  K   ++R+ + L+ ++  D   LE     +   I+  + + S  QI 
Sbjct: 45  LDPDIITNYLSDGKTLGYVRVTVELMAENEADLKLLEQHDPLIRDAIIRLMGSKSADQIK 104

Query: 138 GAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
                   +++ + R      K   +  V  +IF  F+
Sbjct: 105 SLVSREDLRKECQTRANELLVKETGKKAVRELIFTKFL 142


>gi|332799186|ref|YP_004460685.1| flagellar basal body-associated protein FliL [Tepidanaerobacter sp.
           Re1]
 gi|332696921|gb|AEE91378.1| flagellar basal body-associated protein FliL [Tepidanaerobacter sp.
           Re1]
          Length = 152

 Score = 37.4 bits (85), Expect = 0.73,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 44/90 (48%), Gaps = 11/90 (12%)

Query: 89  ITNFDSSPKDWLRLDIALIC----KDIPDKVFL--ETLHQDIMAYIRTVSIKQITGAQGF 142
           +TN     K ++RL  +L+     KD+ +++ L    +   I   +R+ +   I  ++G 
Sbjct: 66  LTNLSD--KGYIRL--SLVYLLNSKDVENELKLKESEIRDKIFVILRSETYDSIKDSEGM 121

Query: 143 RYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
              ++ I+E + ++ + G +  V F + I+
Sbjct: 122 ENLRKKIKESLNQILTNGSIVDVYFTSIIV 151


>gi|120603952|ref|YP_968352.1| flagellar basal body-associated protein FliL [Desulfovibrio
           vulgaris DP4]
 gi|120564181|gb|ABM29925.1| flagellar basal body-associated protein FliL [Desulfovibrio
           vulgaris DP4]
 gi|311232392|gb|ADP85246.1| flagellar basal body-associated protein FliL [Desulfovibrio
           vulgaris RCH1]
          Length = 169

 Score = 37.0 bits (84), Expect = 0.82,   Method: Composition-based stats.
 Identities = 21/178 (11%), Positives = 55/178 (30%), Gaps = 17/178 (9%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +   +   + +    ++   +V   +            L     Q E+   +   N 
Sbjct: 1   MAEEQKPA---KKSSKVKWIILLLVLLLLAGGGAGAYWWFFLRQPPAQAEQAATEADKNA 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLE-- 118
                       +       ++ +L P + N          L +++  +        E  
Sbjct: 58  TKGAGKTDTAKSEG------RLTTLPPFLVNLADPAGRRY-LKLSMDVEVNAPAAVKEIE 110

Query: 119 ----TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
                +   I+  +   S  ++   +G    K ++ +R+ ++     V+ V F  F+I
Sbjct: 111 GQTAKVRDAIILLLSGKSYTELAAPEGKLLLKNEVADRLNQILGAPRVTRVYFTEFVI 168


>gi|209963532|ref|YP_002296447.1| flagellar basal body-associated protein FliL [Rhodospirillum
           centenum SW]
 gi|209956998|gb|ACI97634.1| flagellar basal body-associated protein FliL [Rhodospirillum
           centenum SW]
          Length = 161

 Score = 37.0 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 33/107 (30%), Gaps = 7/107 (6%)

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKV-----FLETLHQDIM 125
                         L  +  N          L I +  +  PDK          L   + 
Sbjct: 55  APPPAQAGWSAFVKLPDLTVNL-RPTSKVKLLKIGVTLRTAPDKAAELATLEPVLIDGMQ 113

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-VSSVIFRTFII 171
            Y+R +    + G  G    +E +  R +L +    V  V+ RT I+
Sbjct: 114 DYLRQLDEHDLEGNAGLARLREGLLRRSRLLAAPVPVEDVLLRTMIL 160


>gi|206891032|ref|YP_002249869.1| flagellar basal body-associated protein FliL [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742970|gb|ACI22027.1| flagellar basal body-associated protein FliL [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 170

 Score = 37.0 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 16/97 (16%), Positives = 41/97 (42%), Gaps = 10/97 (10%)

Query: 83  FSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET-------LHQDIMAYIRTVSIKQ 135
           F+L+P + N          L +++   ++ D    E        +   I+  +   +  +
Sbjct: 75  FALEPFVVNLMDQSGTKY-LKVSVQI-ELSDAKLAEQAKNKTPQIRDAIITLLTNKTSDE 132

Query: 136 ITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
           +   +G    K++I++R  ++  +G V +V    F++
Sbjct: 133 LITPEGKLLLKDEIKQRANQILGEGTVINVYLTDFVM 169


>gi|167037658|ref|YP_001665236.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167040319|ref|YP_001663304.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           sp. X514]
 gi|256750751|ref|ZP_05491636.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|300914403|ref|ZP_07131719.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           sp. X561]
 gi|307724361|ref|YP_003904112.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           sp. X513]
 gi|320116073|ref|YP_004186232.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|166854559|gb|ABY92968.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           sp. X514]
 gi|166856492|gb|ABY94900.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256750334|gb|EEU63353.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|300889338|gb|EFK84484.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           sp. X561]
 gi|307581422|gb|ADN54821.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           sp. X513]
 gi|319929164|gb|ADV79849.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 135

 Score = 37.0 bits (84), Expect = 0.94,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 89  ITNFDSSPKDWLRLDIALICKDIPDKVFLET----LHQDIMAYIRTVSIKQITGAQGFRY 144
           ITN     + +++  I L   D      LE     +   I+  +R  + + + G +G   
Sbjct: 48  ITNL-KGDRKFVKATIKLQVADKNTLKILEERTPQIRDLIIQILRGKTDQDVEGPEGQEK 106

Query: 145 FKEDIEERV-KLRSQGFVSSVIFRTFII 171
            K DI+ ++ K+  +  + +V F  FI+
Sbjct: 107 LKNDIKNQINKIIGERKIVNVYFEEFIV 134


>gi|196232464|ref|ZP_03131317.1| serine/threonine protein kinase [Chthoniobacter flavus Ellin428]
 gi|196223536|gb|EDY18053.1| serine/threonine protein kinase [Chthoniobacter flavus Ellin428]
          Length = 801

 Score = 37.0 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 38/108 (35%), Gaps = 8/108 (7%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLF----AGQKEEKYQKFILNN 60
           D   Q  +   ++  +    + T      G+L    +L  F    A    +  +K     
Sbjct: 332 DPKKQAGKPRNYRWLIYTTAMLTVAVGVSGFLFRNQLLARFRPVEAKDTAQAAKKETAEM 391

Query: 61  FYDNSVRSVHTGD-TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALI 107
            Y+ + + +  GD   + +       +P   +     K+W+ L  A++
Sbjct: 392 TYEQARQLIAKGDVKQATEAFATLEARP---DTPQPQKNWITLHAAIV 436


>gi|302392383|ref|YP_003828203.1| flagellar basal body-associated protein FliL [Acetohalobium
           arabaticum DSM 5501]
 gi|302204460|gb|ADL13138.1| flagellar basal body-associated protein FliL [Acetohalobium
           arabaticum DSM 5501]
          Length = 149

 Score = 36.7 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 13/54 (24%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDI-EERVKLRSQGFVSSVIFRTFII 171
            +   +++ +RT   + I    G +  +E I  E  K  ++G V++V F  F++
Sbjct: 95  QVRDAVISIVRTKKPQDINTQAGIKDLREQIRNELNKFIAEGKVTNVFFTQFVV 148


>gi|253702498|ref|YP_003023687.1| flagellar basal body-associated protein FliL [Geobacter sp. M21]
 gi|251777348|gb|ACT19929.1| flagellar basal body-associated protein FliL [Geobacter sp. M21]
          Length = 172

 Score = 36.7 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 22/177 (12%), Positives = 54/177 (30%), Gaps = 12/177 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +      +  + +   V    IG          +       ++      +   
Sbjct: 1   MAEQAKDTPPKDNKKLFIIIGAVVAVLAIGGG------AALFLGGGKGEKGAEGAKVEAK 54

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-----LRLDIALICKDIPDKV 115
                  +       +     I+ ++P I N     +       +  ++A        + 
Sbjct: 55  AEGGGHGAPAKEGEGAAAGATIYPMEPFIVNIYDGAELRYLKVKVEFEMANPQVKPELEA 114

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
            +  L   I+  + T ++++I   QG    +E I   V K+     ++ V F  F++
Sbjct: 115 KMAPLRDAILILLTTKTMQEIQDLQGKNQLREQILAAVSKVVPPSKITKVYFTDFVV 171


>gi|163801851|ref|ZP_02195748.1| flagellar basal body-associated protein FliL [Vibrio sp. AND4]
 gi|159174359|gb|EDP59163.1| flagellar basal body-associated protein FliL [Vibrio sp. AND4]
          Length = 166

 Score = 36.7 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 23/185 (12%), Positives = 54/185 (29%), Gaps = 34/185 (18%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +          + KL +    V   +               F    +E  Q      
Sbjct: 1   MAEEQQQGADAPNGKSKLLIIIIAVVVLLVGGG-------AAAFFLMGSDESAQPEQAEQ 53

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
               +  +      I+         QP I N     +D  +++   L+ +   ++     
Sbjct: 54  TQPQTTAAPIAYVNIA---------QPFIFNVTGDRRDRLVQIKAQLMVRGGENEQLARY 104

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---------LRSQGFVSSVIF 166
               +   +++   + + +Q+    G    + ++ ER              Q  +  V+F
Sbjct: 105 HSPLIESSLLSTFASATAEQLRSPTG----RVELRERASDDIKAALSTAVGQPVIEKVLF 160

Query: 167 RTFII 171
             F+I
Sbjct: 161 TDFVI 165


>gi|330445372|ref|ZP_08309024.1| flagellar basal body-associated FliL family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328489563|dbj|GAA03521.1| flagellar basal body-associated FliL family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 159

 Score = 36.3 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 22/170 (12%), Positives = 50/170 (29%), Gaps = 26/170 (15%)

Query: 13  GNQHKLFV-TWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           G +  + +    VV    G    WL             E   Q                 
Sbjct: 4   GKKKLMIISAAVVVLLLAGGIGFWLLSGDDAAEPQQAAEVAQQ---------------GA 48

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET----LHQDIMA 126
                +    +   QP   N     +D  +++ + L+ +   ++   +     +   ++ 
Sbjct: 49  VKAPVMSAYYVVLPQPFTFNVTGDSRDRVVQIKVQLMVRGDKNEALAKQHTPLIESTLLQ 108

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEE-----RVKLRSQGFVSSVIFRTFII 171
                +++Q+    G    ++   E      VK+     V  V+F  F++
Sbjct: 109 AFGVATVEQLRNPNGRDQLRQQALEAVKATMVKVAGTPAVERVLFTGFVM 158


>gi|260772329|ref|ZP_05881245.1| flagellar biosynthesis protein FliL [Vibrio metschnikovii CIP
           69.14]
 gi|260611468|gb|EEX36671.1| flagellar biosynthesis protein FliL [Vibrio metschnikovii CIP
           69.14]
          Length = 169

 Score = 36.3 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 21/177 (11%), Positives = 61/177 (34%), Gaps = 26/177 (14%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           D  SQ    ++ KL +        +    G      ++   + Q+         +     
Sbjct: 4   DENSQDAPKSKKKLLIIIVAAAVLLLGGGG--AAFFLMGSGSDQQS-------ADTANRR 54

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLE----T 119
           +  SV     +++        QP + N     +   +++ + L+ +   ++         
Sbjct: 55  AAPSVAPVSYVNIA-------QPFVFNVSGDTRGRMVQVKVQLMVRGTNNENLARFHSPL 107

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
           +   ++A   + +++Q+    G    ++   E +K     +  +  +  V+F  F++
Sbjct: 108 VESTLLATFASATVEQLRTPSGRVELRDKATEDIKAAMTQVVGEPVIERVLFTDFVM 164


>gi|91223551|ref|ZP_01258816.1| flagellar basal body-associated protein FliL [Vibrio alginolyticus
           12G01]
 gi|91191637|gb|EAS77901.1| flagellar basal body-associated protein FliL [Vibrio alginolyticus
           12G01]
          Length = 167

 Score = 36.3 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/180 (10%), Positives = 50/180 (27%), Gaps = 23/180 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +          + KL +    V   +           ++      + E  Q+  +  
Sbjct: 1   MAEEQLQGADAPKGKSKLLIIIIAVVVLLLGGG--AAAFFLMGSDEPAQAESSQQAQVKA 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET- 119
                +  V+                        S    +++   L+ +   ++      
Sbjct: 59  SDAAPIAYVNLPQAFVFNVT------------GDSRDRLVQIKAQLMVRGAENEELARYH 106

Query: 120 ---LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFV-----SSVIFRTFII 171
              +   +++   + ++ Q+    G    ++   E +K      V       V+F  F+I
Sbjct: 107 SPLIESSMLSTFASATVDQLRSPTGRVELRDRASEDIKAALNAAVGKPVIEKVLFTDFVI 166


>gi|302389161|ref|YP_003824982.1| cobalt ABC transporter, ATPase subunit [Thermosediminibacter oceani
           DSM 16646]
 gi|302199789|gb|ADL07359.1| cobalt ABC transporter, ATPase subunit [Thermosediminibacter oceani
           DSM 16646]
          Length = 277

 Score = 36.3 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 11/61 (18%)

Query: 94  SSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV 153
           +  + W+R  + L+ +D  D+VF  T+ +D +A+          G +       +IEERV
Sbjct: 71  AETEYWVRSRVGLVFQDPDDQVFSSTVEED-VAF----------GPRNLGLAPAEIEERV 119

Query: 154 K 154
           +
Sbjct: 120 R 120


>gi|262393594|ref|YP_003285448.1| flagellar biosynthesis protein FliL [Vibrio sp. Ex25]
 gi|262337188|gb|ACY50983.1| flagellar biosynthesis protein FliL [Vibrio sp. Ex25]
          Length = 167

 Score = 36.3 bits (82), Expect = 1.8,   Method: Composition-based stats.
 Identities = 17/180 (9%), Positives = 49/180 (27%), Gaps = 23/180 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +          + KL +    V   +           ++      + E  Q+     
Sbjct: 1   MAEEQLQGADAPKGKGKLLIIIIAVVVLLLGGG--AAAFFLMGSDEPAQAEASQQVQAKA 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET- 119
              + +  V+                             +++   L+ +   ++      
Sbjct: 59  SDASPIAYVNLPQAFVFNVTGDRR------------DRLVQIKAQLMVRGAENEELARYH 106

Query: 120 ---LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFV-----SSVIFRTFII 171
              +   +++   + ++ Q+    G    ++   E +K      V       V+F  F+I
Sbjct: 107 SPLIESSLLSTFASATVDQLRSPTGRVELRDRASEDIKAALNAAVGKPVIEKVLFTDFVI 166


>gi|188582488|ref|YP_001925933.1| flagellar basal body-associated protein FliL [Methylobacterium
           populi BJ001]
 gi|179345986|gb|ACB81398.1| flagellar basal body-associated protein FliL [Methylobacterium
           populi BJ001]
          Length = 192

 Score = 35.9 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 19/104 (18%), Positives = 40/104 (38%), Gaps = 9/104 (8%)

Query: 61  FYDNSVRSVHTGDTISLKKLQIF-SLQPIITNFDSSPK----DWLRLDIALICKDIPDKV 115
                    H G+ +  K   +F  ++ ++ N    P     + L+L +AL  KD   + 
Sbjct: 71  AAHADAHGEHAGEKVDPKAQAVFLDMRDMMVNLSPDPGATKANVLKLRVALELKDAKVES 130

Query: 116 ----FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL 155
                +  +      Y+R +    + G+ G    +E++  RV +
Sbjct: 131 TVKPLMPRVEDAFQTYLREIRASDLAGSAGLYRLREELLRRVNI 174


>gi|47228422|emb|CAG05242.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 1946

 Score = 35.9 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 12/63 (19%), Positives = 22/63 (34%)

Query: 37   GGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP 96
                       ++ E+      ++  + +VRS     T +        LQP +TN   S 
Sbjct: 1030 ASTAPKPTSPERRTEEPAATPRSSVDEATVRSALPPPTAAFMPGPAEELQPAVTNLTVSD 1089

Query: 97   KDW 99
            + W
Sbjct: 1090 RTW 1092


>gi|332140588|ref|YP_004426326.1| flagellar basal body-associated protein FliL [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327550610|gb|AEA97328.1| flagellar basal body-associated protein FliL [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 179

 Score = 35.9 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 59/181 (32%), Gaps = 13/181 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   +     + K+ +   +    +G          +LF    +   +        
Sbjct: 1   MADEELQVEDGGKKKGKMMLIIIIAVVLVGGGA---AAYFLLFAGGDEPAAEQLAETDAA 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
               +  +   G+      L +   +P + N   S +D  +++ + L+ +   ++   +T
Sbjct: 58  AAAATAPAAGPGNAEMGTALYVAMPRPFVFNVPGSGRDRLVQIKVQLLVRGSDNEELAKT 117

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++    T +   +    G    +E     V      +     V  V+F  F+
Sbjct: 118 HIPLIEGTLLQAFSTSNADDLVTEAGKIELREQAVSEVQKALKDITGSDVVERVLFTGFV 177

Query: 171 I 171
           +
Sbjct: 178 M 178


>gi|116251391|ref|YP_767229.1| dTDP-glucose 4,6-dehydratase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256039|emb|CAK07120.1| putative dTDP-glucose 4,6-dehydratase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 351

 Score = 35.9 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 105 ALICKDIPDKVFLETLHQDIMAYIRTV-SIKQITGAQGFRYFKEDIEERVKLR 156
           + + + +  ++  E L+ D + Y   + S+K +  A  +++ + DI +R ++R
Sbjct: 14  SALVRHLVSEIGAEVLNVDTLTYAGNLASLKSVESAPNYQFLRADICDRARMR 66


>gi|163852466|ref|YP_001640509.1| flagellar basal body-associated protein FliL [Methylobacterium
           extorquens PA1]
 gi|218531222|ref|YP_002422038.1| flagellar basal body-associated protein FliL [Methylobacterium
           chloromethanicum CM4]
 gi|240139803|ref|YP_002964280.1| Flagellar fliL protein [Methylobacterium extorquens AM1]
 gi|254562218|ref|YP_003069313.1| flagellar fliL protein [Methylobacterium extorquens DM4]
 gi|163664071|gb|ABY31438.1| flagellar basal body-associated protein FliL [Methylobacterium
           extorquens PA1]
 gi|218523525|gb|ACK84110.1| flagellar basal body-associated protein FliL [Methylobacterium
           chloromethanicum CM4]
 gi|240009777|gb|ACS41003.1| Flagellar fliL protein [Methylobacterium extorquens AM1]
 gi|254269496|emb|CAX25462.1| Flagellar fliL protein [Methylobacterium extorquens DM4]
          Length = 172

 Score = 35.9 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 45/126 (35%), Gaps = 9/126 (7%)

Query: 39  IVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIF-SLQPIITNFDSSP- 96
           I+   +           F+ +          H  + +  K   +F  ++ ++ N    P 
Sbjct: 29  IIAAAVLLLGGGGGGFFFMKSRAAHADAHGEHGAEKLDPKAQAVFLDMRDMLVNLSPDPG 88

Query: 97  ---KDWLRLDIALICKDIPDKV----FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDI 149
               + L+L +AL  KD   +      +  +      Y+R +    + G+ G    +E++
Sbjct: 89  ATKSNVLKLRVALELKDAKVEATVKPLMPRVEDAFQTYLREIRASDLAGSAGLYRLREEL 148

Query: 150 EERVKL 155
             RV +
Sbjct: 149 LRRVNI 154


>gi|303326578|ref|ZP_07357021.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           3_1_syn3]
 gi|302864494|gb|EFL87425.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           3_1_syn3]
          Length = 113

 Score = 35.9 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 15/112 (13%), Positives = 35/112 (31%), Gaps = 5/112 (4%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDIPDKVFLET---L 120
               +     +      +  L PI  N      + +L+L + +       +        +
Sbjct: 1   DAPRIERQSDLPRSAGLVLPLPPITVNLSDPGGRRYLKLGMEVEVNADVSEALKAQNARI 60

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
              ++  +   S   I    G    K ++  R+ ++     V  V F  F++
Sbjct: 61  RDAVIMLLAGKSFTDIATPDGKVLLKAEVAARLNQILGAQRVIRVYFTDFVV 112


>gi|225849154|ref|YP_002729318.1| flagellar basal body-associated protein FliL [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225644683|gb|ACN99733.1| flagellar basal body-associated protein FliL [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 169

 Score = 35.9 bits (81), Expect = 2.3,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 48/128 (37%), Gaps = 9/128 (7%)

Query: 52  KYQKFILNNFYDNSVRSVHTGDTISLKKLQI-FSLQPIITNFDSSPKDWLRLDIALICKD 110
              KF+  +  +       T +  ++++  +   +   I N      D   + + ++ + 
Sbjct: 40  AAYKFLFASKNEEKPAEKVTKEVKNVEEHGVELEVGTFIANLADKDADRY-IKVTIVMEV 98

Query: 111 IPDKVFLE------TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSS 163
             +KV  E       +   I   + T + + +   +G    KE+I  RV  +   G V  
Sbjct: 99  QDEKVKEEATKRMPQIKDSINTLLFTKTSEDLKSPEGIERLKEEIIRRVNAILPTGGVKD 158

Query: 164 VIFRTFII 171
           V F  FII
Sbjct: 159 VYFTEFII 166


>gi|288962687|ref|YP_003452981.1| FliL protein [Azospirillum sp. B510]
 gi|288914953|dbj|BAI76437.1| FliL protein [Azospirillum sp. B510]
          Length = 179

 Score = 35.5 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 16/121 (13%), Positives = 45/121 (37%), Gaps = 10/121 (8%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD-SSPKDWLRLDIALICKDIPDKVFLE 118
                +V  +      S+    +  +  ++ N    +P  +L++ ++L       +   +
Sbjct: 57  AAGTPAVERLWAPAAESVPADAVAEMPELVVNLRRDTPSRFLKIGLSLTVSPRDRQRVEQ 116

Query: 119 ---TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR------SQGFVSSVIFRTF 169
               L   +  ++R +    + G+ G    + +I+ R  L        +  V+ V+ R+ 
Sbjct: 117 AMPQLTDSLQEFLRNLDQDDLEGSAGLHRLRSEIKRRFNLILSDPAGRRDVVTDVLLRSL 176

Query: 170 I 170
           +
Sbjct: 177 L 177


>gi|262281907|ref|ZP_06059676.1| zinc-binding oxidoreductase [Streptococcus sp. 2_1_36FAA]
 gi|262262361|gb|EEY81058.1| zinc-binding oxidoreductase [Streptococcus sp. 2_1_36FAA]
          Length = 334

 Score = 35.5 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 51/138 (36%), Gaps = 10/138 (7%)

Query: 26  YTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSL 85
              I    G +G I + +  A            N+ Y  S+ ++      +++ + + + 
Sbjct: 170 VVVISAAAGGIGSIAVQYAVAKGATVIGIASKKNSEYLKSLGAIPVAYEENIQNVLLSAS 229

Query: 86  Q-PIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRY 144
             PI    D    D+++L  +L  K       + +       Y+  +   Q TG +   Y
Sbjct: 230 PKPITKFLDCYGSDYVKLAFSLGLKGTAIGTLVPS------PYV-MIKGAQFTGPRHSTY 282

Query: 145 FKEDIEERVKLRSQGFVS 162
             +D+    ++ S+G V 
Sbjct: 283 --DDLNTLAEMVSEGKVR 298


>gi|71018395|ref|XP_759428.1| hypothetical protein UM03281.1 [Ustilago maydis 521]
 gi|46099035|gb|EAK84268.1| hypothetical protein UM03281.1 [Ustilago maydis 521]
          Length = 1203

 Score = 35.5 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 35/102 (34%), Gaps = 15/102 (14%)

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIAL----ICKDIPDKVFLETLHQDIMAY 127
            D      L+   L   + N   +PK WL   +AL    +   +P  V       D+ AY
Sbjct: 139 SDRAPHSDLEAERLVEAVANLPHNPKTWLPSQVALYLTHVLGLVPRPVV-----DDVTAY 193

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTF 169
           +R+  +    G + F    E   ER  L        ++    
Sbjct: 194 VRSSRM----GGRAFLRLSEKDLERQGL--NLKWRKLMIEAV 229


>gi|7025354|gb|AAF35845.1|AF220002_2 unknown [Rhodospirillum centenum]
          Length = 161

 Score = 35.1 bits (79), Expect = 3.4,   Method: Composition-based stats.
 Identities = 25/147 (17%), Positives = 44/147 (29%), Gaps = 14/147 (9%)

Query: 28  FIGIFCGWLGGIVMLFLFAGQKE--EKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSL 85
            +G       G++ L    G +E      +         S        T++L+      L
Sbjct: 25  LLGAGAVVSAGVLGLLASVGSREIGLWTDEAPPPAQAGWSAFVKLPDLTVNLRPTSKVKL 84

Query: 86  QPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYF 145
             I     ++P            K          L   +  Y R +    + G  G    
Sbjct: 85  LKIGVTLRTAPD-----------KAAELATLEPVLIDGMQDYFRQLDEHDLEGNAGLARL 133

Query: 146 KEDIEERVKLRSQGF-VSSVIFRTFII 171
           +E +  R +L +    V  V+ RT I+
Sbjct: 134 REGLLRRSRLLAAPVPVEDVLLRTMIL 160


>gi|239909252|ref|YP_002955994.1| flagellar FliL protein [Desulfovibrio magneticus RS-1]
 gi|239799119|dbj|BAH78108.1| flagellar FliL protein [Desulfovibrio magneticus RS-1]
          Length = 199

 Score = 35.1 bits (79), Expect = 3.5,   Method: Composition-based stats.
 Identities = 26/199 (13%), Positives = 52/199 (26%), Gaps = 29/199 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTW-------------FVVYTFIGIFCGWLGGIVMLFLF-- 45
           M+      Q  +     +                 F   TF                   
Sbjct: 1   MADPAPEEQPKKKKSGLIKYIILVVLLLVLGGGGYFAYLTFFAAKPPAAAPPAEGAAPAE 60

Query: 46  ---AGQKEEKYQKFILNNFYDNSVRSVHTGDTISL-----KKLQIFSLQPIITNFDSSPK 97
              A    E               +S   G                +L P + N      
Sbjct: 61  APKADAHAEAKPAEKKAEGGHGEAKSDAKGGGGHGGGKDKAASNNVALPPFVVNLADP-N 119

Query: 98  DWLRLDIALICKDIPDKVFLET----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV 153
               L + L  +   +   LE     +   ++  + + + + ++  +G    +++I +R+
Sbjct: 120 ARRYLKVVLEVEVTSNPELLEDNKAKIRDALLMLLSSKTSQDLSTLEGKILLRKEIVDRL 179

Query: 154 -KLRSQGFVSSVIFRTFII 171
            +   Q  VS V F  F+I
Sbjct: 180 NQAIGQPKVSRVYFTDFVI 198


>gi|84388117|ref|ZP_00991013.1| flagellar basal body-associated protein [Vibrio splendidus 12B01]
 gi|84377184|gb|EAP94054.1| flagellar basal body-associated protein [Vibrio splendidus 12B01]
          Length = 162

 Score = 35.1 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 26/170 (15%), Positives = 54/170 (31%), Gaps = 27/170 (15%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           +G    L +   VV   +GI          LF F G  +   +          +   V  
Sbjct: 9   KGKSKLLIIIIAVVVLLLGIGG-------ALFFFLGSDDSASESQSQPATAVVAAEPVMY 61

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET----LHQDIMA 126
            +            QP + N     KD  +++   L+ +   ++         +   ++A
Sbjct: 62  VNIP----------QPFLFNVTGDKKDRLVQIKAQLMVRGSKNEDLARYHSPLVESTLLA 111

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
              + ++ Q+    G    ++   E       +   Q  +  V+F  F+I
Sbjct: 112 TFASATVDQLRSPTGRIELRDKATEDIKASLAQAVGQPVIEKVLFTDFVI 161


>gi|327472862|gb|EGF18289.1| zinc-binding dehydrogenase family oxidoreductase [Streptococcus
           sanguinis SK408]
          Length = 334

 Score = 35.1 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 50/138 (36%), Gaps = 10/138 (7%)

Query: 26  YTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSL 85
              I    G +G I + +  A            N+ Y  S+ ++      +++   + + 
Sbjct: 170 VVVISAAAGGIGSIAVQYAVAKGATVIGIASKKNSEYLKSLGAIPVAYEENIQNALLSAS 229

Query: 86  Q-PIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRY 144
             PI    D    D+++L  +L  K I     + +       Y+  +   Q TG +   Y
Sbjct: 230 PKPITKFLDCYGSDYVKLAFSLGLKGIAIGTLVPS------PYV-MIRGAQFTGPRHSTY 282

Query: 145 FKEDIEERVKLRSQGFVS 162
             +D+    ++ S G V 
Sbjct: 283 --DDLNTLAEMVSDGKVR 298


>gi|239997090|ref|ZP_04717614.1| flagellar basal body-associated protein FliL [Alteromonas macleodii
           ATCC 27126]
          Length = 179

 Score = 35.1 bits (79), Expect = 3.9,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 58/181 (32%), Gaps = 13/181 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   +     + K+ +   +    +G          +LF    +   +        
Sbjct: 1   MAEEELQVEEGGKKKGKMMLIIIIAVVLLGGGA---AAYFLLFAGGDEPAAEQLAETDAA 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
               S  +   G       L +   +P + N   + +D  +++ + L+ +   ++   +T
Sbjct: 58  AAAASAPASAAGKAEMGTALYVAMPRPFVFNVPGAGRDRLVQIKVQLLVRGSDNEELAKT 117

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++    T +   +    G    +E     V      +     V  V+F  F+
Sbjct: 118 HIPLIEGTLLQAFSTSNADDLVTEAGKIELREQAVTEVQKALKDITGSDVVERVLFTGFV 177

Query: 171 I 171
           +
Sbjct: 178 M 178


>gi|329901245|ref|ZP_08272770.1| Flagellar biosynthesis protein fliL [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549177|gb|EGF33769.1| Flagellar biosynthesis protein fliL [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 173

 Score = 34.7 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 31/164 (18%), Positives = 50/164 (30%), Gaps = 39/164 (23%)

Query: 22  WFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQ 81
             VV    G   G+         F   K+ K         ++ +   V            
Sbjct: 34  AVVVLALAGGGAGY---------FLMGKKAKPAGEHAEESHEAAKAPVF----------- 73

Query: 82  IFSLQPIITNFDSSPKDWLRLDIALICKDIPD------KVFLETLHQDIMAYIRTVSIKQ 135
              L P   N      D   L IA+  +   D      KV+L  +   ++  + +    +
Sbjct: 74  -LVLDPFTVNLQQEAGDQY-LQIAMTVQVADDKQSEEIKVYLPQIRSRVLMVLSSKKASE 131

Query: 136 ITGAQGFRYFKEDI--------EERVKLRSQGFVSSVIFRTFII 171
           I    G +   +DI         ER K      V+ V F +F+I
Sbjct: 132 INTPDGKKQLADDIITAIKKPFSERGK---PQKVNDVFFTSFVI 172


>gi|149928156|ref|ZP_01916402.1| flagellar basal body-associated protein FliL [Limnobacter sp.
           MED105]
 gi|149823141|gb|EDM82379.1| flagellar basal body-associated protein FliL [Limnobacter sp.
           MED105]
          Length = 172

 Score = 34.7 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 21/172 (12%), Positives = 57/172 (33%), Gaps = 32/172 (18%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           +G++ KL +   +V T +         ++      G  EEK ++ +    +         
Sbjct: 20  KGSKKKLILILAIVLTVLAAGGAAAFFLLGSQGAEGGAEEKVEEPVGPPTF--------- 70

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPKDW-----LRLDIALICKDIPDKVFLETLHQDIMA 126
                        +   + N             +  +++   +    K F   +   I+ 
Sbjct: 71  -----------VVMDQFVVNLAEPDTTRYLQIGITYEVSGPAQAEEIKNFTPVIRSRILL 119

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEE--RVKLRSQGF-----VSSVIFRTFII 171
            +   ++  +T  +G +   +++ +  RV ++         +  V F +F+I
Sbjct: 120 VLSGKNVSNLTSIEGKQQLMDELVDLARVTIKGDPKDPTRGIRDVHFSSFVI 171


>gi|218887302|ref|YP_002436623.1| flagellar basal body-associated protein FliL [Desulfovibrio
           vulgaris str. 'Miyazaki F']
 gi|218758256|gb|ACL09155.1| flagellar basal body-associated protein FliL [Desulfovibrio
           vulgaris str. 'Miyazaki F']
          Length = 171

 Score = 34.3 bits (77), Expect = 5.3,   Method: Composition-based stats.
 Identities = 17/177 (9%), Positives = 53/177 (29%), Gaps = 13/177 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +       + +    ++   ++   +G   G       +   A Q  E   +     
Sbjct: 1   MAEEAAP--PKKKSGKLKWIILILLLLLLGGGGGGGAYWWFVMRPAAQNAEGAPEPAKAE 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKVF- 116
              ++      G     +  ++  L   + N           L +++ +       ++  
Sbjct: 59  GKADA-----KGGEAPARNAKVAKLPTFLVNLADPTGRRYLKLTMEVEVGSDATVKELEG 113

Query: 117 -LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
               +   ++  + + S   +   +     K ++ ER+ ++     V  V     +I
Sbjct: 114 QSAKVRDAVILLLSSKSYADLAPIESKLQLKNEVAERLNQILGGPKVLRVYITEMVI 170


>gi|324992138|gb|EGC24060.1| zinc-binding dehydrogenase family oxidoreductase [Streptococcus
           sanguinis SK405]
          Length = 334

 Score = 34.3 bits (77), Expect = 6.0,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 49/136 (36%), Gaps = 10/136 (7%)

Query: 28  FIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQ- 86
            I    G +G I + +  A            N+ Y  S+ ++      +++   + +   
Sbjct: 172 VISAAAGGIGSIAVQYAVAKGATVIGIASKKNSEYLKSLGAIPVAYEENIQNALLSASPK 231

Query: 87  PIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFK 146
           PI    D    D+++L  +L  K       + +       Y+  +   Q TG +   Y  
Sbjct: 232 PITKFLDCYGSDYVKLAFSLGLKGTDIGTLVPS------PYV-MIRGAQFTGPRHSTY-- 282

Query: 147 EDIEERVKLRSQGFVS 162
           +D+    ++ S G V 
Sbjct: 283 DDLNTLAEMVSDGKVR 298


>gi|224827259|ref|ZP_03700353.1| signal recognition particle-docking protein FtsY [Lutiella
           nitroferrum 2002]
 gi|224600548|gb|EEG06737.1| signal recognition particle-docking protein FtsY [Lutiella
           nitroferrum 2002]
          Length = 358

 Score = 34.3 bits (77), Expect = 6.1,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 38/126 (30%), Gaps = 10/126 (7%)

Query: 41  MLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--D 98
           M   F  +               N+          +    +   + P++      PK   
Sbjct: 1   MFSFFKKKSAPPATPASSETPATNTTAIAEPHIADAPSTPETAVIAPVVAE-AVPPKKPS 59

Query: 99  WL-RLDIAL------ICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEE 151
           W  RL   L      + K +        + +D+   + TV +    G     +  +D+ E
Sbjct: 60  WTERLKAGLSKTRDKLGKSLAGLFGGGKIDEDLYDELETVLLTADMGVDATLHLLKDVRE 119

Query: 152 RVKLRS 157
           RV LR 
Sbjct: 120 RVSLRG 125


>gi|47221354|emb|CAF97272.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 1314

 Score = 34.3 bits (77), Expect = 6.5,   Method: Composition-based stats.
 Identities = 22/114 (19%), Positives = 35/114 (30%), Gaps = 22/114 (19%)

Query: 53   YQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP 112
             Q   LN     + +     +          SL P++ N +  P    R+        + 
Sbjct: 1148 EQALPLNLSKRFAAKRPGAAEAPDP------SLGPVLGNQEQPPSKRARV--------VG 1193

Query: 113  DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIF 166
                 E L Q      RT  +   TG  G +  K   EE   L S   + + + 
Sbjct: 1194 CPAQAEDLSQ------RTAPVSAGTGGAG-QNLKNQ-EEPADLSSPSRIRAFLL 1239


>gi|294084395|ref|YP_003551153.1| flagellar basal body-associated protein FliL [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663968|gb|ADE39069.1| flagellar basal body-associated protein FliL [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 192

 Score = 34.3 bits (77), Expect = 6.7,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 67/197 (34%), Gaps = 32/197 (16%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D   +  +G   K+ +     +  IG   G   G ++         E+ ++ I   
Sbjct: 1   MAENDEEPKKSKGFLIKIILFVVGGFVLIGAGLG--VGYMLFGAAQPDPSEQIEEIIERK 58

Query: 61  FY----------DNSVRSVHTGDTISLKKLQIFSLQ---PIITNFDSSPKDWLRLDIALI 107
                       DN+     + DT  ++       +      +N   S K    L + + 
Sbjct: 59  MQEAEAAEQEALDNATAQRVSKDTPEVENFVTIYYEFPGTFTSNLMGSRKM---LQVGVG 115

Query: 108 CKDIPDKVFLETLHQDIMAYIRTVSI--------KQITGAQGFRYFKEDIEE--RVKLRS 157
                D+  +E +    +A +R+V +          + G  G       + +    KL S
Sbjct: 116 VSTQYDESIMEMVESHQLA-LRSVVLGVLSEFGEDDVQGIAGREKLATAMRDAMNAKLES 174

Query: 158 Q---GFVSSVIFRTFII 171
               G V+ V F +F++
Sbjct: 175 LEDFGGVAEVHFTSFVL 191


>gi|254292907|ref|YP_003058930.1| flagellar basal body-associated protein FliL [Hirschia baltica ATCC
           49814]
 gi|254041438|gb|ACT58233.1| flagellar basal body-associated protein FliL [Hirschia baltica ATCC
           49814]
          Length = 224

 Score = 34.3 bits (77), Expect = 6.8,   Method: Composition-based stats.
 Identities = 22/192 (11%), Positives = 55/192 (28%), Gaps = 51/192 (26%)

Query: 1   MSYDDTTSQYI---------RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFA----- 46
           M+ +D  S+           +    K  + + V+   + +  G   G+++          
Sbjct: 1   MADEDKESEDTTLEEEKPAKKKLAGKTMILFIVLPALLIMGGGVAVGMMLAGGGKEAASE 60

Query: 47  ------------------------------GQKEEKYQKFILNNFYDNSVRSVHTGDTIS 76
                                         G K++ + +   +  +    R   T    +
Sbjct: 61  SHAEIVDDHGEEKDDHGKKSDSHEEKADDHGAKDDGHGESSGSGDHQGPARETGTLQVGN 120

Query: 77  LKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPD----KVFLETLHQDIMAYIR 129
                 + +  ++ N  S   D    L+L + L  +D          L  +      ++R
Sbjct: 121 SGDPSYYIMPDLLVNLASQDGDRQLFLKLKLTLEAEDPEMFADIPKMLPRITDQYQMFLR 180

Query: 130 TVSIKQITGAQG 141
            + +  + G+ G
Sbjct: 181 ELRVDDLNGSAG 192


>gi|70992787|ref|XP_751242.1| conserved hypothetical protein [Aspergillus fumigatus Af293]
 gi|66848875|gb|EAL89204.1| conserved hypothetical protein [Aspergillus fumigatus Af293]
 gi|159130304|gb|EDP55417.1| conserved hypothetical protein [Aspergillus fumigatus A1163]
          Length = 1297

 Score = 34.0 bits (76), Expect = 7.0,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 41/134 (30%), Gaps = 14/134 (10%)

Query: 36   LGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS 95
            L G       + Q+          N  +  +  + T         ++  +      +   
Sbjct: 1162 LPGHKTPGASSSQRAPAKPSPNYPNSENIHLPEIATDSEDEDSDAEMLPVP----KWAQP 1217

Query: 96   PK--DWLR----LDIALICKDIPDKVFLETLHQD--IMAYIRTVSIKQITGAQGF--RYF 145
             +  + LR    ++   I   I      ET   D  I  +    S    +GA G      
Sbjct: 1218 KELENILRQQEGMEADSIFGPIAPFSLEETFKADKKIKKFRERTSSANWSGADGLTQEEI 1277

Query: 146  KEDIEERVKLRSQG 159
            + D+ ER +LR  G
Sbjct: 1278 RRDLAERQRLRLNG 1291


>gi|146296291|ref|YP_001180062.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409867|gb|ABP66871.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 157

 Score = 34.0 bits (76), Expect = 7.7,   Method: Composition-based stats.
 Identities = 24/150 (16%), Positives = 56/150 (37%), Gaps = 24/150 (16%)

Query: 30  GIFCGWLGGIV-MLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPI 88
           G+  G+L  +  +       K     +      Y   V                     I
Sbjct: 23  GMGIGFLSVMKNLSPTSTTGKAAATVEKKPEKTYTYDVNDGKA----------------I 66

Query: 89  ITNFDSSPKD-----WLRLDIALICKDIPDKVFLETLH-QDIM-AYIRTVSIKQITGAQG 141
           ++N   +  +      + + I +  K +P+++  + +   DI+ + +R+ +  ++   +G
Sbjct: 67  MSNLQDTQNNAGRIIRVTVQIEVTDKKLPEEMKNKNIVISDIIDSVLRSKTADELLEPEG 126

Query: 142 FRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
               +++I+ER+       V +V F  FII
Sbjct: 127 KEKVRKEIKERLNEIFNNKVYNVNFGEFII 156


>gi|258621110|ref|ZP_05716144.1| flagellar basal body-associated protein [Vibrio mimicus VM573]
 gi|258626184|ref|ZP_05721032.1| flagellar basal body-associated protein [Vibrio mimicus VM603]
 gi|262170886|ref|ZP_06038564.1| flagellar biosynthesis protein FliL [Vibrio mimicus MB-451]
 gi|258581539|gb|EEW06440.1| flagellar basal body-associated protein [Vibrio mimicus VM603]
 gi|258586498|gb|EEW11213.1| flagellar basal body-associated protein [Vibrio mimicus VM573]
 gi|261891962|gb|EEY37948.1| flagellar biosynthesis protein FliL [Vibrio mimicus MB-451]
          Length = 166

 Score = 34.0 bits (76), Expect = 7.9,   Method: Composition-based stats.
 Identities = 16/172 (9%), Positives = 51/172 (29%), Gaps = 21/172 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +  +       +  + +   VV   +    G    ++                    
Sbjct: 1   MAEEQLSDAPKGKKKLLIIIIAAVVL--LAGGGGAAFFMMGSG--------------DGE 44

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
               + +      T +     +   QP + N     +D  +++ + L+ +   ++     
Sbjct: 45  AAAQAEQKAEQAATPADPVSYVNIAQPFVFNVTGDDRDRLVQIKVQLMVRGSENENLARY 104

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFR 167
               +   ++A   + +++Q+    G    ++   E +K      V   +  
Sbjct: 105 HSPLVESSLLATFASATVEQLRTPSGRIELRDKATEDIKAALNQAVGKPVIE 156


>gi|262166228|ref|ZP_06033965.1| flagellar biosynthesis protein FliL [Vibrio mimicus VM223]
 gi|262025944|gb|EEY44612.1| flagellar biosynthesis protein FliL [Vibrio mimicus VM223]
          Length = 166

 Score = 33.6 bits (75), Expect = 9.0,   Method: Composition-based stats.
 Identities = 17/172 (9%), Positives = 51/172 (29%), Gaps = 21/172 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +  +       +  + +   VV   +    G    ++                    
Sbjct: 1   MAEEQLSDAPKGKKKLLIIIIAAVVL--LAGGGGAAFFMMGSG--------------DGE 44

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLET 119
               + +      T +     +   QP + N     +D  +++ + L+ +   ++     
Sbjct: 45  AAAQAEQKAEQAATPADPVSYVNIAQPFVFNVTGDDRDRLVQIKVQLMVRGSENENLARY 104

Query: 120 ----LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFR 167
               +   ++A   + +++Q+    G    ++   E +K      V   I  
Sbjct: 105 HSPLVESTLLATFASATVEQLRTPNGRIELRDKATEDIKAALNQAVGKPIIE 156


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.305    0.127    0.323 

Lambda     K      H
   0.267   0.0387    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,731,182,147
Number of Sequences: 14124377
Number of extensions: 100285128
Number of successful extensions: 391708
Number of sequences better than 10.0: 360
Number of HSP's better than 10.0 without gapping: 153
Number of HSP's successfully gapped in prelim test: 280
Number of HSP's that attempted gapping in prelim test: 391284
Number of HSP's gapped (non-prelim): 456
length of query: 172
length of database: 4,842,793,630
effective HSP length: 129
effective length of query: 43
effective length of database: 3,020,748,997
effective search space: 129892206871
effective search space used: 129892206871
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (20.6 bits)
S2: 76 (34.0 bits)