BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780373|ref|YP_003064786.1| flagellar basal
body-associated protein FliL [Candidatus Liberibacter asiaticus str.
psy62]
         (172 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780373|ref|YP_003064786.1| flagellar basal body-associated protein FliL [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040050|gb|ACT56846.1| flagellar basal body-associated protein FliL [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 172

 Score =  120 bits (301), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 172/172 (100%), Positives = 172/172 (100%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN
Sbjct: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
           FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL
Sbjct: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA 172
           HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA
Sbjct: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA 172


>gi|209547933|ref|YP_002279850.1| flagellar basal body-associated protein FliL [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209533689|gb|ACI53624.1| flagellar basal body-associated protein FliL [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 168

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 62/172 (36%), Positives = 96/172 (55%), Gaps = 6/172 (3%)

Query: 1   MSYDDTTS-QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  D ++ Q  + +   + +    V T +G   GW  G ++     G KE +       
Sbjct: 1   MAEPDASAGQPKKKSGTLMMIIGIAVLTLLGAGGGWAVGTIVAPNIKGAKEAE-----QA 55

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
              +   ++      IS +   +  L+PI +N     ++W+RL++AL+    PD    E 
Sbjct: 56  KDAEAKKKAEEGLAHISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSED 115

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +HQDI+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 IHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|118474507|ref|YP_892093.1| flagellar basal body-associated protein FliL [Campylobacter fetus
           subsp. fetus 82-40]
 gi|118413733|gb|ABK82153.1| flagellar basal body-associated protein FliL [Campylobacter fetus
           subsp. fetus 82-40]
          Length = 175

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 61/177 (34%), Gaps = 9/177 (5%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +  T++        + +    V  F+ I    L   +++   + QK E  Q      
Sbjct: 1   MADEAKTTEGGSKKSPVVLIAIVGVLVFLLIIGA-LVAFMLVGSSSEQKMEANQAPNSTQ 59

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-----LRLDIALICKDIPDKV 115
                  S             ++ +   + N  S          L L+++          
Sbjct: 60  QQAAP--SPKQRSNDFFNVGPMYPMDQFLVNLLSESGSRFLKTTLNLELSEQTLSPEIDK 117

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               +   I+  + + + + ++ ++G    K+++  ++  +   G++ +V F  FI+
Sbjct: 118 KKPLIRDIIIRTLSSKTYEDVSTSKGKERLKDELVTKINEILRDGYIKNVYFTDFIV 174


>gi|222147576|ref|YP_002548533.1| flagellar protein [Agrobacterium vitis S4]
 gi|221734564|gb|ACM35527.1| flagellar protein [Agrobacterium vitis S4]
          Length = 172

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 54/171 (31%), Positives = 83/171 (48%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+         +     L +      T +G   GWL G ++       KEE+        
Sbjct: 1   MADAPALEGPSKKASPILLIAALAGLTVVGAGAGWLVGTMVAPKVKVAKEEQKAAEEAGG 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
                 +       +  +   I  L P+ TN     + W+RL++AL+     D    E +
Sbjct: 61  KKKEGEKEETGLPKLPAEANGIVQLDPVTTNLAYPSESWVRLEVALVFNGPVDAKLAEDI 120

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           HQD+MAY+RTVS++QI G +GF Y K+D+ ERV +RS+G VS ++FRTF+I
Sbjct: 121 HQDLMAYMRTVSLQQIEGPRGFDYLKDDLRERVDVRSEGRVSKLLFRTFVI 171


>gi|116250487|ref|YP_766325.1| FliL flagella related protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255135|emb|CAK06209.1| method: conceptual translation supplied by author (flil) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 168

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 61/172 (35%), Positives = 95/172 (55%), Gaps = 6/172 (3%)

Query: 1   MSYDDTTS-QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  D ++ Q  + +   + +    V T +G   GW  G ++     G K     +    
Sbjct: 1   MAEPDASAGQSHKKSGSLMTIIGIAVLTLLGAGGGWAVGTIVAPNIKGAK-----EVEQA 55

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
              +   ++      IS +   +  L+PI +N     ++W+RL++AL+    PD    E 
Sbjct: 56  KDAEAKKKAEEGLARISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSED 115

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +HQDI+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 IHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|307318917|ref|ZP_07598348.1| flagellar basal body-associated protein FliL [Sinorhizobium
           meliloti AK83]
 gi|306895331|gb|EFN26086.1| flagellar basal body-associated protein FliL [Sinorhizobium
           meliloti AK83]
          Length = 163

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 88/168 (52%), Gaps = 7/168 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  S+  +     + +    V T +    GWL G+++            +K        
Sbjct: 2   EEIESKETKAPSRLMTIAAVAVLTLVAGGGGWLAGMLLAPPP-------AEKTEAAAELP 54

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
            +         I+     I  L PI TN     ++W+RL++AL     PD    ET+HQD
Sbjct: 55  ANATGEEDIPKIAAVAHGIVQLDPITTNLAYPAENWVRLEVALQFDGAPDVALAETIHQD 114

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I AY++TVS++QI G +GF+Y ++DI+ERV LRS+G V++V+FRTF+I
Sbjct: 115 IAAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSEGRVTNVMFRTFVI 162


>gi|86356317|ref|YP_468209.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CFN
           42]
 gi|86280419|gb|ABC89482.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CFN
           42]
          Length = 168

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 61/172 (35%), Positives = 96/172 (55%), Gaps = 6/172 (3%)

Query: 1   MSYDDTTS-QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ +D ++ Q  + +   + +    V T +G   GW  G ++     G K     +    
Sbjct: 1   MADEDISAGQSKKKSGPLMTIIGIAVLTLLGAGGGWAVGTIVAPEIKGAK-----EVEQA 55

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
              +   ++      IS +   +  L+PI +N     ++W+RL++AL+    PD    E 
Sbjct: 56  KEAEAKKKAEEGLARISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVAED 115

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +HQDI+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 IHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|241203111|ref|YP_002974207.1| flagellar basal body-associated protein FliL [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857001|gb|ACS54668.1| flagellar basal body-associated protein FliL [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 168

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 61/172 (35%), Positives = 95/172 (55%), Gaps = 6/172 (3%)

Query: 1   MSYDDTTS-QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  D ++ Q  + +   + +    V T +G   GW  G ++     G K     +    
Sbjct: 1   MAEPDASAGQSQKKSGALMTIIGIAVLTLLGAGGGWAVGTIVAPNIKGAK-----EVEQA 55

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
              +   ++      IS +   +  L+PI +N     ++W+RL++AL+    PD    E 
Sbjct: 56  KDAEAKKKAEEGLARISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSED 115

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +HQDI+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 IHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|15964420|ref|NP_384773.1| flagellar transmembrane protein [Sinorhizobium meliloti 1021]
 gi|307311562|ref|ZP_07591203.1| flagellar basal body-associated protein FliL [Sinorhizobium
           meliloti BL225C]
 gi|15073597|emb|CAC45239.1| Flagellar transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306899579|gb|EFN30208.1| flagellar basal body-associated protein FliL [Sinorhizobium
           meliloti BL225C]
          Length = 163

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 92/168 (54%), Gaps = 7/168 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  S+  +     + +    V T +    GWL G ++L     +K E   +   N   +
Sbjct: 2   EEIESKETKAPSRLMTIAAVAVLTLVAGGGGWLAG-MLLAPPPAEKTEIPAELPANATGE 60

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
             +        +S     I  L PI TN     ++W+RL++AL     PD    ET+HQD
Sbjct: 61  EGI------PKMSAVAHGIVQLDPITTNLAYPAENWVRLEVALQFDGAPDVALAETIHQD 114

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I AY++TVS++QI G +GF+Y ++DI+ERV LRS+G V++V+FRTF+I
Sbjct: 115 IAAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSEGRVTNVMFRTFVI 162


>gi|118581836|ref|YP_903086.1| flagellar basal body-associated protein FliL [Pelobacter
           propionicus DSM 2379]
 gi|118504546|gb|ABL01029.1| flagellar basal body-associated protein FliL [Pelobacter
           propionicus DSM 2379]
          Length = 177

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 23/176 (13%), Positives = 62/176 (35%), Gaps = 5/176 (2%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D+  S  + G  +K  +   +      +    +   +++      ++ K  +     
Sbjct: 1   MAKDEQESAEVEGGSNKKKMFIIIGAAVAAVVILGVVAFMLMGKGGSDEKGKEGEAKTEA 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD---IPDKVF 116
             +       T          I+ L+P I N     +  +L++ + +             
Sbjct: 61  KAEGGHGGETTAGKEGAAAANIYPLEPFIVNIYDGQELRYLKVKVEMEMAGSTKGDLDAR 120

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           L  +   I+  + + +++ +   QG    K++I   V  + +   ++ V F  F++
Sbjct: 121 LAPMRDTILVLLSSKTLQDLQDLQGKNQLKDEILVSVNKIITPARITKVYFTDFVV 176


>gi|227820863|ref|YP_002824833.1| putative flagellar basal body-associated protein FliL
           [Sinorhizobium fredii NGR234]
 gi|227339862|gb|ACP24080.1| putative flagellar basal body-associated protein FliL
           [Sinorhizobium fredii NGR234]
          Length = 163

 Score =  104 bits (259), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 89/168 (52%), Gaps = 7/168 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++   +  +     + +    V T +    GWL GI +            +K        
Sbjct: 2   EEIDIKQQKSPSLVMTIAAVAVLTLVAGGGGWLVGIFLAPPP-------AEKAEAVAEVP 54

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
            +         I+ +   I  L+PI TN     ++W+R+++AL  K +PD    E +HQD
Sbjct: 55  ENATGEEGLPKIATEANGIVQLEPITTNLAYPAENWVRVEVALQFKGVPDVALAEEIHQD 114

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I+AY++TVS++QI G +GF+Y ++DI+ERV LRS G V++V+FRTF+I
Sbjct: 115 IIAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSDGRVTNVMFRTFVI 162


>gi|313682720|ref|YP_004060458.1| flagellar basal body-associated protein flil [Sulfuricurvum
           kujiense DSM 16994]
 gi|313155580|gb|ADR34258.1| flagellar basal body-associated protein FliL [Sulfuricurvum
           kujiense DSM 16994]
          Length = 189

 Score =  104 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 61/188 (32%), Gaps = 17/188 (9%)

Query: 1   MSYDD----TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKE------ 50
           M+  +     T +  + + + L +    V   I I  G +  ++M    A  +       
Sbjct: 1   MAEKEKDEHETEEGKKKSGNMLLIIIIGVLALILIIGGIVAFLMMGNHDAEAEAGHAKTE 60

Query: 51  -EKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALIC 108
                                 G  +  +   +F L     N  S   + +L+ +I L  
Sbjct: 61  VAADSHSAEAEHSGEGSGGTPMGGEVMTEVGLMFPLDGFTVNLLSESGRRYLKCEINLEM 120

Query: 109 ----KDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSS 163
                    +         I+  + + S+++I+  +G    KE I   + L    G V +
Sbjct: 121 GGEELSPELEEKKPIFRDIIIRILSSKSLEEISTVKGKEKLKEQIVNELNLRLKDGKVKN 180

Query: 164 VIFRTFII 171
           + F  F++
Sbjct: 181 IYFTDFVV 188


>gi|190890368|ref|YP_001976910.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
 gi|190695647|gb|ACE89732.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
          Length = 168

 Score =  103 bits (257), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 60/172 (34%), Positives = 94/172 (54%), Gaps = 6/172 (3%)

Query: 1   MSYDDTTS-QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  D ++ Q  + +   + +    + T +G   GW  G ++       KE         
Sbjct: 1   MADADLSAGQPKKKSGPLMTIIGVAILTLLGAGGGWAVGTIVAPEIKVAKE-----AEEA 55

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
              +   ++      IS +   +  L+PI +N     ++W+RL++AL+    PD    E 
Sbjct: 56  KDAEAKKKAEEGLAHISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVAED 115

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +HQDI+AYIRTVS++QI G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 IHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 167


>gi|34558258|ref|NP_908073.1| flagellar basal body-associated protein FliL [Wolinella
           succinogenes DSM 1740]
 gi|34483977|emb|CAE10973.1| HYPOTHETICAL PROTEIN-Flagellar basal body associated protein
           [Wolinella succinogenes]
          Length = 178

 Score =  103 bits (257), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 27/177 (15%), Positives = 67/177 (37%), Gaps = 6/177 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++  +    G ++KL +        + +  G +    ML      +    Q     +
Sbjct: 1   MADENKETAQAEGKKNKLIIFIIAGVIALLLIIGGVVVYFMLSSNPEPQAASAQASQSTS 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD-SSPKDWLRLDIALICKDI----PDKV 115
               +  +  +G    L    +++L   I N    S + +L+  I +             
Sbjct: 61  GGAKAGGASRSGGGNFLSVGPMYALDQFIVNLTTQSGRRYLKTSINVELSQPNLTAELDT 120

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               +   +++ + + SI++I+  +G    KE++ ER+      G + ++ F  F++
Sbjct: 121 KRAVIRDTVISILSSKSIEEISTMKGKEKLKEELIERLNEFLVDGRIVNLFFTDFVV 177


>gi|154174846|ref|YP_001408107.1| flagellar basal body-associated protein FliL [Campylobacter curvus
           525.92]
 gi|153793137|gb|EAT99397.2| flagellar basal body-associated protein FliL [Campylobacter curvus
           525.92]
          Length = 179

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 25/178 (14%), Positives = 65/178 (36%), Gaps = 7/178 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFL-FAGQKEEKYQKFILN 59
           M+ +    Q  +G    L +    +   + +  G +  +++           + Q  +  
Sbjct: 1   MADEIEEKQTKKGGSSALIIIIVAMLVLLLVVGGLVAFLLLGNDESHDASMAQPQAQVQQ 60

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKD----IPDK 114
           +    S +     +        I+ L   I N    +   +L+  I L   D        
Sbjct: 61  SAPAKSAKPASKRNNDYANMGPIYPLDQFIVNLLSENGSRFLKTKIDLEQSDELLTPELD 120

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
                L   I+  + + + ++++ A+G    K++I  ++  + S G++ ++ F  F++
Sbjct: 121 KKKALLRDIIIRTLSSKTYEEVSTAKGKDRLKDEIVGKLNEVLSDGYIKNIYFTDFVV 178


>gi|2275166|gb|AAB81418.1| FliL [Sinorhizobium meliloti]
          Length = 163

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 51/168 (30%), Positives = 86/168 (51%), Gaps = 7/168 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  S+  +     + +    V T +    GWL G ++L     +K E   +   N   +
Sbjct: 2   EEIESKETKATSRLMTIAAVAVLTLVAGGGGWLAG-MLLAPPPSEKTETAAELPANATGE 60

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
             +  +      +      +    +          W+RL++AL     PD    ET+HQD
Sbjct: 61  EDIPKMSAVGHTARAARSDYDEPCLSAEN------WVRLEVALQFDGAPDVALAETIHQD 114

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I AY++TVS++QI G +GF+Y ++DI+ERV LRS+G V++V+FRTF+I
Sbjct: 115 IAAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSEGRVTNVMFRTFVI 162


>gi|157165347|ref|YP_001466934.1| flagellar basal body-associated protein FliL [Campylobacter
           concisus 13826]
 gi|112799969|gb|EAT97313.1| flagellar basal body-associated protein FliL [Campylobacter
           concisus 13826]
          Length = 178

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 21/177 (11%), Positives = 60/177 (33%), Gaps = 6/177 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +    +  +G    L +    ++  + +  G +  +++      +            
Sbjct: 1   MAEEVEEKKAKKGGNGALMIIIIAIFVLLLVIGGLVAFLMLSSDEPKEANMAQTPAQTQT 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDI----PDKV 115
               +      G         I+ L   + N    +   +L+  I L   D         
Sbjct: 61  QPAPAQNKAKRGGNDYSNMGPIYPLDQFVVNLLSENGSRFLKTKIDLEQSDELLTAELDK 120

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
               L   I+  + + + ++++ A+G    K++I  ++      G++ ++ F  F++
Sbjct: 121 KKALLRDIIIRTLSSKTYEEVSTAKGKDRLKDEIVGKLNEVLNDGYIKNIFFTDFVV 177


>gi|218679633|ref|ZP_03527530.1| orfc; method: conceptual translation supplied by author (flil)
           [Rhizobium etli CIAT 894]
          Length = 150

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 60/154 (38%), Positives = 88/154 (57%), Gaps = 5/154 (3%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           + +    V T +G   GW  G ++     G KE +          +   ++      IS 
Sbjct: 1   MTIIGIAVLTLLGAGGGWAVGTIVAPNIKGAKEAE-----QAKDAEAKKKAEEGLARIST 55

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQIT 137
           +   I  L+PI +N     ++W+RL++AL+    PD    E +HQDI+AYIRTVS++QI 
Sbjct: 56  EANNIVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSEDIHQDILAYIRTVSLQQIE 115

Query: 138 GAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 GPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 149


>gi|255322747|ref|ZP_05363891.1| flagellar basal body-associated protein FliL [Campylobacter showae
           RM3277]
 gi|255300308|gb|EET79581.1| flagellar basal body-associated protein FliL [Campylobacter showae
           RM3277]
          Length = 177

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 65/177 (36%), Gaps = 7/177 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ + + +Q  +GN   L     V+   + +  G L  ++M       + +  Q      
Sbjct: 1   MAEEISENQGKKGNGLVLI-IIIVILLLLLVVGGLLAFLLMGGNEENAQAQTAQVQTEQV 59

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKD----IPDKV 115
                  +        +    ++ L   I N  S     +L+  + L             
Sbjct: 60  QAAAPKNTAGKRSNDYVNMGPVYPLDQFIVNLLSESGSRYLKTKVDLELSADTLTPEIDK 119

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               +   +++ + + + ++++  +G    K++I +R+  + + G + ++ F  F++
Sbjct: 120 KKPLIRDIVVSTLSSKTYEEVSTQKGKNRLKDEIVDRLNEVLADGHIKNIYFTDFVV 176


>gi|317151984|ref|YP_004120032.1| flagellar basal body-associated protein FliL [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316942235|gb|ADU61286.1| flagellar basal body-associated protein FliL [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 165

 Score =  101 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 18/177 (10%), Positives = 60/177 (33%), Gaps = 19/177 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D   +  +G + K ++   V    +G+   +   + +                   
Sbjct: 1   MADEDLVQEGKKGGKLK-WIIIAVALIVLGVGGYFGYTMFL------------AAPDEAQ 47

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDIPDK----V 115
             ++       G      + ++  L   + N      + +L+L + +  +D   +     
Sbjct: 48  TAESGAGEEGAGVPTESLEGKLVPLPMFLVNLADPLGRRYLKLGMEVEVRDEKAEQALLK 107

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +   +   ++    + +   ++  +     K++I +R+  +  +G +  V     +I
Sbjct: 108 YEAKIKDTLLLLFSSKTYDDLSTMKAKVELKQEIVDRLNQIVGKGAILRVYITEMVI 164


>gi|163758020|ref|ZP_02165108.1| flagellar biosynthesis transmembrane protein [Hoeflea phototrophica
           DFL-43]
 gi|162284309|gb|EDQ34592.1| flagellar biosynthesis transmembrane protein [Hoeflea phototrophica
           DFL-43]
          Length = 171

 Score =  100 bits (249), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 48/171 (28%), Positives = 90/171 (52%), Gaps = 1/171 (0%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   +     +  L VT  VV    G+  G    +  +       EE+       +
Sbjct: 1   MADNEDQEEEQGKKKSGLIVTIAVVLVLSGLAGGGGWVVGGMIAPQVAVEEEAAVEAEES 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
             + +            ++  +  L PI TN     + W+R++++L+    PD+   + +
Sbjct: 61  GEEGAEAEKDEEAGNKSRE-NVLPLDPITTNLSYPSESWIRIEVSLLFGGAPDQALADQI 119

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           HQD+++Y+RTVS++QI G +GF+Y ++D+ ERV+LRS+G V+ ++FRTF+I
Sbjct: 120 HQDVLSYLRTVSLQQIDGPRGFQYLRDDLRERVRLRSEGRVNDILFRTFVI 170


>gi|218670414|ref|ZP_03520085.1| flagellar biosynthesis transmembrane protein [Rhizobium etli GR56]
          Length = 150

 Score = 99.1 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/154 (37%), Positives = 88/154 (57%), Gaps = 5/154 (3%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           + +    + T +G   GW  G ++     G KE +          +   ++      IS 
Sbjct: 1   MTIMGVAILTLLGAGGGWAVGTIVAPEIKGAKEAE-----QAKDAEAKKKAEEGLARIST 55

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQIT 137
           +   +  L+PI +N     ++W+RL++AL+    PD    E +HQDI+AYIRTVS++QI 
Sbjct: 56  EANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSEDIHQDILAYIRTVSLQQIE 115

Query: 138 GAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 116 GPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 149


>gi|322421725|ref|YP_004200948.1| flagellar basal body-associated protein FliL [Geobacter sp. M18]
 gi|320128112|gb|ADW15672.1| flagellar basal body-associated protein FliL [Geobacter sp. M18]
          Length = 174

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 56/176 (31%), Gaps = 8/176 (4%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+      +    N  KLF+    V   + I          +     +K  +  K     
Sbjct: 1   MAEPAKAQETPEKNNKKLFIIIGAVVGVLAIGG---AAAFFMGGSKKEKAPEGAKVEAKA 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI----PDKVF 116
              +   +       ++          I+  +D     +L+L +     +          
Sbjct: 58  EGGHGAPAKEGEGGAAVGGTIYPLEPFIVNIYDGQELRYLKLKVEFEMANPQAKGELDAK 117

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
           +  L   I+  + T ++++I   QG    +E I   V K+     ++ V F  F++
Sbjct: 118 MAPLRDAILILLTTKTMQEIQDLQGKNQLREQILAAVSKVVPPSKITKVYFTDFVV 173


>gi|78358625|ref|YP_390074.1| flagellar protein FliL [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78221030|gb|ABB40379.1| flagellar protein FliL [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 158

 Score = 97.9 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 21/177 (11%), Positives = 54/177 (30%), Gaps = 26/177 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ + T  Q  +G + K ++   VV   +     +             + ++  K     
Sbjct: 1   MAEEKT--QEKKGGKLK-WIIMIVVLLLLAGGGAFAYFTFFAGSSDPAQTDQTTKAEE-- 55

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALIC----KDIPDKV 115
                            K +Q+ +L   + N      + +L++ + +             
Sbjct: 56  ---------------VPKDVQVVTLPTFLVNLSDPLGRRYLKMTLDVEVINPKVAEELNK 100

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               +   ++  + + S   +   +     K +I +R+  +     V  V F   +I
Sbjct: 101 STARVQDAMILLLSSKSYADLAPLENKLLLKNEIVDRLNQILGGSKVRQVYFTEMVI 157


>gi|222084870|ref|YP_002543399.1| flagellar biosynthesis transmembrane protein [Agrobacterium
           radiobacter K84]
 gi|221722318|gb|ACM25474.1| flagellar biosynthesis transmembrane protein [Agrobacterium
           radiobacter K84]
          Length = 164

 Score = 97.5 bits (241), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 54/171 (31%), Positives = 88/171 (51%), Gaps = 8/171 (4%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     S   +G+   + +   +  T +G   GW  G ++                   
Sbjct: 1   MAEAADASANSKGSPLVMTIVGLLALTVLGGGGGWFLGTIVAPKIKAATAAVQAATQTTG 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
               ++          L+   I  L PIITN     ++W+RL+IAL+ K  PD    + +
Sbjct: 61  DEKQAIA--------PLESSNIVQLDPIITNLGYPSQNWIRLEIALVFKGQPDAQLAQAI 112

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           H+D++AY+RTVS++QI G +G +Y ++D++ERV LRS+G VS V+FRTF+I
Sbjct: 113 HEDVLAYVRTVSLQQIEGPRGLQYLRDDLQERVDLRSEGRVSKVMFRTFVI 163


>gi|56695123|ref|YP_165470.1| flagellar basal body-associated protein FliL [Ruegeria pomeroyi
           DSS-3]
 gi|56676860|gb|AAV93526.1| flagellar basal body-associated protein FliL [Ruegeria pomeroyi
           DSS-3]
          Length = 168

 Score = 97.5 bits (241), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 19/175 (10%), Positives = 50/175 (28%), Gaps = 12/175 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+              K  +   +V   +G   G+   +  L     Q  E+        
Sbjct: 1   MTDATADEVEPEKKSGKKGLIVGLVLALVGAGGGFYATVSGLIPLGAQPAEE-------- 52

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFL 117
             ++                 +     +++      +  LR    L   +      +   
Sbjct: 53  HGESGGDHGAVVPDALPNVAYVDLQPIMVSLLGEGGQRHLRFHAQLEVPEQYLADVEKIR 112

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
             +   +  Y+R + I  ++        +  ++ R+ +   +G V  V+   F++
Sbjct: 113 PRIVDVLNGYLRAIEISDLSDPLALTRLRGHMQRRINIVAGEGRVKDVLVMEFVL 167


>gi|237752089|ref|ZP_04582569.1| flagellar basal body-associated protein FliL [Helicobacter
           winghamensis ATCC BAA-430]
 gi|229376656|gb|EEO26747.1| flagellar basal body-associated protein FliL [Helicobacter
           winghamensis ATCC BAA-430]
          Length = 178

 Score = 97.5 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 72/179 (40%), Gaps = 10/179 (5%)

Query: 1   MSYDDTTSQYIRG-NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ ++     + G  Q+K+ +   +    + +    + GI++     G + E+       
Sbjct: 1   MAEEEKKPSKLEGLKQNKMILFIIIGVVALLLIIFIVVGILIFS--GGNESEQAGVAPQT 58

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF--DSSPKDWLR----LDIALICKDIPD 113
                +  S    ++  L    ++ L   I N       K +L+    L++++       
Sbjct: 59  QQSAANKGSTANPNSSLLSVGPMYPLDQFIVNLLASGGGKRYLKTSIALELSIPEMQAEL 118

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            +  + L   ++  + + + +++  A+G +  KE++ ER+      G V ++ F  F++
Sbjct: 119 DIKRDVLRDTVITILSSKTFEEVQTAKGKQKLKEEMMERINEFLVDGRVVNMFFTEFVV 177


>gi|302037614|ref|YP_003797936.1| flagellar basal body-associated protein FliL [Candidatus Nitrospira
           defluvii]
 gi|300605678|emb|CBK42011.1| Flagellar basal body-associated protein FliL [Candidatus Nitrospira
           defluvii]
          Length = 178

 Score = 97.2 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/177 (14%), Positives = 52/177 (29%), Gaps = 6/177 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS               + +   +V   + +  G    +  +   A  ++   +      
Sbjct: 1   MSEAAEEKAPAAPAGIPMKMVIIIVAGVLVLGLGGAFAMFKMMGGASGEKAHGENGGEKQ 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKV 115
                      G         I  L P I N   +P+  +L++ + +   +       K 
Sbjct: 61  AAHGEAEDKGGGHGAVADASAIADLDPFIVNLADTPEIRYLKVTLKVEADNSNTVEQIKA 120

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-VSSVIFRTFII 171
               +   I+  +  +        QG    +EDI +R+        V S  F  F+I
Sbjct: 121 RTPQIRDAILVLLTGLDSATARSPQGKHKLREDITDRINGLLPKKSVKSTYFTEFVI 177


>gi|222823312|ref|YP_002574885.1| flagellar basal body-associated protein FliL [Campylobacter lari
           RM2100]
 gi|222538533|gb|ACM63634.1| flagellar basal body-associated protein FliL [Campylobacter lari
           RM2100]
          Length = 183

 Score = 96.8 bits (239), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 19/183 (10%), Positives = 65/183 (35%), Gaps = 11/183 (6%)

Query: 1   MSYD---DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ D   +      +G    + +    ++ F+ +  G +  ++           + ++  
Sbjct: 1   MADDMIDEQGESKKKGGNTLVIIIVVFLFVFLLVIVGAIAYLMFSGNSEENPAPQEEQQA 60

Query: 58  LNNFYDNSVR--SVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-----LRLDIALICKD 110
                    +  SV    +       ++ L P   N  S          ++L+  +    
Sbjct: 61  QQATTPAPKKTNSVAARGSDYANIGVMYPLAPFTLNLLSDGGARYVKCTIQLEQNVETLT 120

Query: 111 IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
                    +   I+  + + + ++++  +G    K+++  ++  + + GF+ ++ F  F
Sbjct: 121 PELDKKSAIIRDIIIRTLTSKTFEEVSTTKGKERLKDELTGKINEVLTDGFIKNIYFTDF 180

Query: 170 IIA 172
           +++
Sbjct: 181 VVS 183


>gi|15642126|ref|NP_231758.1| flagellar basal body-associated protein FliL [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|147673204|ref|YP_001217649.1| flagellar basal body-associated protein FliL [Vibrio cholerae O395]
 gi|153803036|ref|ZP_01957622.1| flagellar protein FliL, putative [Vibrio cholerae MZO-3]
 gi|153818970|ref|ZP_01971637.1| flagellar protein FliL, putative [Vibrio cholerae NCTC 8457]
 gi|153822902|ref|ZP_01975569.1| flagellar protein FliL, putative [Vibrio cholerae B33]
 gi|153828598|ref|ZP_01981265.1| putative flagellar protein FliL [Vibrio cholerae 623-39]
 gi|227082252|ref|YP_002810803.1| putative flagellar protein FliL [Vibrio cholerae M66-2]
 gi|229507788|ref|ZP_04397293.1| flagellar biosynthesis protein FliL [Vibrio cholerae BX 330286]
 gi|229511975|ref|ZP_04401454.1| flagellar biosynthesis protein FliL [Vibrio cholerae B33]
 gi|229519111|ref|ZP_04408554.1| flagellar biosynthesis protein FliL [Vibrio cholerae RC9]
 gi|229522080|ref|ZP_04411497.1| flagellar biosynthesis protein FliL [Vibrio cholerae TM 11079-80]
 gi|229524129|ref|ZP_04413534.1| flagellar biosynthesis protein FliL [Vibrio cholerae bv. albensis
           VL426]
 gi|229607333|ref|YP_002877981.1| flagellar basal body-associated protein FliL [Vibrio cholerae
           MJ-1236]
 gi|254849212|ref|ZP_05238562.1| flagellar basal body-associated protein FliL [Vibrio cholerae MO10]
 gi|255745134|ref|ZP_05419083.1| flagellar biosynthesis protein FliL [Vibrio cholera CIRS 101]
 gi|262153476|ref|ZP_06028606.1| flagellar biosynthesis protein FliL [Vibrio cholerae INDRE 91/1]
 gi|262167486|ref|ZP_06035192.1| flagellar biosynthesis protein FliL [Vibrio cholerae RC27]
 gi|297582025|ref|ZP_06943944.1| flagellar basal body-associated protein FliL [Vibrio cholerae
           RC385]
 gi|298497851|ref|ZP_07007658.1| flagellar basal body-associated protein FliL [Vibrio cholerae MAK
           757]
 gi|9656677|gb|AAF95272.1| flagellar protein FliL, putative [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|124121434|gb|EAY40177.1| flagellar protein FliL, putative [Vibrio cholerae MZO-3]
 gi|126510465|gb|EAZ73059.1| flagellar protein FliL, putative [Vibrio cholerae NCTC 8457]
 gi|126519598|gb|EAZ76821.1| flagellar protein FliL, putative [Vibrio cholerae B33]
 gi|146315087|gb|ABQ19626.1| putative flagellar protein FliL [Vibrio cholerae O395]
 gi|148875869|gb|EDL74004.1| putative flagellar protein FliL [Vibrio cholerae 623-39]
 gi|227010140|gb|ACP06352.1| putative flagellar protein FliL [Vibrio cholerae M66-2]
 gi|227014023|gb|ACP10233.1| putative flagellar protein FliL [Vibrio cholerae O395]
 gi|229337710|gb|EEO02727.1| flagellar biosynthesis protein FliL [Vibrio cholerae bv. albensis
           VL426]
 gi|229341005|gb|EEO06010.1| flagellar biosynthesis protein FliL [Vibrio cholerae TM 11079-80]
 gi|229343800|gb|EEO08775.1| flagellar biosynthesis protein FliL [Vibrio cholerae RC9]
 gi|229351940|gb|EEO16881.1| flagellar biosynthesis protein FliL [Vibrio cholerae B33]
 gi|229355293|gb|EEO20214.1| flagellar biosynthesis protein FliL [Vibrio cholerae BX 330286]
 gi|229369988|gb|ACQ60411.1| flagellar biosynthesis protein FliL [Vibrio cholerae MJ-1236]
 gi|254844917|gb|EET23331.1| flagellar basal body-associated protein FliL [Vibrio cholerae MO10]
 gi|255736964|gb|EET92360.1| flagellar biosynthesis protein FliL [Vibrio cholera CIRS 101]
 gi|262024058|gb|EEY42753.1| flagellar biosynthesis protein FliL [Vibrio cholerae RC27]
 gi|262030713|gb|EEY49347.1| flagellar biosynthesis protein FliL [Vibrio cholerae INDRE 91/1]
 gi|297533720|gb|EFH72562.1| flagellar basal body-associated protein FliL [Vibrio cholerae
           RC385]
 gi|297542184|gb|EFH78234.1| flagellar basal body-associated protein FliL [Vibrio cholerae MAK
           757]
          Length = 167

 Score = 96.8 bits (239), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 58/181 (32%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D  ++  +G +  L +    V    G          M+     +     ++     
Sbjct: 1   MAEEDLGTEAPKGKKKLLIIIIAAVVLLAGGGG---AAFFMMGSGGDEAAADAEQKTEQV 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                          +     +   QP + N    +    +++ + L+ +   ++     
Sbjct: 58  AAP------------TDPVSYVNIAQPFVFNVTGDAKDRLVQIKVQLMVRGSENENLARY 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++A   + +++Q+    G    ++   + +     +   +  +  V+F  F+
Sbjct: 106 HSPLVESSLLATFASATVEQLRTPNGRIELRDKATDDIKAALNQAVGKPVIEKVLFTDFV 165

Query: 171 I 171
           +
Sbjct: 166 M 166


>gi|229528861|ref|ZP_04418251.1| flagellar biosynthesis protein FliL [Vibrio cholerae 12129(1)]
 gi|229332635|gb|EEN98121.1| flagellar biosynthesis protein FliL [Vibrio cholerae 12129(1)]
 gi|327484655|gb|AEA79062.1| Flagellar biosynthesis protein FliL [Vibrio cholerae LMA3894-4]
          Length = 167

 Score = 96.8 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 58/181 (32%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D  ++  +G +  L +    V    G          M+     +     ++     
Sbjct: 1   MAEEDLGTEAPKGKKKLLIIIIAAVVLLAGGGG---AAFFMMGSGDDEAAADAEQKTEQV 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                          +     +   QP + N    +    +++ + L+ +   ++     
Sbjct: 58  AAP------------TDPVSYVNIAQPFVFNVTGDAKDRLVQIKVQLMVRGSENENLARY 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++A   + +++Q+    G    ++   + +     +   +  +  V+F  F+
Sbjct: 106 HSPLVESSLLATFASATVEQLRTPNGRIELRDKATDDIKAALNQAVGKPVIEKVLFTDFV 165

Query: 171 I 171
           +
Sbjct: 166 M 166


>gi|117926843|ref|YP_867460.1| flagellar basal body-associated protein FliL [Magnetococcus sp.
           MC-1]
 gi|117610599|gb|ABK46054.1| flagellar basal body-associated protein FliL [Magnetococcus sp.
           MC-1]
          Length = 166

 Score = 96.4 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/177 (16%), Positives = 63/177 (35%), Gaps = 18/177 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ + T  Q   G    + +   VV   IG+  G+  G ++      ++++         
Sbjct: 1   MAEEGTQEQEGGGGGGLMKIIIPVVALLIGVGGGYFLGDMLASKSVEEQKQAEPTETKK- 59

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD-SSPKDWLRLDIALICKD----IPDKV 115
                       + I      +F L+  + N +      +L+  I L           + 
Sbjct: 60  -----------PEDIRAMVGDVFPLEDFLVNLNEGRGNRYLKATIELELDTEELRPEVER 108

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
               +   I++ + + S K++  ++G    +E+I  R+      G V  V F  F+I
Sbjct: 109 RQPQIRDVILSLLGSKSAKELMDSEGKFRLREEILSRINAVLVNGNVKRVYFTAFVI 165


>gi|119503671|ref|ZP_01625754.1| Flagellar basal body-associated protein [marine gamma
           proteobacterium HTCC2080]
 gi|119460733|gb|EAW41825.1| Flagellar basal body-associated protein [marine gamma
           proteobacterium HTCC2080]
          Length = 186

 Score = 96.0 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 56/179 (31%), Gaps = 14/179 (7%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           S D+  S+   G + KL +        +GI  G    +  +        E  + +     
Sbjct: 12  SEDEEPSEGSSGGKRKLILLIVGAILLLGIGIGAGFFVGNMTADEPDSAESAEVYEEEGE 71

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----IPDKVFL 117
            D+  +       I +   ++     +     +    +++ ++ L+  +       +  +
Sbjct: 72  EDSDRKKKDDRHNIYITVGKL-----LAAVEHNGSTRYIQAEVDLVGYEKSVMDDAQHNV 126

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-----GFVSSVIFRTFII 171
             L   ++    + +   +    G    + +  + V    +       V  V F  F+I
Sbjct: 127 PALRNRLLLLFSSQNFDDVRTIAGRERLRVESLKAVNDVLELGPKGDRVEDVYFTAFVI 185


>gi|150395490|ref|YP_001325957.1| flagellar basal body-associated protein FliL [Sinorhizobium medicae
           WSM419]
 gi|150027005|gb|ABR59122.1| flagellar basal body-associated protein FliL [Sinorhizobium medicae
           WSM419]
          Length = 163

 Score = 96.0 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 88/168 (52%), Gaps = 7/168 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  S+  +     + +      T +    GWL G+++            +K        
Sbjct: 2   EEIESKETKSPSRVMTIAAVAALTLVAGGGGWLAGMLLAPP-------AAEKTEAAVELP 54

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
            +         I+     I  L PI TN     ++W+RL++AL    +PD    ET+HQD
Sbjct: 55  ANATGEEEIARIATVANGIVQLDPITTNLAYPAENWVRLEVALQFNGVPDVALAETIHQD 114

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I AY++TVS++Q+ G +GF+Y ++DI+ERV LRS+G V+SV+FRTF+I
Sbjct: 115 IAAYLKTVSLQQVQGPRGFQYLRDDIQERVDLRSEGRVTSVMFRTFVI 162


>gi|223040577|ref|ZP_03610848.1| flagellar basal body-associated protein FliL [Campylobacter rectus
           RM3267]
 gi|222878125|gb|EEF13235.1| flagellar basal body-associated protein FliL [Campylobacter rectus
           RM3267]
          Length = 174

 Score = 96.0 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/177 (11%), Positives = 63/177 (35%), Gaps = 10/177 (5%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +       +     + +   V+   + +  G L  ++M       + +         
Sbjct: 1   MAEE----AQGKKGGSLVLIIIIVILILLLVVGGLLAFLLMSGNDDAMQAQAMHSQTEQV 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDI----PDKV 115
               S  ++    +  +    I+ L   I N    S   +L+  + L             
Sbjct: 57  QTPMSKNTMGKRSSDYINMGPIYPLDQFIVNLLSDSGSRYLKTKVDLELSAESLTSEIDK 116

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               +   I++ + + + ++++  +G    K++I +R+  + + G + ++ F  F++
Sbjct: 117 KKPLVRDIIVSTLSSKTYEEVSTQKGKNRLKDEIVDRLNEVLADGHIKNIYFTDFVV 173


>gi|57505268|ref|ZP_00371197.1| probable flagellar protein Cj1408 [Campylobacter upsaliensis
           RM3195]
 gi|57016404|gb|EAL53189.1| probable flagellar protein Cj1408 [Campylobacter upsaliensis
           RM3195]
          Length = 178

 Score = 96.0 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 19/178 (10%), Positives = 60/178 (33%), Gaps = 6/178 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M  +   ++  +     L +   VV   + +        ++      +            
Sbjct: 1   MEEEVENTEGKKKKSGSLVIIIVVVLFVLLLTIMGFIAYLLTSTSNDEGAVTEAPKEEAK 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDI----PDKV 115
               + ++     +       ++ L P   N    S   +++  I L             
Sbjct: 61  PAAKTSQASTQRGSDYANIGPMYPLDPFTLNLLSDSGSRYVKCTIELEQNSELLKTELDK 120

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
            +  +   I+  +   + ++I+ ++G    K+++  ++  + + GF+ +V F  F+++
Sbjct: 121 KVAIIRDVIIRTLTAKTFEEISTSKGKERLKDELVGKINEILTDGFIKNVYFTDFVVS 178


>gi|229513778|ref|ZP_04403240.1| flagellar biosynthesis protein FliL [Vibrio cholerae TMA 21]
 gi|229348959|gb|EEO13916.1| flagellar biosynthesis protein FliL [Vibrio cholerae TMA 21]
          Length = 167

 Score = 96.0 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 58/181 (32%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D  ++  +G +  L +    V    G          M+     +     ++     
Sbjct: 1   MAEEDLGTEAPKGKKKLLIIIIAAVVLLAGGGG---AAFFMMGSGDDEAVADAEQKTEQV 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                          +     +   QP + N    +    +++ + L+ +   ++     
Sbjct: 58  AAP------------TDPVSYVNIAQPFVFNVTGDAKDRLVQIKVQLMVRGSENENLARY 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++A   + +++Q+    G    ++   + +     +   +  +  V+F  F+
Sbjct: 106 HSPLVESSLLATFASATVEQLRTPNGRIELRDKATDDIKAALNQAVGKPVIEKVLFTDFV 165

Query: 171 I 171
           +
Sbjct: 166 M 166


>gi|28899017|ref|NP_798622.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153836968|ref|ZP_01989635.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|153840526|ref|ZP_01993193.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|153841426|ref|ZP_01993403.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|260365237|ref|ZP_05777794.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus K5030]
 gi|260878787|ref|ZP_05891142.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AN-5034]
 gi|260897382|ref|ZP_05905878.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus Peru-466]
 gi|260899941|ref|ZP_05908336.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ4037]
 gi|4322003|gb|AAD15906.1| polar flagellar protein FliL [Vibrio parahaemolyticus]
 gi|28807236|dbj|BAC60506.1| polar flagellar protein FliL [Vibrio parahaemolyticus RIMD 2210633]
 gi|149745479|gb|EDM56730.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|149745810|gb|EDM56940.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|149749741|gb|EDM60486.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|308088284|gb|EFO37979.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus Peru-466]
 gi|308094199|gb|EFO43894.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AN-5034]
 gi|308107277|gb|EFO44817.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ4037]
 gi|308115425|gb|EFO52965.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus K5030]
 gi|328474446|gb|EGF45251.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus 10329]
          Length = 167

 Score = 96.0 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 56/181 (30%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +          + KL +    V   +G          ++      +  + +      
Sbjct: 1   MAEEQLQGADAPKGKSKLLIIIIAVVVLLGGGG--AAAFFLMGSDDSAQAAEAESQQTQA 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV---- 115
              N +               +   QP I N     +   +++   L+ +   ++     
Sbjct: 59  AAANPIA-------------YVNLPQPFIFNVTGDRRDRLVQIKAQLMVRGSENEQLARY 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFK----EDIEERVK-LRSQGFVSSVIFRTFI 170
               +   +++   + +++Q+    G    +    EDI+  +     +  +  V+F  F+
Sbjct: 106 HSPLVESSLLSTFASATVEQLRSPTGRVELRDRASEDIKAALNAAVGKPVIEKVLFTDFV 165

Query: 171 I 171
           I
Sbjct: 166 I 166


>gi|262404473|ref|ZP_06081028.1| flagellar biosynthesis protein FliL [Vibrio sp. RC586]
 gi|262349505|gb|EEY98643.1| flagellar biosynthesis protein FliL [Vibrio sp. RC586]
          Length = 167

 Score = 95.6 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 57/181 (31%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++  +   +G +  L +    V    G          M+    G+   + ++     
Sbjct: 1   MAEEEQAADAPKGKKKLLIIIIAAVVLLAGGGG---AAFFMMGSGDGEAAAQAEQKTEQA 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                                +   QP + N         +++ + L+ +   ++     
Sbjct: 58  ATPAD------------PVSYVNIAQPFVFNVTGDEKDRLVQIKVQLMVRGSENENLARY 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++A   + +++Q+    G    ++   + +     +   +  +  V+F  F+
Sbjct: 106 HSPLVESTLLATFASATVEQLRTPNGRIELRDKATDDIKAALNQAVGKPIIEKVLFTDFV 165

Query: 171 I 171
           +
Sbjct: 166 M 166


>gi|163738047|ref|ZP_02145463.1| flagellar basal body-associated protein FliL [Phaeobacter
           gallaeciensis BS107]
 gi|163742557|ref|ZP_02149943.1| flagellar basal body-associated protein FliL [Phaeobacter
           gallaeciensis 2.10]
 gi|161384142|gb|EDQ08525.1| flagellar basal body-associated protein FliL [Phaeobacter
           gallaeciensis 2.10]
 gi|161388663|gb|EDQ13016.1| flagellar basal body-associated protein FliL [Phaeobacter
           gallaeciensis BS107]
          Length = 174

 Score = 95.6 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/172 (13%), Positives = 59/172 (34%), Gaps = 11/172 (6%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
            T Q     + KL +   VV   +G   G+      L  F     +      ++      
Sbjct: 7   DTEQDAPAKKSKLPLIIGVVLALVGAGGGFFAVQSGLLPFG----QSAAPEGVDATEVAP 62

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSP-----KDWLRLDIALICKDIPDKVFLETL 120
               +      +  L    ++PI+     +      +   +L++ L  +    +  L  +
Sbjct: 63  EGVDNGESAEDIANLAFIEMEPIVITLRKASGLKHLRFRSQLEVDLAHRA-EVEKILPRV 121

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
              + +Y+R + ++ +T        +  +  R+ +   QG V  ++   F++
Sbjct: 122 VDVLNSYLRALELEDLTDPMALPKLRAQMLRRINIAAGQGRVRDLLIMDFVL 173


>gi|121586822|ref|ZP_01676604.1| flagellar protein FliL, putative [Vibrio cholerae 2740-80]
 gi|121727185|ref|ZP_01680352.1| flagellar protein FliL, putative [Vibrio cholerae V52]
 gi|153213254|ref|ZP_01948666.1| flagellar protein FliL, putative [Vibrio cholerae 1587]
 gi|153825619|ref|ZP_01978286.1| flagellar protein FliL, putative [Vibrio cholerae MZO-2]
 gi|254291363|ref|ZP_04962156.1| flagellar protein FliL, putative [Vibrio cholerae AM-19226]
 gi|262191376|ref|ZP_06049566.1| flagellar biosynthesis protein FliL [Vibrio cholerae CT 5369-93]
 gi|121548989|gb|EAX59028.1| flagellar protein FliL, putative [Vibrio cholerae 2740-80]
 gi|121630430|gb|EAX62823.1| flagellar protein FliL, putative [Vibrio cholerae V52]
 gi|124116054|gb|EAY34874.1| flagellar protein FliL, putative [Vibrio cholerae 1587]
 gi|149740770|gb|EDM54869.1| flagellar protein FliL, putative [Vibrio cholerae MZO-2]
 gi|150422693|gb|EDN14647.1| flagellar protein FliL, putative [Vibrio cholerae AM-19226]
 gi|262032751|gb|EEY51299.1| flagellar biosynthesis protein FliL [Vibrio cholerae CT 5369-93]
          Length = 167

 Score = 95.6 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 58/181 (32%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D  ++  +G +  L +    V    G          M+     +     ++     
Sbjct: 1   MAEEDLGTEAPKGKKKLLIIIIAAVVLLAGGGG---AAFFMMGSGGEEAAADAEQKTEQV 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                          +     +   QP + N    +    +++ + L+ +   ++     
Sbjct: 58  AAP------------TDPVSYVNIAQPFVFNVTGDAKDRLVQIKVQLMVRGSENENLARY 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++A   + +++Q+    G    ++   + +     +   +  +  V+F  F+
Sbjct: 106 HSPLVESSLLATFASATVEQLRTPNGRIELRDKATDDIKAALNQAVGKPVIEKVLFTDFV 165

Query: 171 I 171
           +
Sbjct: 166 M 166


>gi|27365286|ref|NP_760814.1| flagellar basal body-associated protein FliL [Vibrio vulnificus
           CMCP6]
 gi|37680659|ref|NP_935268.1| flagellar basal body-associated protein FliL [Vibrio vulnificus
           YJ016]
 gi|320155670|ref|YP_004188049.1| flagellar biosynthesis protein FliL [Vibrio vulnificus MO6-24/O]
 gi|27361433|gb|AAO10341.1| Flagellar biosynthesis protein fliL [Vibrio vulnificus CMCP6]
 gi|37199408|dbj|BAC95239.1| flagellar basal body-associated protein FliL [Vibrio vulnificus
           YJ016]
 gi|319930982|gb|ADV85846.1| flagellar biosynthesis protein FliL [Vibrio vulnificus MO6-24/O]
          Length = 165

 Score = 94.8 bits (234), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 18/181 (9%), Positives = 56/181 (30%), Gaps = 27/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +    +     + KL +    V   +    G    ++       +   + Q      
Sbjct: 1   MAEELQNGEEAPKGKSKLLIIIIAVVVLLAGGGGAAFFLMGSDPAEEEAAAQVQAQ---- 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV---- 115
                         +      +   QP + N     +   +++ + L+ +   ++     
Sbjct: 57  -------------PVEAPIAYVNIAQPFVFNVTGDNRNRMVQIKVQLMVRGTENENLARY 103

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-----RSQGFVSSVIFRTFI 170
               +   +++   + +++Q+    G    ++   + +K        Q  +  V+F  F+
Sbjct: 104 HSPLIESSLLSTFASATVEQLRSPTGRTELRDKATDDIKAALTKSVGQPVIEKVLFTDFV 163

Query: 171 I 171
           I
Sbjct: 164 I 164


>gi|315639231|ref|ZP_07894393.1| flagellar protein FliL [Campylobacter upsaliensis JV21]
 gi|315480557|gb|EFU71199.1| flagellar protein FliL [Campylobacter upsaliensis JV21]
          Length = 178

 Score = 94.8 bits (234), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 20/178 (11%), Positives = 61/178 (34%), Gaps = 6/178 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M  +   ++  +     L +   VV   + +        ++      +            
Sbjct: 1   MEEEVENTEGKKKKGGSLVIIIVVVLFVLLLTIMGFIAYLLTSTSNDEGAVTEAPKEEAK 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDI----PDKV 115
               S ++     +       ++ L+P   N    S   +++  I L             
Sbjct: 61  PVAKSSQAPTQRGSDYANIGPMYPLEPFTLNLLSDSGSRYVKCTIELEQNSELLKTELDK 120

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
            +  +   I+  +   + ++I+ ++G    K+++  ++  + + GF+ +V F  F+++
Sbjct: 121 KVAIIRDVIIRTLTAKTFEEISTSKGKERLKDELVGKINEILTDGFIKNVYFTDFVVS 178


>gi|262393594|ref|YP_003285448.1| flagellar biosynthesis protein FliL [Vibrio sp. Ex25]
 gi|262337188|gb|ACY50983.1| flagellar biosynthesis protein FliL [Vibrio sp. Ex25]
          Length = 167

 Score = 94.8 bits (234), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 18/181 (9%), Positives = 54/181 (29%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +          + KL +    V   +           ++      + E  Q+     
Sbjct: 1   MAEEQLQGADAPKGKGKLLIIIIAVVVLLLGGG--AAAFFLMGSDEPAQAEASQQVQAKA 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV---- 115
              + +               +   Q  + N     +   +++   L+ +   ++     
Sbjct: 59  SDASPIA-------------YVNLPQAFVFNVTGDRRDRLVQIKAQLMVRGAENEELARY 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFK----EDIEERVK-LRSQGFVSSVIFRTFI 170
               +   +++   + ++ Q+    G    +    EDI+  +     +  +  V+F  F+
Sbjct: 106 HSPLIESSLLSTFASATVDQLRSPTGRVELRDRASEDIKAALNAAVGKPVIEKVLFTDFV 165

Query: 171 I 171
           I
Sbjct: 166 I 166


>gi|163801851|ref|ZP_02195748.1| flagellar basal body-associated protein FliL [Vibrio sp. AND4]
 gi|159174359|gb|EDP59163.1| flagellar basal body-associated protein FliL [Vibrio sp. AND4]
          Length = 166

 Score = 94.5 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 19/181 (10%), Positives = 53/181 (29%), Gaps = 26/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +          + KL +    V   +           ++      + E+ ++     
Sbjct: 1   MAEEQQQGADAPNGKSKLLIIIIAVVVLLVGGG--AAAFFLMGSDESAQPEQAEQTQPQT 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV---- 115
                                +   QP I N     +   +++   L+ +   ++     
Sbjct: 59  TAA--------------PIAYVNIAQPFIFNVTGDRRDRLVQIKAQLMVRGGENEQLARY 104

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
               +   +++   + + +Q+    G    +E   + +K        Q  +  V+F  F+
Sbjct: 105 HSPLIESSLLSTFASATAEQLRSPTGRVELRERASDDIKAALSTAVGQPVIEKVLFTDFV 164

Query: 171 I 171
           I
Sbjct: 165 I 165


>gi|261209863|ref|ZP_05924164.1| flagellar biosynthesis protein FliL [Vibrio sp. RC341]
 gi|260841049|gb|EEX67574.1| flagellar biosynthesis protein FliL [Vibrio sp. RC341]
          Length = 167

 Score = 94.1 bits (232), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 57/181 (31%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++  +   +G +  L +    V    G          M+     +   + ++     
Sbjct: 1   MAEEEQVADAPKGKKKLLIIIIAAVVLLAGGGG---AAFFMMGSGGEEAAAQAEQKTEQA 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                                +   QP + N    +    +++ + L+ +   ++     
Sbjct: 58  ATPAD------------PVSYVNIAQPFVFNVTGDAKDRMVQIKVQLMVRGSENENLARY 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++A   + +++Q+    G    ++   E +     +   +  +  V+F  F+
Sbjct: 106 HSPLVESTLLATFASATVEQLRTPNGRIELRDKATEDIKAALNQAVGKPIIEKVLFTDFV 165

Query: 171 I 171
           +
Sbjct: 166 M 166


>gi|99082788|ref|YP_614942.1| flagellar basal body-associated protein FliL [Ruegeria sp. TM1040]
 gi|99039068|gb|ABF65680.1| Flagellar fliL protein [Ruegeria sp. TM1040]
          Length = 174

 Score = 93.7 bits (231), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 19/172 (11%), Positives = 53/172 (30%), Gaps = 11/172 (6%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
                    + K+ +   +V    G   G+      L  F           +     +  
Sbjct: 7   DVETDQPAKKSKMPLIIGLVLGIAGAGGGFYAVQSGLLPFGNTPA----PEMAQATKEAP 62

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSP-----KDWLRLDIALICKDIPDKVFLETL 120
                      +  L    ++PI+   + +      +   +L++         +  L  +
Sbjct: 63  EGVDKGESAEEIANLAFIEMEPIVVTLNRASGVQQLRFRAQLEVN-QADQDEVETVLPRV 121

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
              + +Y+R + ++ +T        +  +  R+ +   QG V  ++   F++
Sbjct: 122 VDVLNSYLRALELEDLTDPMALPKLRAQMLRRINIVTGQGRVRDLLIMDFVL 173


>gi|91223551|ref|ZP_01258816.1| flagellar basal body-associated protein FliL [Vibrio alginolyticus
           12G01]
 gi|91191637|gb|EAS77901.1| flagellar basal body-associated protein FliL [Vibrio alginolyticus
           12G01]
          Length = 167

 Score = 92.9 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 18/181 (9%), Positives = 54/181 (29%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +          + KL +    V   +           ++      + E  Q+  +  
Sbjct: 1   MAEEQLQGADAPKGKSKLLIIIIAVVVLLLGGG--AAAFFLMGSDEPAQAESSQQAQVKA 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV---- 115
                +               +   Q  + N     +   +++   L+ +   ++     
Sbjct: 59  SDAAPIA-------------YVNLPQAFVFNVTGDSRDRLVQIKAQLMVRGAENEELARY 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFK----EDIEERVK-LRSQGFVSSVIFRTFI 170
               +   +++   + ++ Q+    G    +    EDI+  +     +  +  V+F  F+
Sbjct: 106 HSPLIESSMLSTFASATVDQLRSPTGRVELRDRASEDIKAALNAAVGKPVIEKVLFTDFV 165

Query: 171 I 171
           I
Sbjct: 166 I 166


>gi|317051548|ref|YP_004112664.1| flagellar basal body-associated protein FliL [Desulfurispirillum
           indicum S5]
 gi|316946632|gb|ADU66108.1| flagellar basal body-associated protein FliL [Desulfurispirillum
           indicum S5]
          Length = 170

 Score = 92.5 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 58/182 (31%), Gaps = 24/182 (13%)

Query: 1   MSYDDTTSQ-----YIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQK 55
           M+ +D   +       +G   K  +   ++   + +  G     ++              
Sbjct: 1   MAIEDKEEKESSNSPAKGGGSKKLLIIILILVLVLLLAGAGAYFLLRSPAP--------- 51

Query: 56  FILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDI--- 111
                    +   V    T + +   ++ +   I N      K +LR+ I L   +    
Sbjct: 52  ----AAAPGAEADVPGAPTETTEIGTMYPMDTFIVNLADVLGKRYLRVTIQLEMDNPRLA 107

Query: 112 -PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTF 169
                    L   ++  + +   + I+ AQG    + +I  RV    + G +  V F  F
Sbjct: 108 RELDRRSPQLRDAVLTILSSKKYEDISTAQGKLRLRSEIVSRVNAFLTSGSIRRVYFTEF 167

Query: 170 II 171
           ++
Sbjct: 168 VV 169


>gi|220903652|ref|YP_002478964.1| flagellar basal body-associated protein FliL [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219867951|gb|ACL48286.1| flagellar basal body-associated protein FliL [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 212

 Score = 92.5 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/199 (10%), Positives = 51/199 (25%), Gaps = 31/199 (15%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVY--TFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +       + ++ K  V    +   T  G   G    + +     G      +    +  
Sbjct: 13  EGQAESPKKKSRLKRIVIILAILLMTLSGAGLGGYWWLYLRTPANGAAASSPEAAGGDRP 72

Query: 62  YDNSVRSV------------------------HTGDTISLKKLQIFSLQPIITNFDSS-P 96
            ++   S                              +      +  L P+  N      
Sbjct: 73  VESGAPSGAASGGHAAAGLPGGQPAPGTDVRIERQSDLPRSGGMVLPLPPVTVNLADPSG 132

Query: 97  KDWLRLDIALICKDI---PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV 153
           + +L++ + +          +     +   I+  +   S   I    G    K ++  R+
Sbjct: 133 RRYLKMGMEVEVNADVSAALQANNARIRDAIIMLLAGKSYADIASPDGKVLLKAEVAARL 192

Query: 154 K-LRSQGFVSSVIFRTFII 171
             +     V  V F  F++
Sbjct: 193 NQILGAQRVVRVFFTDFVV 211


>gi|126734119|ref|ZP_01749866.1| flagellar basal body-associated protein FliL [Roseobacter sp. CCS2]
 gi|126716985|gb|EBA13849.1| flagellar basal body-associated protein FliL [Roseobacter sp. CCS2]
          Length = 164

 Score = 92.5 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 18/177 (10%), Positives = 55/177 (31%), Gaps = 18/177 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D   ++       KL + +  V   +G   G+      +   +   +          
Sbjct: 1   MTADADVAEDAPRKASKLPLVFGFVLAILGAGGGFYAVQSGVLSGSDSSDAA-------- 52

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICK---DIPDKVF 116
                 +   +  + +   +   ++ P++ +         LR    L  +       +  
Sbjct: 53  -----EKESASETSNTELDVAFVAIDPLVISLPGQGGRDHLRFAAQLEVRPDHAAEVEAI 107

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFIIA 172
              +   +  Y+R + I  +         +  +  R+++    G V  ++   F+++
Sbjct: 108 RPRIVDVLNGYLRAIDIASLEDPATLPRLRAQMLRRIQVVTGPGRVDDILIMEFVLS 164


>gi|42524698|ref|NP_970078.1| flagellar protein FliL [Bdellovibrio bacteriovorus HD100]
 gi|39576908|emb|CAE78137.1| flagellar protein FliL [Bdellovibrio bacteriovorus HD100]
          Length = 236

 Score = 92.5 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/175 (13%), Positives = 58/175 (33%), Gaps = 11/175 (6%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +  D +S    G+  K  +   +    + +  G    +      + +K+E  +  I    
Sbjct: 65  AASDVSSAPSGGSGQKPILLIALAVVNMLVVAGVGFMLY-----SNRKKEAAEPKIEQVI 119

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWL-----RLDIALICKDIPDKVF 116
              +               ++  L+  I N   S    +      L++         +  
Sbjct: 120 KGEAEAQHKEATEEKEVIGKVVPLETFIVNLAGSKGRKVAKVNMELEVTGSHVMEELEKR 179

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
              +   I+  + + + + ++   G    + +I++ +     QG +S+V F  FI
Sbjct: 180 KAQIRDIIIIILSSKTYEDVSSRDGKDSLRSEIKDTINSFLVQGKISNVFFTEFI 234


>gi|268679514|ref|YP_003303945.1| flagellar basal body-associated protein FliL [Sulfurospirillum
           deleyianum DSM 6946]
 gi|268617545|gb|ACZ11910.1| flagellar basal body-associated protein FliL [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 179

 Score = 92.2 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 62/174 (35%), Gaps = 8/174 (4%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++      +  +  + +   +V   + +  G     +ML     ++         +   +
Sbjct: 7   EENDGAVEKKPKGNMVLIIVIVLLVVLLIGGGAAAFLMLGGSHEEEATTSAPQTQDVKTE 66

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKD----IPDKVFLE 118
              +      T  L    ++ L   + N  S     +L++ I L   D            
Sbjct: 67  --KKKTPKRSTDHLVVGPMYPLAQFVVNLLSESGNRFLKVAIDLELSDAKLQPEIDHKKS 124

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
            +   I+    + + ++I+  +G    K+++ E++    S G+V ++ F  F++
Sbjct: 125 LIRDIIIRTFSSKTFEEISTIKGKDKLKDEVLEKINENLSDGYVKNIYFTDFVV 178


>gi|120603952|ref|YP_968352.1| flagellar basal body-associated protein FliL [Desulfovibrio
           vulgaris DP4]
 gi|120564181|gb|ABM29925.1| flagellar basal body-associated protein FliL [Desulfovibrio
           vulgaris DP4]
 gi|311232392|gb|ADP85246.1| flagellar basal body-associated protein FliL [Desulfovibrio
           vulgaris RCH1]
          Length = 169

 Score = 92.2 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/177 (11%), Positives = 56/177 (31%), Gaps = 15/177 (8%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +    +  + +    ++   +V   +            L     Q E+   +   N 
Sbjct: 1   MAEE---QKPAKKSSKVKWIILLLVLLLLAGGGAGAYWWFFLRQPPAQAEQAATEADKNA 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDI----PDKV 115
                       +       ++ +L P + N      + +L+L + +           + 
Sbjct: 58  TKGAGKTDTAKSE------GRLTTLPPFLVNLADPAGRRYLKLSMDVEVNAPAAVKEIEG 111

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               +   I+  +   S  ++   +G    K ++ +R+  +     V+ V F  F+I
Sbjct: 112 QTAKVRDAIILLLSGKSYTELAAPEGKLLLKNEVADRLNQILGAPRVTRVYFTEFVI 168


>gi|192359510|ref|YP_001982200.1| Flagellar basal body-associated protein FliL [Cellvibrio japonicus
           Ueda107]
 gi|190685675|gb|ACE83353.1| Flagellar basal body-associated protein FliL [Cellvibrio japonicus
           Ueda107]
          Length = 189

 Score = 92.2 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/190 (12%), Positives = 61/190 (32%), Gaps = 36/190 (18%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            + T +  ++ ++ KLF+   V    I I  G     +  +      +E  Q        
Sbjct: 14  ANATDTGTVKSDKKKLFLIIGVAVVLILISVGGTLAALKFWRGDDNPDEAVQP------- 66

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV----FL 117
                    G       + +        NF+ + +  +L+ +I L+ +D   +      +
Sbjct: 67  --------AGPVALAPAIYLQLNPNFTINFNVNGRQRFLQAEITLMYRDPVLEPLLKLHM 118

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ----------------GFV 161
             +   ++  + + +  ++   +G    + +    V+                      V
Sbjct: 119 PAIRNSLVMLLSSKNFDELQTPEGKEALRTEALSAVQGIVDREQQAQASASSSAAATSKV 178

Query: 162 SSVIFRTFII 171
             V+F TF++
Sbjct: 179 EQVLFTTFVM 188


>gi|260772329|ref|ZP_05881245.1| flagellar biosynthesis protein FliL [Vibrio metschnikovii CIP
           69.14]
 gi|260611468|gb|EEX36671.1| flagellar biosynthesis protein FliL [Vibrio metschnikovii CIP
           69.14]
          Length = 169

 Score = 92.2 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 19/181 (10%), Positives = 58/181 (32%), Gaps = 27/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D+  SQ    ++ KL +        +    G      ++   + Q+           
Sbjct: 1   MAADE-NSQDAPKSKKKLLIIIVAAAVLLLGGGG--AAFFLMGSGSDQQSADTANRRAA- 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                                +   QP + N    +    +++ + L+ +   ++     
Sbjct: 57  -------------PSVAPVSYVNIAQPFVFNVSGDTRGRMVQVKVQLMVRGTNNENLARF 103

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++A   + +++Q+    G    ++   E +     ++  +  +  V+F  F+
Sbjct: 104 HSPLVESTLLATFASATVEQLRTPSGRVELRDKATEDIKAAMTQVVGEPVIERVLFTDFV 163

Query: 171 I 171
           +
Sbjct: 164 M 164


>gi|261252328|ref|ZP_05944901.1| flagellar biosynthesis protein FliL [Vibrio orientalis CIP 102891]
 gi|260935719|gb|EEX91708.1| flagellar biosynthesis protein FliL [Vibrio orientalis CIP 102891]
          Length = 165

 Score = 91.8 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 57/181 (31%), Gaps = 27/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   +  +G    L +    V   +G          ++      + ++  +     
Sbjct: 1   MAVEEIEPEAPKGKGKLLIIIIAAVVLLVGGGG---AAFFLMGSDDSAETQQATQQE--- 54

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                        T +     +   QP + N         +++ + L+ +   ++     
Sbjct: 55  -----------VVTPTDPVAYVNIAQPFLFNVTGDKKDRLVQIKVQLMVRGSENENLARY 103

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
               +   +++   + ++ Q+    G    ++   + +K        Q  +  V+F  F+
Sbjct: 104 HSPLIESSLLSTFASATVDQLRTVNGRVELRDKATDDIKASLNRAVGQPVIERVLFTDFV 163

Query: 171 I 171
           +
Sbjct: 164 M 164


>gi|220934500|ref|YP_002513399.1| flagellar basal body-associated protein FliL [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995810|gb|ACL72412.1| flagellar basal body-associated protein FliL [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 167

 Score = 91.8 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 18/186 (9%), Positives = 61/186 (32%), Gaps = 35/186 (18%)

Query: 1   MSYDDT-----TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQK 55
           M+  D       +   +G + KL +   +     G   G +   +M              
Sbjct: 1   MAKKDELNLDVGTPPAKGGKMKLILIVVLAVLLGGGIAGGVLFFLMGG------------ 48

Query: 56  FILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDI--- 111
                        V  G  +    +       ++ NF    +  ++++ + +  +D    
Sbjct: 49  --------EPREVVEAGPAVLPPPIYKSLEPALVVNFQGPGRIRYVQVGVVMSARDPKVM 100

Query: 112 -PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVI 165
                 +  +  +++  +   + +++   +G    +E++ + ++        +  + +V 
Sbjct: 101 DAVDAHMPVIRNNLIMLLSGKTYEELNTREGKEQAREEVLDTIRRVLEERTGEAGIEAVY 160

Query: 166 FRTFII 171
           F +F++
Sbjct: 161 FTSFVM 166


>gi|218778864|ref|YP_002430182.1| flagellar basal body-associated protein FliL [Desulfatibacillum
           alkenivorans AK-01]
 gi|218760248|gb|ACL02714.1| Flagellar basal body-associated protein FliL [Desulfatibacillum
           alkenivorans AK-01]
          Length = 166

 Score = 91.4 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/175 (16%), Positives = 56/175 (32%), Gaps = 17/175 (9%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            DD  ++   G   K  +   +V        G   G +++      +             
Sbjct: 2   ADDAQAEGKGGGGLKWILIALIVVVL---GAGGFIGFLLMSGGGDAQP--------AANV 50

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDIPDKV----FL 117
             +      G+  +     +  +   I N      K +L+  I         K       
Sbjct: 51  PAAPAPAPAGNPNAGAPGIMVEMDSFIVNLRDREGKRYLKAKINFEVPTEAVKAEFTTRK 110

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
             +   I+  +   S  +I+  +G    KE++  RV  + S G VS+V F  F++
Sbjct: 111 AQIRDVILILLSAKSFAEISRLEGKLQLKEELMARVNQVLSSGRVSNVFFTEFVV 165


>gi|46578464|ref|YP_009272.1| flagellar protein FliL [Desulfovibrio vulgaris str. Hildenborough]
 gi|46447875|gb|AAS94531.1| flagellar protein FliL [Desulfovibrio vulgaris str. Hildenborough]
          Length = 171

 Score = 91.0 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 20/172 (11%), Positives = 53/172 (30%), Gaps = 12/172 (6%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
              +  + +    ++   +V   +            L     Q E+   +   N      
Sbjct: 5   EEQKPAKKSSKVKWIILLLVLLLLAGGGAGAYWWFFLRQPPAQAEQAATEADKNATKGAG 64

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDI----PDKVFLETL 120
                  +       ++ +L P + N      + +L+L + +           +     +
Sbjct: 65  KTDTAKSE------GRLTTLPPFLVNLADPAGRRYLKLSMDVEVNAPAAVKEIEGQTAKV 118

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              I+  +   S  ++   +G    K ++ +R+  +     V+ V F  F+I
Sbjct: 119 RDAIILLLSGKSYTELAAPEGKLLLKNEVADRLNQILGAPRVTRVYFTEFVI 170


>gi|77918774|ref|YP_356589.1| flagellar basal body-associated protein [Pelobacter carbinolicus
           DSM 2380]
 gi|77544857|gb|ABA88419.1| flagellar basal body-associated protein [Pelobacter carbinolicus
           DSM 2380]
          Length = 167

 Score = 91.0 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 18/177 (10%), Positives = 53/177 (29%), Gaps = 17/177 (9%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  D          +K  +   ++   +    G       +   A     + ++    +
Sbjct: 1   MAEKDLQQDGSAKKGNKNLIIIGILGVLLLGAIGVAAY---MMGKANAPAAEQEEQTAGD 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDI----PDKV 115
                       +   +    +  ++P I N        +L+  I L             
Sbjct: 58  TAPA--------NGTKVLSGLMVEVEPFIVNILDVQGTRYLKASITLEVDSELAIQEATE 109

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            +  +   ++  I   +  +++  QG    + ++  ++     +G V  + F  F++
Sbjct: 110 RMPQIRDAVLLLISNKTFSEMSDLQGKLQLRAELMAKINSFFRRGKVQKIYFTEFVV 166


>gi|258404713|ref|YP_003197455.1| flagellar basal body-associated protein FliL [Desulfohalobium
           retbaense DSM 5692]
 gi|257796940|gb|ACV67877.1| flagellar basal body-associated protein FliL [Desulfohalobium
           retbaense DSM 5692]
          Length = 169

 Score = 91.0 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/180 (14%), Positives = 61/180 (33%), Gaps = 21/180 (11%)

Query: 1   MSYDDTTS--QYIRG-NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+  D  +  Q  +G  + KL +    V+    I  G       +    G + E  Q+  
Sbjct: 1   MAKKDENAAKQGAKGDRKFKLLLIVASVFLLAAIGAGGYY----IGTQWGSESEAAQENT 56

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IP 112
            ++   +       G         +  +   + N     +  +L+  I +   D      
Sbjct: 57  PSSESVSFDSKGELGP--------LVEMDDFLVNIADGEQTRYLKASITVEATDKKSQDE 108

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-VSSVIFRTFII 171
               +  +   I+ ++ T +  Q+   QG +  + ++ +R+        V  + F  F++
Sbjct: 109 LNKRIPQIRDVIIFHLGTKTFDQVRDLQGKKQLRAELTKRLNGIVDQRLVQRIFFTEFVV 168


>gi|57238445|ref|YP_179576.1| flagellar basal body-associated protein FliL [Campylobacter jejuni
           RM1221]
 gi|57167249|gb|AAW36028.1| flagellar protein FliL [Campylobacter jejuni RM1221]
 gi|315058877|gb|ADT73206.1| Flagellar biosynthesis protein fliL [Campylobacter jejuni subsp.
           jejuni S3]
          Length = 178

 Score = 91.0 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 19/178 (10%), Positives = 61/178 (34%), Gaps = 6/178 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M  +    +  +     L +   ++   + +    +   ++    + + E K        
Sbjct: 1   MDEELENEETKKKKGGSLVIIIVILLFVLLLSIMGVIAWLISSSSSDESEVKEAPKEEAK 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKD----IPDKV 115
                V +     +       ++ L P   N    S   +++  I L             
Sbjct: 61  TDKPKVSAPTQRGSDFANIGPMYPLDPFTLNLLSDSGSRYVKCTIELEQNSELLKPELDK 120

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
            +  +   I+  +   + ++++  +G    K+++  ++  + + GF+ +V F  F+++
Sbjct: 121 KVPVIRDIIIRTLTAKTFEEVSTQKGKERLKDELVGKINEILTDGFIKNVYFTDFVVS 178


>gi|117620848|ref|YP_855910.1| flagellar basal body-associated protein FliL [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117562255|gb|ABK39203.1| flagellar basal body-associated protein FliL [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 172

 Score = 91.0 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 20/182 (10%), Positives = 55/182 (30%), Gaps = 22/182 (12%)

Query: 1   MSYDDTTS-QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ D+  + +     + K  +    +   +    G     ++        E   +     
Sbjct: 1   MADDNELTLKDPAAGKKKKLIMIIALAVIVLGGGGAGAWFMLSGGDKPAAEAAGEGKDAK 60

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKVF-- 116
                               L +   +P + N         +++ I L+ +   D+    
Sbjct: 61  PKEAAPQ-----------PSLYVGMPRPFVFNVSGGQRDRLVQIKIQLMVRGTADETLAK 109

Query: 117 --LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTF 169
             +  +   ++      + +Q+   +G    ++D  E  +     L S   +  V+F  F
Sbjct: 110 QNIPLIEGTLLRVFSAATSEQLMTFEGKEKLRKDSLEECRRVLNDLVSSPVIEQVLFTGF 169

Query: 170 II 171
           ++
Sbjct: 170 VM 171


>gi|325291934|ref|YP_004277798.1| flagellar protein [Agrobacterium sp. H13-3]
 gi|325059787|gb|ADY63478.1| flagellar protein [Agrobacterium sp. H13-3]
          Length = 166

 Score = 90.6 bits (223), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 57/169 (33%), Positives = 89/169 (52%), Gaps = 5/169 (2%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            ++ T    + +   + +    + T +G   GW  G ++    A       +        
Sbjct: 2   ENEQTEGKKKSSPMVMTIAGVAILTLLGAGGGWFVGGMVAPKIA-----GAEAHAPAAAG 56

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQ 122
           ++  +     D I  +   I  L PI TN      +W+RL++AL+ K   +    E +HQ
Sbjct: 57  EHGEKKGEGIDKIPAEANGIVQLDPITTNLAYPSTNWVRLEVALMFKGPVEVNLAEDIHQ 116

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           DIMAY+RTVS++Q+ G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 117 DIMAYVRTVSLQQLEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 165


>gi|260432136|ref|ZP_05786107.1| flagellar basal body-associated protein FliL [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415964|gb|EEX09223.1| flagellar basal body-associated protein FliL [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 165

 Score = 90.6 bits (223), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 24/175 (13%), Positives = 54/175 (30%), Gaps = 15/175 (8%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+          G   K  +   +V    G   G+      L      K EK  +     
Sbjct: 1   MTDATAEQAEAPGKSGKTGLIIGIVLALAGAAGGYFLTTSGLLPIGATKTEKSAE----- 55

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIAL---ICKDIPDKVFL 117
                  +       +L  ++   L P+I + ++S    L+    L          +   
Sbjct: 56  ------HTPGESPVSALPVVEFVDLPPVIVSVNTSDSRHLKFHAQLEVEAAHAAEVEAMK 109

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
             +   +  Y+R + +  +  +      +  +  R+  +  +G V  V+   F++
Sbjct: 110 PRIMDVMNTYLRAIDLSDLQDSLALMRIRGHLHRRIGMVVGEGRVRDVLVMEFVL 164


>gi|86150075|ref|ZP_01068303.1| flagellar protein FliL [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|86151964|ref|ZP_01070177.1| flagellar protein FliL [Campylobacter jejuni subsp. jejuni 260.94]
 gi|86152897|ref|ZP_01071102.1| Flagellar basal body-associated protein FliL [Campylobacter jejuni
           subsp. jejuni HB93-13]
 gi|121613276|ref|YP_001001063.1| flagellar basal body-associated protein FliL [Campylobacter jejuni
           subsp. jejuni 81-176]
 gi|148926758|ref|ZP_01810438.1| possible flagellar protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|157415641|ref|YP_001482897.1| flagellar basal body-associated protein FliL [Campylobacter jejuni
           subsp. jejuni 81116]
 gi|167005964|ref|ZP_02271722.1| possible flagellar protein [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|315124843|ref|YP_004066847.1| flagellar basal body-associated protein [Campylobacter jejuni
           subsp. jejuni ICDCCJ07001]
 gi|85839521|gb|EAQ56782.1| flagellar protein FliL [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85841072|gb|EAQ58321.1| flagellar protein FliL [Campylobacter jejuni subsp. jejuni 260.94]
 gi|85843782|gb|EAQ60992.1| Flagellar basal body-associated protein FliL [Campylobacter jejuni
           subsp. jejuni HB93-13]
 gi|87249864|gb|EAQ72823.1| flagellar protein FliL [Campylobacter jejuni subsp. jejuni 81-176]
 gi|145845122|gb|EDK22218.1| possible flagellar protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|157386605|gb|ABV52920.1| possible flagellar protein [Campylobacter jejuni subsp. jejuni
           81116]
 gi|284926623|gb|ADC28975.1| flagellar basal body-associated protein FliL [Campylobacter jejuni
           subsp. jejuni IA3902]
 gi|307748285|gb|ADN91555.1| Flagellar protein FliL [Campylobacter jejuni subsp. jejuni M1]
 gi|315018565|gb|ADT66658.1| flagellar basal body-associated protein [Campylobacter jejuni
           subsp. jejuni ICDCCJ07001]
 gi|315928051|gb|EFV07370.1| flagellar basal body-associated protein FliL family protein
           [Campylobacter jejuni subsp. jejuni DFVF1099]
 gi|315931441|gb|EFV10408.1| flagellar basal body-associated protein FliL family protein
           [Campylobacter jejuni subsp. jejuni 327]
          Length = 178

 Score = 90.6 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 19/178 (10%), Positives = 61/178 (34%), Gaps = 6/178 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M  +    +  +     L +   ++   + +    +   ++    + + E K        
Sbjct: 1   MDEELENEETKKKKGGSLVIIIVILLFVLLLSIMGVIAWLISSSSSDESEVKEAPKEEAK 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKD----IPDKV 115
                V +     +       ++ L P   N    S   +++  I L             
Sbjct: 61  ADKPKVSAPTQRGSDFANIGPMYPLDPFTLNLLSDSGSRYVKCTIELEQNSELLKPELDK 120

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
            +  +   I+  +   + ++++  +G    K+++  ++  + + GF+ +V F  F+++
Sbjct: 121 KVPVIRDIIIRTLTAKTFEEVSTQKGKERLKDELVGKINEILTDGFIKNVYFTDFVVS 178


>gi|307945663|ref|ZP_07660999.1| flagellar basal body-associated protein FliL [Roseibium sp.
           TrichSKD4]
 gi|307771536|gb|EFO30761.1| flagellar basal body-associated protein FliL [Roseibium sp.
           TrichSKD4]
          Length = 169

 Score = 90.2 bits (222), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 53/163 (32%), Gaps = 22/163 (13%)

Query: 15  QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDT 74
           + KL +   +    +    G     + +                    +           
Sbjct: 22  KKKLILFGAIGLVVLLAAGGAAYFFLFMGG----------------EPEAPAGEPGQPVP 65

Query: 75  ISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICKDIP----DKVFLETLHQDIMAYIR 129
              + +  + L  +  N  +  +  +L++ IAL  KD       + FL  +      Y+R
Sbjct: 66  EVQEPVVFYDLPEMTVNLSTDGRTTYLKVRIALEVKDEETVAQIEPFLPRILDAFQIYLR 125

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
            +    + G+ G    KE++  R+ L      V  V+F+  ++
Sbjct: 126 ELRPADLEGSAGLFRLKEELLRRINLSVYPARVDGVLFKEILV 168


>gi|315121842|ref|YP_004062331.1| flagellar basal body-associated protein FliL [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495244|gb|ADR51843.1| flagellar basal body-associated protein FliL [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 170

 Score = 90.2 bits (222), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 109/173 (63%), Positives = 132/173 (76%), Gaps = 4/173 (2%)

Query: 1   MSYDDTTSQYIRGNQH-KLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           MSY+D     IRGNQ  + F+  F+V T IGIFCGWLGGIV+      +K+E   + I  
Sbjct: 1   MSYNDKN---IRGNQSYERFIMQFIVCTAIGIFCGWLGGIVISSFVLAEKKENSIESIFK 57

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET 119
           N Y+N  RS++  D +  K  QIF+L PIITNFDSSP++WLRLD+ALIC   P+KVFLE 
Sbjct: 58  NVYNNRTRSIYANDAVYPKDPQIFALHPIITNFDSSPENWLRLDVALICDKTPNKVFLEI 117

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA 172
           LHQDIMAY+RTVS+K ITG+QGFRYFKED+EERVKLR+QG VS+VIFRTFIIA
Sbjct: 118 LHQDIMAYVRTVSMKHITGSQGFRYFKEDVEERVKLRAQGSVSNVIFRTFIIA 170


>gi|88596075|ref|ZP_01099312.1| flagellar protein FliL [Campylobacter jejuni subsp. jejuni 84-25]
 gi|205356151|ref|ZP_03222918.1| possible flagellar protein [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|218563012|ref|YP_002344791.1| flagellar basal body-associated protein FliL [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|88190916|gb|EAQ94888.1| flagellar protein FliL [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112360718|emb|CAL35517.1| putative flagellar protein [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|205345994|gb|EDZ32630.1| possible flagellar protein [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|315929539|gb|EFV08731.1| flagellar basal body-associated protein FliL family protein
           [Campylobacter jejuni subsp. jejuni 305]
          Length = 178

 Score = 90.2 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 19/178 (10%), Positives = 61/178 (34%), Gaps = 6/178 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M  +    +  +     L +   ++   + +    +   ++    + + E K        
Sbjct: 1   MDEELENEETKKKKGGSLVIIIVILLFVLLLSIMGVIAWLISSSSSDESEVKEAPKEEAK 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKD----IPDKV 115
                V +     +       ++ L P   N    S   +++  I L             
Sbjct: 61  ADKPKVSAPAQRGSDFANIGPMYPLDPFTLNLLSDSGSRYVKCTIELEQNSELLKPELDK 120

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
            +  +   I+  +   + ++++  +G    K+++  ++  + + GF+ +V F  F+++
Sbjct: 121 KVPVIRDIIIRTLTAKTFEEVSTQKGKERLKDELVGKINEILTDGFIKNVYFTDFVVS 178


>gi|242309009|ref|ZP_04808164.1| flagellar basal body-protein FliL [Helicobacter pullorum MIT
           98-5489]
 gi|239524433|gb|EEQ64299.1| flagellar basal body-protein FliL [Helicobacter pullorum MIT
           98-5489]
          Length = 177

 Score = 90.2 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 32/179 (17%), Positives = 71/179 (39%), Gaps = 11/179 (6%)

Query: 1   MSYD-DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ +    S+     Q+K+ +   +    + +       IV + +F+G KEE   +    
Sbjct: 1   MAEEAQKDSKLSNLKQNKMILFIIIGVVALLLIILI---IVGILIFSGDKEESQPQSNQP 57

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF--DSSPKDWLR----LDIALICKDIPD 113
                S  S    ++  L    ++ L+  I N       K +L+    L++++       
Sbjct: 58  LQSAASKSSTANPNSSLLSVGPMYPLEQFIVNLVSTGGGKRYLKTSIALEMSIAEMQPEL 117

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              ++ L   I+  +   + ++I   +G +  KE+I  R+      G + +V F  F++
Sbjct: 118 DSKVDILRDTIITILSDKTFEEIQTTRGKQKLKEEILARINEFLVDGRIVNVFFTDFVV 176


>gi|283956789|ref|ZP_06374265.1| possible flagellar protein [Campylobacter jejuni subsp. jejuni
           1336]
 gi|283791764|gb|EFC30557.1| possible flagellar protein [Campylobacter jejuni subsp. jejuni
           1336]
          Length = 178

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/178 (10%), Positives = 61/178 (34%), Gaps = 6/178 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M  +    +  +     L +   ++   + +    +   ++    + + E K        
Sbjct: 1   MDEELENEETKKKKGGSLVIIIVILLFVLLLSIMGVIAWLISSSSSDESEVKEAPKEETK 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKD----IPDKV 115
                + +     +       ++ L P   N    S   +++  I L             
Sbjct: 61  ADKPKISAPTQRGSDFANIGPMYPLDPFTLNLLSDSGSRYVKCTIELEQNSELLKPELDK 120

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
            +  +   I+  +   + ++++  +G    K+++  ++  + + GF+ +V F  F+++
Sbjct: 121 KVPVIRDIIIRTLTAKTFEEVSTQKGKERLKDELVGKINEILTDGFIKNVYFTDFVVS 178


>gi|88800463|ref|ZP_01116027.1| flagellar protein FliL [Reinekea sp. MED297]
 gi|88776793|gb|EAR08004.1| flagellar protein FliL [Reinekea sp. MED297]
          Length = 177

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 72/183 (39%), Gaps = 19/183 (10%)

Query: 1   MSYDD--TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +D     +  + N  KL +  F+V   + +    +     L     +  E  Q  I 
Sbjct: 1   MAEEDAIEGEESGKKNAGKLKLIIFIVLGVLLVAGLSIFATWFLM--KDRMVEPDQPGIS 58

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----D 113
               +    +V  G+      +        I N+ +  +  +L+++++++ +D       
Sbjct: 59  EIPLEEPQMTVEQGE-----AIYHAMQPAFIVNYSNGGRSRFLQIELSVLTRDPAAIEVL 113

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRT 168
            +    +  +++      +I Q+  A+G +   +D+   ++        +  + SV+FR+
Sbjct: 114 ILHNPLIRNNLLDVFAAQNINQLATAEGKQKLVDDLTSAIQDVLIIEMGRPGIESVLFRS 173

Query: 169 FII 171
           F++
Sbjct: 174 FVM 176


>gi|87119477|ref|ZP_01075374.1| flagellar protein [Marinomonas sp. MED121]
 gi|86164953|gb|EAQ66221.1| flagellar protein [Marinomonas sp. MED121]
          Length = 174

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/184 (11%), Positives = 60/184 (32%), Gaps = 24/184 (13%)

Query: 1   MSYDD---TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ DD   +  +  +G + KL +        + I  G     ++    +   +    + +
Sbjct: 1   MADDDLDVSAEEGAKGGKSKLIIIIVAAVLVLAIGGG-AAFFLLSGDDSETADASASEEV 59

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IP 112
                             +   + +      + +F  + K  +L+L++ +  +D      
Sbjct: 60  SQ----------EVSVATTGPAIYLKLDPAFVVDFIVAGKQRYLQLNLTVKSRDQGQVDA 109

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFR 167
            K+ +  +   ++    +    ++   +G    K    E +          G V  ++F 
Sbjct: 110 IKIHMPLIRNSLVLLFSSQVFNELQSTEGKMALKAAAVESINTILSEETGAGGVEDILFT 169

Query: 168 TFII 171
            F++
Sbjct: 170 NFVM 173


>gi|51246519|ref|YP_066403.1| flagellar protein (FliL) [Desulfotalea psychrophila LSv54]
 gi|50877556|emb|CAG37396.1| related to flagellar protein (FliL) [Desulfotalea psychrophila
           LSv54]
          Length = 162

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 24/177 (13%), Positives = 59/177 (33%), Gaps = 22/177 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +  + Q   G + KLF+   +    I +       ++                    
Sbjct: 1   MAEEKASPQEKNGKKKKLFLIGGIALVAIILIGIIAYLLLNKGDD--------------- 45

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-----LRLDIALICKDIPDKV 115
               + ++V      +     +  LQ  + N  S  ++      + L+++         +
Sbjct: 46  -TQVTDKNVPVPQVNATNLGPMVDLQDFVVNIISDEENHYVKTAITLEVSNSSASEEVGM 104

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            +  +   I+        +++   QG +  K +I  R+  +   G V +V F  F++
Sbjct: 105 RMPQMRDTIILIFGNKDYRELQDLQGKKQLKAEISSRINAILQTGQVVAVYFTAFVV 161


>gi|254500959|ref|ZP_05113110.1| flagellar basal body-associated protein FliL [Labrenzia alexandrii
           DFL-11]
 gi|222437030|gb|EEE43709.1| flagellar basal body-associated protein FliL [Labrenzia alexandrii
           DFL-11]
          Length = 169

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/163 (12%), Positives = 53/163 (32%), Gaps = 22/163 (13%)

Query: 15  QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDT 74
           + KL +   +    +    G     + +                                
Sbjct: 22  KKKLILFGAIGLVVLLAVGGGAYYFLFMGDS----------------MPAPAPGEDAPPQ 65

Query: 75  ISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICKD----IPDKVFLETLHQDIMAYIR 129
            + + +  + L  +  N  +  +  +L++ IAL  ++       + +L  +      Y+R
Sbjct: 66  EAQRPVVFYDLPEMTVNLATEGRTTYLKVRIALEVENRAMIDQIQPYLPRILDAFQIYLR 125

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
            +    + G+ G    KE++  R+ L      V  V+F+  ++
Sbjct: 126 ELRPADLEGSAGLFRLKEELLRRINLSVYPAKVEGVLFKEILV 168


>gi|253827891|ref|ZP_04870776.1| flagellar basal body-associated protein [Helicobacter canadensis
           MIT 98-5491]
 gi|253511297|gb|EES89956.1| flagellar basal body-associated protein [Helicobacter canadensis
           MIT 98-5491]
          Length = 177

 Score = 89.5 bits (220), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 69/179 (38%), Gaps = 11/179 (6%)

Query: 1   MSYDDT-TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ ++   S+     Q+K+ +   +    + +    + GI++       +    Q     
Sbjct: 1   MADEEQKESKLASLKQNKMILFIIIGVVALLLIILIVVGILIFSGGDETQS---QDANQP 57

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF--DSSPKDWLR----LDIALICKDIPD 113
                S  SV   ++  L    ++ L   I N       K +L+    L++++       
Sbjct: 58  TQSSASKSSVANPNSSLLNVGPMYPLDQFIVNLVSTGGGKRYLKTAIALEMSIAEMQPEL 117

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              +  L   I+  + + + ++I   +G +  KE+I  R+      G +S+V F  F++
Sbjct: 118 DTKVNILRDTIITILASKTFEEIQTTRGKQKLKEEIIARLNEFLVDGRISNVFFTEFVV 176


>gi|302343738|ref|YP_003808267.1| flagellar basal body-associated protein FliL [Desulfarculus baarsii
           DSM 2075]
 gi|301640351|gb|ADK85673.1| flagellar basal body-associated protein FliL [Desulfarculus baarsii
           DSM 2075]
          Length = 189

 Score = 89.5 bits (220), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/162 (16%), Positives = 50/162 (30%), Gaps = 7/162 (4%)

Query: 17  KLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTIS 76
           KL +   V    +          ++    A   E            + +  +        
Sbjct: 27  KLIIIVAVGLIVLFGAGFGAWWFLLAGDDAPPPEAAPAAQQGQAPAEGAAPAQGQEGAAQ 86

Query: 77  LKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTV 131
            K   I  L+P + N      K +L+L +A+   D          L  +   I+  + + 
Sbjct: 87  EKPGTIVQLEPFVVNLADPGGKRYLKLTMAVDAGDEKLKAEIDARLPQIRDSILLLLTSK 146

Query: 132 SIKQITGAQGFRYFKEDIEERVK--LRSQGFVSSVIFRTFII 171
           + + I    G    + ++       L   G V +V F  F+I
Sbjct: 147 AYQDIAEVAGKIRLRTEVLAIFNRYLAGAGSVHAVYFSEFVI 188


>gi|294084395|ref|YP_003551153.1| flagellar basal body-associated protein FliL [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663968|gb|ADE39069.1| flagellar basal body-associated protein FliL [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 192

 Score = 89.5 bits (220), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/194 (12%), Positives = 60/194 (30%), Gaps = 26/194 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D   +  +G   K  +  FVV  F+ I  G   G ++         E+ ++ I   
Sbjct: 1   MAENDEEPKKSKGFLIK--IILFVVGGFVLIGAGLGVGYMLFGAAQPDPSEQIEEIIERK 58

Query: 61  -------------FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALI 107
                               S  T +  +   +         +N     +  L++ + + 
Sbjct: 59  MQEAEAAEQEALDNATAQRVSKDTPEVENFVTIYYEFPGTFTSNLMG-SRKMLQVGVGVS 117

Query: 108 CKDIP-----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ---- 158
            +         +     L   ++  +       + G  G       + + +  + +    
Sbjct: 118 TQYDESIMEMVESHQLALRSVVLGVLSEFGEDDVQGIAGREKLATAMRDAMNAKLESLED 177

Query: 159 -GFVSSVIFRTFII 171
            G V+ V F +F++
Sbjct: 178 FGGVAEVHFTSFVL 191


>gi|311992315|gb|ADQ26731.1| flagellar basal-body associated protein [Aeromonas hydrophila]
          Length = 171

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/179 (10%), Positives = 53/179 (29%), Gaps = 21/179 (11%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            ++ T +     + K  +    +   +    G     ++        E   +        
Sbjct: 3   DNELTLKDPAAGKKKKLIMIIALAVIVLGGGGAGAWFMLSGGDKPAAEAAGEGKDAKPKE 62

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKVF----L 117
                            L +   +P + N         +++ I L+ +   D+      +
Sbjct: 63  AAPQ-----------PSLYVGMPRPFVFNVSGGQRDRLVQIKIQLMVRGTADETLAKQNI 111

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
             +   ++      + +Q+   +G    ++D  E  +     L S   +  V+F  F++
Sbjct: 112 PLIEGTLLRVFSAATSEQLMTFEGKEKLRKDSLEECRRVLNDLVSSPVIEQVLFTGFVM 170


>gi|260429247|ref|ZP_05783224.1| flagellar basal body-associated protein FliL [Citreicella sp. SE45]
 gi|260419870|gb|EEX13123.1| flagellar basal body-associated protein FliL [Citreicella sp. SE45]
          Length = 185

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 50/174 (28%), Gaps = 9/174 (5%)

Query: 7   TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKF----ILNNFY 62
             +  +    KL +   VV   +G   G+      L  F G  +                
Sbjct: 11  EDEEPKKKSSKLPLIIGVVLALVGGGGGFYAAFSGLLPFGGGGDHTAPADGHGDTAAAGA 70

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALIC---KDIPDKVFLE 118
            +   +   G  +    +    +  +I +   S     LR   +L          +    
Sbjct: 71  HDPHAADDHGAPLPDANVAFIEMPQLIISMGPSSDMHHLRFLASLEVPPSHMAEVESLKP 130

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
            +   +  Y+R +    I         +  +  RV+L   +  V  ++   F++
Sbjct: 131 RVVDVLNNYLRALHPSDIEAPGALIRIRSQMLRRVQLVAGEDRVRDLLIMEFVL 184


>gi|153952291|ref|YP_001398709.1| flagellar basal body-associated protein FliL [Campylobacter jejuni
           subsp. doylei 269.97]
 gi|152939737|gb|ABS44478.1| flagellar protein FliL [Campylobacter jejuni subsp. doylei 269.97]
          Length = 178

 Score = 89.1 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/178 (10%), Positives = 62/178 (34%), Gaps = 6/178 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M  +    +  +     L +   ++   + +    +   ++    + + E K        
Sbjct: 1   MDEELGNEETKKKKGGSLVIIIVILLFVLLLSIMGMIAWLISSSSSDESEVKEAPKEEVK 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKD----IPDKV 115
                V +     +       ++ L P   N    S   +++  I L   +         
Sbjct: 61  ADKPKVSAPAQRGSDFANIGPMYPLDPFTLNLLSDSGSRYVKCTIELEQNNELLKPELDK 120

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
            +  +   I+  +   + ++++  +G    K+++  ++  + + GF+ +V F  F+++
Sbjct: 121 KVPVIRDIIIRTLTAKTFEEVSTQKGKERLKDELVGKINEILTDGFIKNVYFTDFVVS 178


>gi|149194580|ref|ZP_01871676.1| flagellar basal body-associated protein FliL [Caminibacter
           mediatlanticus TB-2]
 gi|149135324|gb|EDM23804.1| flagellar basal body-associated protein FliL [Caminibacter
           mediatlanticus TB-2]
          Length = 173

 Score = 89.1 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/141 (16%), Positives = 53/141 (37%), Gaps = 17/141 (12%)

Query: 37  GGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSS 95
              ++      Q  ++ QK                  T   +   I+ L   + N  +S+
Sbjct: 43  AYFLLSGNDEPQDNQEPQKIEKKKKV-----------TNMTEIGPIYPLDTFVVNLINSN 91

Query: 96  PKDWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEE 151
              +L+  I L              L  +   I+  + + ++++I  ++G    KE+I+ 
Sbjct: 92  ASRYLKCKIDLELDAPETQQEIDKKLPAIRDLIIRILSSKTVEEIQTSKGKEKLKEEIKR 151

Query: 152 RVK-LRSQGFVSSVIFRTFII 171
           ++  + + G + +V F  F+I
Sbjct: 152 KINEILTTGEIRNVYFTEFVI 172


>gi|222053612|ref|YP_002535974.1| flagellar basal body-associated protein FliL [Geobacter sp. FRC-32]
 gi|221562901|gb|ACM18873.1| flagellar basal body-associated protein FliL [Geobacter sp. FRC-32]
          Length = 166

 Score = 88.7 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/177 (15%), Positives = 62/177 (35%), Gaps = 18/177 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +   + N+    +    V   I I        +M+    G+K  K Q+     
Sbjct: 1   MAEQKEEAVPAKDNKKLFIIIGAAVLALIVIAVIVA---MMMGGGKGEKPAKAQEAKAEK 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK----V 115
             +   ++             ++ L+P I N     +  +L++ +         K     
Sbjct: 58  KGEGGEKASAA---------TVYPLEPFIVNIYDGQELRYLKIKVEFEMAAAEIKTEIDA 108

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIE-ERVKLRSQGFVSSVIFRTFII 171
               L   ++  + T +++++   QG    +++I    VK+   G V  V F  F++
Sbjct: 109 QQSALRDAVLVLLTTKTMREVQDLQGKNQLRDEILSTTVKILGPGKVIKVYFTDFVV 165


>gi|254466464|ref|ZP_05079875.1| flagellar basal body-associated protein FliL [Rhodobacterales
           bacterium Y4I]
 gi|206687372|gb|EDZ47854.1| flagellar basal body-associated protein FliL [Rhodobacterales
           bacterium Y4I]
          Length = 174

 Score = 88.3 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/172 (13%), Positives = 56/172 (32%), Gaps = 11/172 (6%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
            T       + KL +   VV    G   G+      L  F     +K      +   +  
Sbjct: 7   DTEADAPAKKGKLPLIIGVVLALAGAGGGFFAVQSGLLPFG----QKAAPEPAHAAEEAP 62

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSP-----KDWLRLDIALICKDIPDKVFLETL 120
                      +  L    + PI+     +      +   +L++ L  +    +  L  +
Sbjct: 63  EGVDTGETAEDIANLAFIEMDPIVITLSKASGIKHLRFRAQLEVDLAHQA-EVEKILPRV 121

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
              + +Y+R + ++ +T        +  +  R+ +   QG V  ++   F++
Sbjct: 122 VDVLNSYLRALELEDLTDPMALPKLRAQMLRRINIATGQGRVRDLLIMDFVL 173


>gi|254510615|ref|ZP_05122682.1| flagellar basal body-associated protein FliL [Rhodobacteraceae
           bacterium KLH11]
 gi|221534326|gb|EEE37314.1| flagellar basal body-associated protein FliL [Rhodobacteraceae
           bacterium KLH11]
          Length = 176

 Score = 88.3 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 24/175 (13%), Positives = 53/175 (30%), Gaps = 15/175 (8%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+              K  +   +    +G   G+      L  FA Q+  K        
Sbjct: 12  MTDATADEAEATKKSGKKGLVLGLFLALVGGVGGYFITASGLLPFANQEVAKDAD----- 66

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFL 117
                 +         L  +    L P+I + ++S    L+    L          +   
Sbjct: 67  ------KKGEGASVKGLPDVAFVDLPPVIISVNTSDSRHLKFHAQLEVNAGYTADIEKMQ 120

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
             +   + +Y+R V +  +  +      +  +  R+ +   +G V  V+   F++
Sbjct: 121 PRIMDVLNSYLRAVELTDLEDSLALVRIRGHLLRRIGIVVGEGRVRDVLVMEFVL 175


>gi|197120189|ref|YP_002140616.1| flagellar basal body-associated protein FliL [Geobacter
           bemidjiensis Bem]
 gi|197089549|gb|ACH40820.1| flagellar basal body-associated protein FliL [Geobacter
           bemidjiensis Bem]
          Length = 174

 Score = 87.9 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 26/177 (14%), Positives = 58/177 (32%), Gaps = 10/177 (5%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+           +  KLF+    V   + I  G      +       ++      +   
Sbjct: 1   MAEQAKAQDAPPKDNKKLFIIIGAVVAVLAIGGGA----ALFLGGKKGEKAPEGAKVEAK 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDI----PDKV 115
                  +       +     I+ L+P I N     +  +L++ +     +       + 
Sbjct: 57  AEGGGHGAPAKEGEGAAAGATIYPLEPFIVNIYDGAELRYLKVKVEFEMANPQVKPELEA 116

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
            +  L   I+  + T ++++I   QG    +E I   V K+     ++ V F  F++
Sbjct: 117 KMAPLRDAILILLTTKTMQEIQDLQGKNQLREQILAAVSKVVPPSKITKVYFTDFVV 173


>gi|118588709|ref|ZP_01546117.1| flagellar basal body-associated protein FliL [Stappia aggregata IAM
           12614]
 gi|118438695|gb|EAV45328.1| flagellar basal body-associated protein FliL [Stappia aggregata IAM
           12614]
          Length = 170

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 53/163 (32%), Gaps = 23/163 (14%)

Query: 15  QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDT 74
           + KL +   +    +    G     +M                        V        
Sbjct: 24  KKKLILFGGIGLVVLLAAGGAGYYFLMGSS-----------------APAPVPGDAESPQ 66

Query: 75  ISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICKD----IPDKVFLETLHQDIMAYIR 129
              K +  + L  +  N  +  +  +L++ IAL  ++       + +L  +      Y+R
Sbjct: 67  EVQKPVVFYDLPEMTVNLATEGRTTYLKVRIALEVENRAMIDQIQPYLPRILDAFQIYLR 126

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
            +    + G+ G    KE++  R+ L      V  V+F+  ++
Sbjct: 127 ELRPADLEGSAGLFRLKEELLRRINLSVYPARVEGVLFKEILV 169


>gi|254476693|ref|ZP_05090079.1| flagellar basal body-associated protein FliL [Ruegeria sp. R11]
 gi|214030936|gb|EEB71771.1| flagellar basal body-associated protein FliL [Ruegeria sp. R11]
          Length = 156

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 21/160 (13%), Positives = 54/160 (33%), Gaps = 11/160 (6%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           + +   VV    G   G+      L  F     +      +           +      +
Sbjct: 1   MPLIIGVVLAIAGAGGGFFAVQSGLLPFG----QSAAPEGVKATEVAPEGVDNGESAEDI 56

Query: 78  KKLQIFSLQPIITNFDSSP-----KDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVS 132
             L    ++PII +   +      +   +L++ L  +    +  L  +   + +Y+R + 
Sbjct: 57  ANLAFIEMEPIIISLRKASGLQHLRFRSQLEVDLAHQA-EVEKILPRIVDVLNSYLRALE 115

Query: 133 IKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
           ++ +T        +  +  R+ +   QG V  ++   F++
Sbjct: 116 LEDLTDPMALPKLRAQMLRRINIAAGQGRVRDLLIMDFVL 155


>gi|75675316|ref|YP_317737.1| flagellar basal body-associated protein FliL [Nitrobacter
           winogradskyi Nb-255]
 gi|74420186|gb|ABA04385.1| Flagellar basal body-associated protein FliL [Nitrobacter
           winogradskyi Nb-255]
          Length = 162

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 25/183 (13%), Positives = 60/183 (32%), Gaps = 34/183 (18%)

Query: 1   MSYDDTTSQYIRGN----QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKF 56
           M+ +D T +   G+    + +  +   +      +  G +   +       Q  E     
Sbjct: 1   MAENDQTGKAADGDAPPARKRFKLIAAIGAALFLVTGGSIWFFMFHHSVGEQHAEAQ--- 57

Query: 57  ILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICK 109
                                K      +  ++ N   +P + ++       L++    +
Sbjct: 58  -------------------PPKPPSFVDVPDMLVNLVGAPGERVQYLKLKLVLEVKEEPQ 98

Query: 110 DIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRT 168
               +  L  +      Y+R +    + G+ G    KE++  RV  + S   V++V+F+ 
Sbjct: 99  VEKIRPALPRVTDLFQTYMRELRPSDLNGSAGLFRLKEELTRRVNAVLSPDHVNAVLFKE 158

Query: 169 FII 171
            +I
Sbjct: 159 VVI 161


>gi|74055040|gb|AAZ95845.1| FliL [Aeromonas hydrophila]
          Length = 171

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 22/181 (12%), Positives = 56/181 (30%), Gaps = 21/181 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D+  +        K  +   V    I +  G    +++        E   +      
Sbjct: 1   MADDNELTLKDPAAGKKKKLIMVVALAVIVLGGGAGAWLMLSGGDKPAAEAAAEGKDAKP 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKVF--- 116
             +                L +   +P + N         +++ I L+ +   D+     
Sbjct: 61  KEEA-----------VQPSLYVGMPRPFVFNVSGGQRDRLVQIKIQLMVRGAADETLAKQ 109

Query: 117 -LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +  +   ++      + +Q+   +G    ++D  E  +     L S   +  V+F  F+
Sbjct: 110 NIPLIEGTLLRVFSAATSEQLMTFEGKEKLRKDSLEECRRVLNDLVSSPVIEQVLFTGFV 169

Query: 171 I 171
           +
Sbjct: 170 M 170


>gi|146307838|ref|YP_001188303.1| flagellar basal body-associated protein FliL [Pseudomonas mendocina
           ymp]
 gi|145576039|gb|ABP85571.1| flagellar basal body-associated protein FliL [Pseudomonas mendocina
           ymp]
          Length = 173

 Score = 87.5 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 24/183 (13%), Positives = 58/183 (31%), Gaps = 23/183 (12%)

Query: 1   MSYDDTTSQY--IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+  +         G + KL +   +V   +      +GG   +     + ++       
Sbjct: 1   MAKKEAAPAADGQPGGKSKLKLIILIVVGLLLAVGLSIGGTWFILSKGDKADDAKPAEAA 60

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPD 113
           +               +    L    +   + NF+   +  +L++ +AL+ +D       
Sbjct: 61  SPAVP-----------VRQPALYQDLMPAFVVNFNHQGRTRYLQVSMALMSRDAAGVEKL 109

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRT 168
           KV +  L   ++  +       +    G     +     V+  +Q       V  V+F  
Sbjct: 110 KVHMPVLRNRLVMLLSGQDFAALQTPLGKEMLLQQALASVQELAQKETGSTVVEQVLFTN 169

Query: 169 FII 171
           F++
Sbjct: 170 FVL 172


>gi|262166228|ref|ZP_06033965.1| flagellar biosynthesis protein FliL [Vibrio mimicus VM223]
 gi|262025944|gb|EEY44612.1| flagellar biosynthesis protein FliL [Vibrio mimicus VM223]
          Length = 166

 Score = 87.1 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 55/181 (30%), Gaps = 26/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +  +       + KL +        +    G      M+    G+   + ++     
Sbjct: 1   MAEEQLSDAPK--GKKKLLIIIIAAVVLLAGGGG--AAFFMMGSGDGEAAAQAEQKAEQA 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                                +   QP + N         +++ + L+ +   ++     
Sbjct: 57  ATPAD------------PVSYVNIAQPFVFNVTGDDRDRLVQIKVQLMVRGSENENLARY 104

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++A   + +++Q+    G    ++   E +     +   +  +  V+F  F+
Sbjct: 105 HSPLVESTLLATFASATVEQLRTPNGRIELRDKATEDIKAALNQAVGKPIIEKVLFTDFV 164

Query: 171 I 171
           +
Sbjct: 165 M 165


>gi|88858102|ref|ZP_01132744.1| flagellar basal body-associated protein [Pseudoalteromonas tunicata
           D2]
 gi|88819719|gb|EAR29532.1| flagellar basal body-associated protein [Pseudoalteromonas tunicata
           D2]
          Length = 179

 Score = 87.1 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 59/181 (32%), Gaps = 13/181 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +        G + K  +   +    +    G     +M       +EE   +    +
Sbjct: 1   MADEKDLQIEEGGGKSKKMLFIIIAVVVLIAGGG-GAFFMMSGDDTPAQEETLAENASAD 59

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWL-----RLDIALICKDIPDKV 115
              +      + +      L +   +P + N   + +D L     +L +     +   K 
Sbjct: 60  GAKSEAADKSSAE--MGSALYVGMPRPFVFNVPGASRDRLVQIKVQLLVRGDVNEEAAKK 117

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +  +   +++   T +  +++ + G    +    + V+     +     V  ++F  F+
Sbjct: 118 HIPLIEGTLLSVFSTSNADELSTSAGKETLRTKALKNVQDTLTEIEGNKVVERILFTGFV 177

Query: 171 I 171
           +
Sbjct: 178 M 178


>gi|92116938|ref|YP_576667.1| flagellar basal body-associated protein FliL [Nitrobacter
           hamburgensis X14]
 gi|91799832|gb|ABE62207.1| flagellar basal body-associated protein FliL [Nitrobacter
           hamburgensis X14]
          Length = 190

 Score = 87.1 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 26/178 (14%), Positives = 56/178 (31%), Gaps = 32/178 (17%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +  +  +     ++ KL V    V   +G    W                          
Sbjct: 36  AAAEGDAPPAPRSRLKLIVAAVAVLCLVGGAGTWFFFF---------------------- 73

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDK 114
                      +    K      +  ++ N   +P + ++       L++    +    K
Sbjct: 74  --RHHGDESHAEAPPPKPPAFVDVPEMLVNLVGAPGERVQYLKVKVVLEVKDEPQVETIK 131

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
             L  +      Y+R +    + G+ G    KE++ +RV    S G V++V+F+  +I
Sbjct: 132 PALPRVTDLFQTYMRELRPSDLNGSAGLFRLKEELTKRVNTAISPGHVNAVLFKEVVI 189


>gi|258621110|ref|ZP_05716144.1| flagellar basal body-associated protein [Vibrio mimicus VM573]
 gi|258626184|ref|ZP_05721032.1| flagellar basal body-associated protein [Vibrio mimicus VM603]
 gi|262170886|ref|ZP_06038564.1| flagellar biosynthesis protein FliL [Vibrio mimicus MB-451]
 gi|258581539|gb|EEW06440.1| flagellar basal body-associated protein [Vibrio mimicus VM603]
 gi|258586498|gb|EEW11213.1| flagellar basal body-associated protein [Vibrio mimicus VM573]
 gi|261891962|gb|EEY37948.1| flagellar biosynthesis protein FliL [Vibrio mimicus MB-451]
          Length = 166

 Score = 87.1 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 55/181 (30%), Gaps = 26/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +  +       + KL +        +    G      M+    G+   + ++     
Sbjct: 1   MAEEQLSDAPK--GKKKLLIIIIAAVVLLAGGGG--AAFFMMGSGDGEAAAQAEQKAEQA 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                                +   QP + N         +++ + L+ +   ++     
Sbjct: 57  ATPAD------------PVSYVNIAQPFVFNVTGDDRDRLVQIKVQLMVRGSENENLARY 104

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++A   + +++Q+    G    ++   E +     +   +  +  V+F  F+
Sbjct: 105 HSPLVESSLLATFASATVEQLRTPSGRIELRDKATEDIKAALNQAVGKPVIEKVLFTDFV 164

Query: 171 I 171
           +
Sbjct: 165 M 165


>gi|224373005|ref|YP_002607377.1| flagellar basal body-associated protein FliL [Nautilia profundicola
           AmH]
 gi|223588699|gb|ACM92435.1| flagellar basal body-associated protein FliL [Nautilia profundicola
           AmH]
          Length = 173

 Score = 87.1 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 61/181 (33%), Gaps = 19/181 (10%)

Query: 1   MSYDDTT----SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKF 56
           M+ +        +   G    L +   V+   + I  G +   ++             + 
Sbjct: 1   MAEEKENQEVQEEKKEGGSKLLLIVIIVLLLILLIVGGLVAYFLLSGGD---------EE 51

Query: 57  ILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIP--- 112
             N   +              +   I+ L   I N   ++   +L+  I L         
Sbjct: 52  QANQPQEPQKIEKKKKVENMTEIGPIYPLDQFIVNLVSNNSSRYLKCKIDLELDSPELQQ 111

Query: 113 -DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
                L  +   I+  + + ++++I  A+G    KE+I+ ++  L + G +  V F  F+
Sbjct: 112 EVDKKLPAIRDLIIRILSSKTVEEIQTAKGKEKLKEEIKRKINELLTTGEIRHVYFTEFV 171

Query: 171 I 171
           I
Sbjct: 172 I 172


>gi|269961626|ref|ZP_06175988.1| flagellar basal body-associated protein [Vibrio harveyi 1DA3]
 gi|269833667|gb|EEZ87764.1| flagellar basal body-associated protein [Vibrio harveyi 1DA3]
          Length = 166

 Score = 86.8 bits (213), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 18/181 (9%), Positives = 54/181 (29%), Gaps = 26/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +          + KL +    V   +         ++                  + 
Sbjct: 1   MAEEQLQGADAPKGKSKLLIIIIAVVVLLIGGGAAAFFLMGS----------------DE 44

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV---- 115
               +        T +     +   QP I N     +   +++   L+ +   ++     
Sbjct: 45  PAQAAQTEQAQAQTAAAPIAYVNIAQPFIFNVTGDRRDRLVQIKAQLMVRGSENEQLARY 104

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFK----EDIEERVK-LRSQGFVSSVIFRTFI 170
               +   +++   + +++Q+    G    +    +DI+  +     +  +  V+F  F+
Sbjct: 105 HSPLIESSLLSTFASATVEQLRSPTGRTELRDRASDDIKAALNAAVGKPVIEKVLFTDFV 164

Query: 171 I 171
           I
Sbjct: 165 I 165


>gi|303246795|ref|ZP_07333072.1| flagellar basal body-associated protein FliL [Desulfovibrio
           fructosovorans JJ]
 gi|302491812|gb|EFL51692.1| flagellar basal body-associated protein FliL [Desulfovibrio
           fructosovorans JJ]
          Length = 190

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 59/189 (31%), Gaps = 18/189 (9%)

Query: 1   MSYD-DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+   +   +  +    K  +   ++    G          +    A  ++ K Q     
Sbjct: 1   MADAPEAPEEKKKSGFLKYVILVVLLLLLGGGGFFAYQYFFVAKPPATAEQAKEQAQAEE 60

Query: 60  NFYDNSVRSVHTGDTI-------------SLKKLQIFSLQPIITNFDSSP-KDWLRLDIA 105
              +                               + +L   + N      + +L++ ++
Sbjct: 61  KKAEEQHAPAEEKKAEGGHGEAQKGGHGGKEAPSNLVALPAFVVNLADPNARRYLKIVLS 120

Query: 106 LICKDIPD--KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVS 162
           +     P+  +     +   ++  + T + + ++  +G    +++I +R+     Q  V+
Sbjct: 121 VEMTGNPELLEANQAKIRDALLMLLSTKTSQDLSTLEGKILLRKEIVDRLNQAIGQAKVA 180

Query: 163 SVIFRTFII 171
            V F  F+I
Sbjct: 181 RVYFTDFVI 189


>gi|260767700|ref|ZP_05876635.1| flagellar biosynthesis protein FliL [Vibrio furnissii CIP 102972]
 gi|260617209|gb|EEX42393.1| flagellar biosynthesis protein FliL [Vibrio furnissii CIP 102972]
 gi|315179468|gb|ADT86382.1| flagellar basal body-associated protein FliL [Vibrio furnissii NCTC
           11218]
          Length = 165

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 22/181 (12%), Positives = 60/181 (33%), Gaps = 27/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   Q    ++ KL +        +    G    ++     A  K E  Q+     
Sbjct: 1   MAVEEL-PQDAPKSKKKLLIIIVAAVVLLLGGGGAAFFLMGSDSGADAKAETTQEAAA-- 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                                +   QP + N    +    +++ + L+ +   ++     
Sbjct: 58  --------------PVDPVSYVNIAQPFVFNVSGDTRDRMVQIKVQLMVRGSKNEGLARY 103

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++A   + +++Q+  A G    ++   + +     K+  Q  +  V+F  F+
Sbjct: 104 HSPLVESTLLATFASATVEQLRSATGRVELRDKATDDIKAAMTKVVGQPVIERVLFTDFV 163

Query: 171 I 171
           +
Sbjct: 164 M 164


>gi|77464891|ref|YP_354395.1| flagellar synthesis protein [Rhodobacter sphaeroides 2.4.1]
 gi|126463733|ref|YP_001044847.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides ATCC 17029]
 gi|77389309|gb|ABA80494.1| possible flagellar synthesis protein [Rhodobacter sphaeroides
           2.4.1]
 gi|126105397|gb|ABN78075.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 162

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 23/176 (13%), Positives = 51/176 (28%), Gaps = 20/176 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+            +  L +   VV   +    G+      L L A    E         
Sbjct: 1   MADAGADQIETTKKRSLLPLILGVVLALVLGGGGFYATWSGLILGASGGHEAETAHEA-- 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALIC---KDIPDKVF 116
                          +L  +    + PI+ +         LR    L           + 
Sbjct: 59  -------------PAALPDIAFVPIDPIVISLGRGSDLSHLRFAAQLEVAKANAAEVTML 105

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           +  +   I  Y+R V++ ++         +  +  R+++   +G V  ++   F++
Sbjct: 106 MPRIVDVINGYLRAVAVSRLEDPTALVELRAQMLRRIQIVTGEGRVRDLLVTEFVL 161


>gi|254470097|ref|ZP_05083501.1| flagellar basal body-associated protein FliL [Pseudovibrio sp.
           JE062]
 gi|211960408|gb|EEA95604.1| flagellar basal body-associated protein FliL [Pseudovibrio sp.
           JE062]
          Length = 165

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/177 (16%), Positives = 61/177 (34%), Gaps = 19/177 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  +    G   K  +    +   + +  G  G  VM              +I   
Sbjct: 1   MADAELQNTEDEGKSGKRKIVIGAIAGVLLLTLGVGGAYVM-------------DWINLG 47

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICKDI----PDKV 115
                 R+  T + I  K +  + L  +  N  +  +  +L++ IAL  +        + 
Sbjct: 48  DTATVKRADGTVEQIETKPVVFYDLPEMTVNLSTQGRTTYLKVRIALEVESDSMVSQVEP 107

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +L  +      Y+R +    + G+ G    KE +  R+        V  V+F+  +I
Sbjct: 108 YLPRILDAFQIYLRELRPADLEGSAGLFRLKEQLLRRINSAIYPAKVEGVLFKEILI 164


>gi|13472581|ref|NP_104148.1| hypothetical protein mlr2923 [Mesorhizobium loti MAFF303099]
 gi|14023327|dbj|BAB49934.1| mlr2923 [Mesorhizobium loti MAFF303099]
          Length = 164

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 47/171 (27%), Positives = 80/171 (46%), Gaps = 8/171 (4%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +   Q  +G    +     +V T   I  GW+ G  +    A        +     
Sbjct: 1   MANVEQL-QPRKGPSLVVQGAMLLVVTAAAIGMGWMSGGYLKGAGAPSSVPVAPENEGKV 59

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
              ++ +   TG T       + +L PI TN  S    W+R++++++          E +
Sbjct: 60  AEPDAAQQPGTGPT-------LVALAPITTNIASPADTWIRMEVSVVYDAPQPPAMTEDI 112

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           HQD++A++RTV + QI GA G+++ K DIEER  +RSQG    V+ RT ++
Sbjct: 113 HQDLLAFVRTVKMHQIEGASGYQHLKADIEERASIRSQGHAKQVLIRTLLL 163


>gi|239909252|ref|YP_002955994.1| flagellar FliL protein [Desulfovibrio magneticus RS-1]
 gi|239799119|dbj|BAH78108.1| flagellar FliL protein [Desulfovibrio magneticus RS-1]
          Length = 199

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 19/198 (9%), Positives = 53/198 (26%), Gaps = 27/198 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAG------------- 47
           M+      Q  +     +     VV   +    G+   +                     
Sbjct: 1   MADPAPEEQPKKKKSGLIKYIILVVLLLVLGGGGYFAYLTFFAAKPPAAAPPAEGAAPAE 60

Query: 48  --QKEEKYQKFILNNFYDNSVRSVHTGDT--------ISLKKLQIFSLQPIITNFDSSPK 97
             + +   +        +       +                    +L P + N      
Sbjct: 61  APKADAHAEAKPAEKKAEGGHGEAKSDAKGGGGHGGGKDKAASNNVALPPFVVNLADPNA 120

Query: 98  DW---LRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK 154
                + L++ +       +     +   ++  + + + + ++  +G    +++I +R+ 
Sbjct: 121 RRYLKVVLEVEVTSNPELLEDNKAKIRDALLMLLSSKTSQDLSTLEGKILLRKEIVDRLN 180

Query: 155 -LRSQGFVSSVIFRTFII 171
               Q  VS V F  F+I
Sbjct: 181 QAIGQPKVSRVYFTDFVI 198


>gi|319898642|ref|YP_004158735.1| flagellar basal body-associated protein FliL [Bartonella
           clarridgeiae 73]
 gi|319402606|emb|CBI76151.1| Flagellar basal body-associated protein FliL [Bartonella
           clarridgeiae 73]
          Length = 166

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 71/175 (40%), Gaps = 15/175 (8%)

Query: 1   MSYDDTTSQY--IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +    +    + N  K+F+   +V T +    GW  G  +            +    
Sbjct: 1   MAEEPKKEESIVQKENSVKIFLIVGLVLTLVAAISGWFLGAWVSREMVPISNSSKEP--- 57

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP--DKVF 116
                     V T + +      +  L PI+TN       W+R++++LI K     +   
Sbjct: 58  --------PVVKTPEYLVAADSHVVILPPILTNIAMPENAWIRMEVSLIIKPNENIEATL 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
              +  D + ++R V+I Q+ G  G    + D+ +R ++RS   VS+++  + ++
Sbjct: 110 TADISNDFLTFLRQVTIDQVKGPSGLMNLRADLLDRARIRSGNKVSNILISSLVV 164


>gi|308273525|emb|CBX30127.1| hypothetical protein N47_D29360 [uncultured Desulfobacterium sp.]
          Length = 171

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/181 (14%), Positives = 63/181 (34%), Gaps = 21/181 (11%)

Query: 1   MSYD---DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ +   +  ++  +  +  +     +  + + +      G  M        +    +  
Sbjct: 1   MAEESVANEEAKTEKAPKKSMLKWVIIACSVLVVGIAGFFGWSMFMKKGASGDSHKAEV- 59

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP--KDWLRLDIALICKDI---- 111
                     S   G+  S +   IF L+  I N   +   K +L++ + L   D     
Sbjct: 60  ----------SETHGEKKSEESRGIFPLESFIVNLMDTGTGKKYLKVTMELEVMDEIGKK 109

Query: 112 PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
             + +   L   I+  + + S ++I   +G    K+ +  R+     +  VS + F  F+
Sbjct: 110 KVEAYKTQLKDTILMLLSSRSYEEINTVEGKLDLKQALLARINQTMGENAVSKIYFTEFV 169

Query: 171 I 171
           +
Sbjct: 170 V 170


>gi|315453005|ref|YP_004073275.1| putative flagellar protein FliL [Helicobacter felis ATCC 49179]
 gi|315132057|emb|CBY82685.1| possible flagellar protein FliL [Helicobacter felis ATCC 49179]
          Length = 182

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/179 (16%), Positives = 64/179 (35%), Gaps = 13/179 (7%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
             ++  + ++  LFV    V   + +    +   +           K          +  
Sbjct: 3   EEAKAPKKSKAMLFVVMGAVLVMLILVGVIVFLFMSKNAEPNGNAPKSGGAAAQQMRNAQ 62

Query: 66  VRSVHTGDTISLKKLQIFSLQP-------IITNF-DSSPKDWLRLDIALICKD----IPD 113
           + +     ++ ++     SL P        + N    + + +L+  ++L   D       
Sbjct: 63  MNNNTDEGSLMVRSSDYLSLGPLYPLTGAFVVNLISQNGRRYLKASVSLELNDAKLLEEV 122

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           KV    +   I+  + + S+++IT  +G    KE+I   +      GFV +V F  F+I
Sbjct: 123 KVKETAIKDTIIEILSSKSVEEITTLKGKNRLKEEIRSNINSFLIDGFVKNVFFTDFVI 181


>gi|292493591|ref|YP_003529030.1| flagellar basal body-associated protein FliL [Nitrosococcus
           halophilus Nc4]
 gi|291582186|gb|ADE16643.1| flagellar basal body-associated protein FliL [Nitrosococcus
           halophilus Nc4]
          Length = 172

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 20/183 (10%), Positives = 54/183 (29%), Gaps = 24/183 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+        ++G          ++ T + +      G+V+    A   +    +   N 
Sbjct: 1   MTQSGELDLEVKGGGTSKKTLIILISTIVMLVVAIAVGVVLFLTGALTPKAATGEAAANP 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK---DWLRLDIALICKD----IPD 113
                              +        + NF    +    +L++ +  + +D       
Sbjct: 61  KAPQ------------HPAIYHSLDPAFVVNFYRQSQQQVRFLQVKMEAMARDSEIIEAI 108

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRT 168
           K     +  +++  +     + I   +G    +E   + +    +       V +V F +
Sbjct: 109 KTHTPAIRNNLLLLLSHQDYETIHTVEGKGQLREAARDEINQVLEDQAGIKGVEAVYFTS 168

Query: 169 FII 171
           FI+
Sbjct: 169 FIM 171


>gi|332994115|gb|AEF04170.1| flagellar basal body-associated protein FliL [Alteromonas sp. SN2]
          Length = 178

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 60/181 (33%), Gaps = 14/181 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   +     + K+ +   +    +    G     ++     G++    ++    +
Sbjct: 1   MAEEELQIEEGGKKKGKMMLIIIIAVVLV--GGGAAAYFLLF--AGGEEPVAAEQLAETD 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV---- 115
               +  +   G       L +   +P + N   + +   +++ + L+ +   ++     
Sbjct: 57  EQAATEAAAPGGSAEVGTALYVAMPRPFVFNVPGTGRDRLVQIKVQLLVRGSDNEELAKT 116

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +  +   ++    T +   +    G    +E     V+     +     V  V+F  F+
Sbjct: 117 HIPLIEGTLLQVFSTSNADDLVTEAGKIELREQAVTEVQKVLKDIAGSDVVERVLFTGFV 176

Query: 171 I 171
           +
Sbjct: 177 M 177


>gi|283955024|ref|ZP_06372531.1| possible flagellar protein [Campylobacter jejuni subsp. jejuni 414]
 gi|283793522|gb|EFC32284.1| possible flagellar protein [Campylobacter jejuni subsp. jejuni 414]
          Length = 178

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 18/178 (10%), Positives = 61/178 (34%), Gaps = 6/178 (3%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M  +    +  +     L +   ++   + +    +   ++    + + E K        
Sbjct: 1   MDDELENEETKKKKGGSLVIIIVILLFVLLLSIMGMIAWLISSSSSDESEVKEAPKEEAK 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKD----IPDKV 115
                V +     +       ++ L P   N    S   +++  I L             
Sbjct: 61  ADKPKVSAPTQRGSDFANIGPMYPLDPFTLNLLSDSGSRYVKCTIELEQNSELLKPELDK 120

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
            +  +   I+  +   + ++++  +G    K+++  ++  + + GF+ ++ F  F+++
Sbjct: 121 KVSVIRDIIIRVLTAKTFEEVSTQKGKERLKDELVGKINEILTDGFIKNIYFTDFVVS 178


>gi|288958673|ref|YP_003449014.1| flagellar basal body-associated protein [Azospirillum sp. B510]
 gi|288910981|dbj|BAI72470.1| flagellar basal body-associated protein [Azospirillum sp. B510]
          Length = 185

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/184 (13%), Positives = 66/184 (35%), Gaps = 13/184 (7%)

Query: 1   MSYDDTTSQ------YIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQ 54
           M+ +    +        +    K  V + V+   + I  G       L      KE+  +
Sbjct: 1   MAAESDAGELSTEGLPRKKFSGKKLVLFVVLPLVLLIGAGAGVYFSGLLDGLLGKEKPAE 60

Query: 55  KFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIP 112
           +       +    +       +      + L  ++ N ++  K   +L++ I++      
Sbjct: 61  EGEQAAAKEGDHGAEAGKGDAAHAAPIFYDLPDMLVNLNTGNKRPAFLKIKISIQLSKPE 120

Query: 113 D----KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFR 167
           D    +  L  +  +   Y+R + ++ + G+ G    ++++  R+   +    V  V+F+
Sbjct: 121 DVGAVEHVLPRIIDNFQVYLRELRLEDLRGSAGMYRLRQELLLRITAAAYPVKVKDVLFK 180

Query: 168 TFII 171
             ++
Sbjct: 181 EMLV 184


>gi|89069805|ref|ZP_01157140.1| flagellar basal body-associated protein FliL [Oceanicola granulosus
           HTCC2516]
 gi|89044606|gb|EAR50722.1| flagellar basal body-associated protein FliL [Oceanicola granulosus
           HTCC2516]
          Length = 162

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/176 (12%), Positives = 48/176 (27%), Gaps = 22/176 (12%)

Query: 1   MSYDDTTS-QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ +           + KL +   VV    G   G+      +     +  E  +     
Sbjct: 1   MTDETAEPDADAPPKKSKLPLLVGVVLALAGAGGGFFIVSSGMIGGGARATESAEPAA-- 58

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD-SSPKDWLRLDIALICKDIP---DKV 115
                            L  +    L PI+ +    S    L+    L            
Sbjct: 59  --------------PEPLAPVAFLPLDPIVISLPPRSGGGHLKFTAQLEVPPEELAQVAA 104

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFI 170
               +   +  Y+R V +  +         +  +  R+ +   +G V+ ++   F+
Sbjct: 105 IQPRIVDVLNGYLRAVDLGDLEDPAMLIRLRAQMLHRIGVVAGEGRVNDLLIMEFV 160


>gi|163732485|ref|ZP_02139930.1| flagellar basal body-associated protein FliL [Roseobacter litoralis
           Och 149]
 gi|161393845|gb|EDQ18169.1| flagellar basal body-associated protein FliL [Roseobacter litoralis
           Och 149]
          Length = 163

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 20/177 (11%), Positives = 47/177 (26%), Gaps = 21/177 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+              KL +    V   IG   G+      +              I   
Sbjct: 1   MTDATNEESTEPPKSGKLPLIIGAVLALIGGGGGFYAASSGM--------------IFAT 46

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-----KDWLRLDIALICKDIPDKV 115
                V       +     +    L+P+  +          +    L++         K 
Sbjct: 47  ESKEEVVEEEKKSSSEFSDISFLPLEPMTISMPRGSAYKHLRFRGELEVPKEY-AEDVKK 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
               +   +  Y+R + +  I         +  +  R+++    G V+ ++   F++
Sbjct: 106 VTPRVIDVLNGYLRALQVSDIEEPASLTRLRSQMLRRIQIVAGPGRVNDLLIMEFVL 162


>gi|189426343|ref|YP_001953520.1| flagellar basal body-associated protein FliL [Geobacter lovleyi SZ]
 gi|189422602|gb|ACD97000.1| flagellar basal body-associated protein FliL [Geobacter lovleyi SZ]
          Length = 183

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/182 (17%), Positives = 71/182 (39%), Gaps = 11/182 (6%)

Query: 1   MSYDDTTSQYI---RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ D+  +       G++ KLF+        + I    +  ++       +  +     +
Sbjct: 1   MAKDEQAAAEAPAEGGSKKKLFIIIGAAALVLVIAGVVVFMMMGKGDKKKEGADAQGAPV 60

Query: 58  LNNFYDNSVRSVHTGDTISLK--KLQIFSLQPIITNFDSSPK-DWLRLDIALICKD---- 110
               +  +  +   G   +       +FSL+P I N     +  +L++ + L        
Sbjct: 61  AEGGHGAAPPAAGGGHGGAAAPGVSTVFSLEPFIVNIYDGQELRYLKVKVELEMVSAAVK 120

Query: 111 IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTF 169
              +  L  +   I+  + T +++++   QG    +E+I   + K+ +QG VS V F  F
Sbjct: 121 PELEGRLAAIRDAILVVLTTKTLQEVQDVQGKNQLREEILTAISKIVAQGKVSKVYFTDF 180

Query: 170 II 171
           ++
Sbjct: 181 VV 182


>gi|297569681|ref|YP_003691025.1| flagellar basal body-associated protein FliL [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925596|gb|ADH86406.1| flagellar basal body-associated protein FliL [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 157

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 21/176 (11%), Positives = 56/176 (31%), Gaps = 32/176 (18%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           + D+      + ++   F+   V    +     +     +         E          
Sbjct: 7   APDNEEEVPQKKSKTLFFIIVGVALLLLAGGGFFTYTTFLAPPHDEDARE---------- 56

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDI----PDKVF 116
                              ++F+L+P + N      K +L++ IAL  +        K  
Sbjct: 57  ----------------PLGEMFALEPFVVNLADPTGKRYLKVQIALELESERAVENAKRA 100

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
              L   ++  +  +S +++   +G    ++++  R  +      V ++ F  F++
Sbjct: 101 EPKLRDTVITMLTALSFEEVMTPEGKIRIRDELLGRFNVVMRPDRVRNIYFTEFVV 156


>gi|254463414|ref|ZP_05076830.1| flagellar basal body-associated protein FliL [Rhodobacterales
           bacterium HTCC2083]
 gi|206680003|gb|EDZ44490.1| flagellar basal body-associated protein FliL [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 188

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/191 (12%), Positives = 62/191 (32%), Gaps = 24/191 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++      +     L +  FVV  F+ +  G   G +M        E+   + I  N
Sbjct: 1   MADEEEP----KKKLRLLKIILFVVGAFVVLGIGLGIGYLMFGPQKNSPEQLVAEIIERN 56

Query: 61  FYDN----------SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD 110
                           +         + +   F     +T      + +L++ I +  + 
Sbjct: 57  SQPASEEVTEEDVTPEKVSKDSPRDEVFQTLYFEFPGTLTTNLQGSRRFLQIGIGISTQY 116

Query: 111 IP-----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-----GF 160
                   +V +  +   ++  +   + + + G+   +   ED++  +    +     G 
Sbjct: 117 DNEILTNVEVHMPAVKAALLVTLSDYTEEDVVGSDARKALAEDLKNTINAEMERLEGFGG 176

Query: 161 VSSVIFRTFII 171
           V  V   ++I+
Sbjct: 177 VEGVHLTSYIM 187


>gi|291286232|ref|YP_003503048.1| flagellar basal body-associated protein FliL [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290883392|gb|ADD67092.1| flagellar basal body-associated protein FliL [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 177

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/175 (14%), Positives = 62/175 (35%), Gaps = 14/175 (8%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            D+ +S+  + +   L +   ++   I +      G +           + Q        
Sbjct: 8   KDEESSEGKKKSGGALKLIIVILLLLIILGVLGGAGYMFFMKPKPDAAAEVQPAKKAAAP 67

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD-----IPDKVF 116
              V+              ++ L+  I N   +    +LR+ + L   D         + 
Sbjct: 68  KKEVKEGGG-------IGSLYPLENFIVNMADTGGTRYLRVTLQLELDDTKKFAEALDMR 120

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
              L   I+  + +   ++++ AQG    K+++  R+  L ++G + ++ F  F+
Sbjct: 121 KPQLRDAILTVLASKRYEEVSSAQGKLILKQELLRRLNSLVTEGTIVNIYFTEFV 175


>gi|85715054|ref|ZP_01046039.1| Flagellar basal body-associated protein FliL [Nitrobacter sp.
           Nb-311A]
 gi|85698251|gb|EAQ36123.1| Flagellar basal body-associated protein FliL [Nitrobacter sp.
           Nb-311A]
          Length = 163

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/184 (13%), Positives = 59/184 (32%), Gaps = 35/184 (19%)

Query: 1   MSYDDTTSQYIRG-----NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQK 55
           M+ +D T +   G      +    +   V    I +  G +   +       Q       
Sbjct: 1   MAENDQTEKAADGDTPPTRKKFKLIIAVVGLALILVTGGSVWFFLFRHHGGEQ------- 53

Query: 56  FILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALIC 108
                            +    K      +  ++ N   +P + ++       L++    
Sbjct: 54  ---------------HAEAPPPKPPAFVDIPDMLVNLVGAPGERVQYLKVKVVLEVKEEP 98

Query: 109 KDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFR 167
           +    +  L  +      Y+R +    + G+ G    KE++  RV  + S   +++V+F+
Sbjct: 99  QAEKIRPALPRVTDLFQTYMRELRPSDLNGSAGLFRLKEELTRRVNEVISPDHINAVLFK 158

Query: 168 TFII 171
             +I
Sbjct: 159 EVVI 162


>gi|225181600|ref|ZP_03735041.1| flagellar basal body-associated protein FliL [Dethiobacter
           alkaliphilus AHT 1]
 gi|225167708|gb|EEG76518.1| flagellar basal body-associated protein FliL [Dethiobacter
           alkaliphilus AHT 1]
          Length = 159

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 56/177 (31%), Gaps = 25/177 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS  +  S   +G++  L +    V   +G+       +                   + 
Sbjct: 1   MSKAEENSAPKKGSRTNLLLAIVAVLALMGVVISVYALL------------------ADR 42

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICK----DIPDKV 115
                       + ++    Q   L     N   S +  +L+  I L  +        + 
Sbjct: 43  EEPLFGGGAQAEEEVAGPFRQFGPLD-FTVNLSDSGQRNYLKATITLAYEERRLAGELEE 101

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               +   I+  +R+ ++  ++   G    + ++ E V  + S G +  + F  F++
Sbjct: 102 RKAQIRDLIINTMRSKAVNDVSDGDGTEKLRGELIEEVNSVLSGGEIVEIYFTDFLV 158


>gi|218460349|ref|ZP_03500440.1| orfc; method: conceptual translation supplied by author (flil)
           [Rhizobium etli Kim 5]
          Length = 123

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 49/99 (49%), Positives = 70/99 (70%)

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVS 132
             IS +   +  L+PI +N     ++W+RL++AL+    PD    E +HQDI+AYIRTVS
Sbjct: 24  ARISTEANNVVQLEPITSNLAYPSENWVRLEVALLFNGPPDVKVSEDIHQDILAYIRTVS 83

Query: 133 IKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           ++QI G +GF+Y ++DI+ERV LRSQG VS V+FRTF+I
Sbjct: 84  LQQIEGPRGFQYLRDDIQERVDLRSQGRVSKVMFRTFVI 122


>gi|255523694|ref|ZP_05390660.1| flagellar basal body-associated protein FliL [Clostridium
           carboxidivorans P7]
 gi|255512563|gb|EET88837.1| flagellar basal body-associated protein FliL [Clostridium
           carboxidivorans P7]
          Length = 183

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 20/173 (11%), Positives = 52/173 (30%), Gaps = 8/173 (4%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
                 +G     F+   +V   I    G+ G          QK               +
Sbjct: 11  KNKTEKKGGNKIKFIAIGLVALIIVGAGGYFGYSKFAKDKGTQKTAAPAAVQTAQTTTQA 70

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDI-----PDKVFLET 119
             + +      +   +   L   + N      K +++  I +                  
Sbjct: 71  KTTQNQSYLEQIVSEKNIGLDECLVNLADEDGKRYVKTKIFVGYDKNSKLETELTEKKPL 130

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +   ++A +R+    +I   +     K ++ +++  L  +G +++V F   ++
Sbjct: 131 IRDAVIAVLRSKKAAEI-TPKNMDSLKMELIQKINPLLKKGQINNVYFSDLLV 182


>gi|156975424|ref|YP_001446331.1| flagellar basal body-associated protein FliL [Vibrio harveyi ATCC
           BAA-1116]
 gi|156527018|gb|ABU72104.1| hypothetical protein VIBHAR_03155 [Vibrio harveyi ATCC BAA-1116]
          Length = 166

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 18/181 (9%), Positives = 54/181 (29%), Gaps = 26/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +          + KL +    V   +         ++                  + 
Sbjct: 1   MAEEQLQGADAPKGKSKLLIIIIAVVVLLLGGGSAAFFLMGS----------------DE 44

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV---- 115
               +        T +     +   QP I N     +   +++   L+ +   ++     
Sbjct: 45  PAQAAQAEQTQAQTAAAPIAYVNIAQPFIFNVTGDRRDRLVQIKAQLMVRGSENEQLARY 104

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFK----EDIEERVK-LRSQGFVSSVIFRTFI 170
               +   +++   + +++Q+    G    +    +DI+  +     +  +  V+F  F+
Sbjct: 105 HSPLIESSLLSTFASATVEQLRSPTGRVELRDRASDDIKAALNAAVGKPVIEKVLFTDFV 164

Query: 171 I 171
           I
Sbjct: 165 I 165


>gi|145298352|ref|YP_001141193.1| flagellar basal body-associated protein FliL [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142851124|gb|ABO89445.1| Flagellar basal body-associated protein [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 172

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 18/182 (9%), Positives = 55/182 (30%), Gaps = 22/182 (12%)

Query: 1   MSYDDTTS-QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ D+  + +     + K  +    +   +    G     ++        +   +     
Sbjct: 1   MADDNELTLKDPAAGKKKKLIMIIALAVIVLAGGGAGAWFMLSGSDKPAADAAAEGADAK 60

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKVF-- 116
                               L +   +P + N         +++ + L+ +   D+    
Sbjct: 61  PKDTAPK-----------PSLYVGMPRPFVFNVSGGQRDRLVKIKVQLMVRGTADENLAK 109

Query: 117 --LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTF 169
             +  +   ++      + +Q+   +G    ++D  E  +     L S   +  V+F  F
Sbjct: 110 QNIPLIEGTLLRIFSAATSEQLMTFEGKEKLRKDSLEECRRVLGDLVSSPVIEQVLFTGF 169

Query: 170 II 171
           ++
Sbjct: 170 VM 171


>gi|57168948|ref|ZP_00368077.1| probable flagellar protein Cj1408 [Campylobacter coli RM2228]
 gi|305431536|ref|ZP_07400710.1| flagellar basal body-associated protein FliL [Campylobacter coli
           JV20]
 gi|57019614|gb|EAL56303.1| probable flagellar protein Cj1408 [Campylobacter coli RM2228]
 gi|304445343|gb|EFM37982.1| flagellar basal body-associated protein FliL [Campylobacter coli
           JV20]
          Length = 178

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 17/145 (11%), Positives = 51/145 (35%), Gaps = 6/145 (4%)

Query: 34  GWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF- 92
             +   ++    + + E K             V +     +       ++ L P   N  
Sbjct: 34  MGVIAWLISSSSSDESEVKAAPKEEAKTDKAKVTAPAQRGSDFANIGPMYPLDPFTLNLL 93

Query: 93  DSSPKDWLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKED 148
             S   +++  I L              +  +   I+  +   + ++++  +G    K++
Sbjct: 94  SDSGSRYVKCTIELEQNTELLKPELDKKVAVIRDIIIRTLTAKTFEEVSTQKGKERLKDE 153

Query: 149 IEERVK-LRSQGFVSSVIFRTFIIA 172
           +  ++  + + GF+ +V F  F+++
Sbjct: 154 LVGKINEILTDGFIKNVYFTDFVVS 178


>gi|153834120|ref|ZP_01986787.1| flagellar basal body-associated protein FliL [Vibrio harveyi HY01]
 gi|148869490|gb|EDL68488.1| flagellar basal body-associated protein FliL [Vibrio harveyi HY01]
          Length = 166

 Score = 84.8 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 18/181 (9%), Positives = 54/181 (29%), Gaps = 26/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +          + KL +    V   +         ++                  + 
Sbjct: 1   MAEEQLQGADAPKGKSKLLIIIIAVVVLLLGGGAAAFFLMGS----------------DE 44

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV---- 115
               +        T +     +   QP I N     +   +++   L+ +   ++     
Sbjct: 45  PAQAAQAEQTQAQTAAAPIAYVNIAQPFIFNVTGDRRDRLVQIKAQLMVRGSENEQLARY 104

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFK----EDIEERVK-LRSQGFVSSVIFRTFI 170
               +   +++   + +++Q+    G    +    +DI+  +     +  +  V+F  F+
Sbjct: 105 HSPLIESSLLSTFASATVEQLRSPTGRVELRDRASDDIKAALNAAVGKPVIEKVLFTDFV 164

Query: 171 I 171
           I
Sbjct: 165 I 165


>gi|307721362|ref|YP_003892502.1| flagellar basal body-associated protein FliL [Sulfurimonas
           autotrophica DSM 16294]
 gi|306979455|gb|ADN09490.1| flagellar basal body-associated protein FliL [Sulfurimonas
           autotrophica DSM 16294]
          Length = 184

 Score = 84.8 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 22/183 (12%), Positives = 62/183 (33%), Gaps = 12/183 (6%)

Query: 1   MSYDDTTSQ--YIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ ++ T +    +     + +   +V   + I  G +  ++++            +   
Sbjct: 1   MAEEEQTEESAPKKKKSSNMLMIIIIVVLVLIIIIGTVVAVLLMGSDEEAVTNNAPQAQE 60

Query: 59  N----NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPD 113
                     S  S    D        ++ L     N    + + +L+  ++L       
Sbjct: 61  KRVDNQKTRRSASSSSLSDRKLSDIGVLYPLDTFTVNLKSDAGRRYLKATMSLELDSPEL 120

Query: 114 ----KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRT 168
                     L   I+  + + ++++I+  +G +   E I + +  + + G +  + F  
Sbjct: 121 SHELDSKAPVLRDRIIRILSSKTLEEISSKKGKQKVSEQIMDILNSMITDGQIKGIYFTE 180

Query: 169 FII 171
           F+I
Sbjct: 181 FVI 183


>gi|218887302|ref|YP_002436623.1| flagellar basal body-associated protein FliL [Desulfovibrio
           vulgaris str. 'Miyazaki F']
 gi|218758256|gb|ACL09155.1| flagellar basal body-associated protein FliL [Desulfovibrio
           vulgaris str. 'Miyazaki F']
          Length = 171

 Score = 84.4 bits (207), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 18/177 (10%), Positives = 49/177 (27%), Gaps = 13/177 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +    +   G    + +   ++    G   G     VM                   
Sbjct: 1   MAEEAAPPKKKSGKLKWIILILLLLLLGGGGGGGAYWWFVMRP-------AAQNAEGAPE 53

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDI----PDKV 115
                 ++   G     +  ++  L   + N      + +L+L + +           + 
Sbjct: 54  PAKAEGKADAKGGEAPARNAKVAKLPTFLVNLADPTGRRYLKLTMEVEVGSDATVKELEG 113

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               +   ++  + + S   +   +     K ++ ER+  +     V  V     +I
Sbjct: 114 QSAKVRDAVILLLSSKSYADLAPIESKLQLKNEVAERLNQILGGPKVLRVYITEMVI 170


>gi|59712453|ref|YP_205229.1| flagellar basal body-associated protein FliL [Vibrio fischeri
           ES114]
 gi|197334475|ref|YP_002156672.1| flagellar basal body-associated protein FliL [Vibrio fischeri MJ11]
 gi|59480554|gb|AAW86341.1| flagellar basal body-associated protein FliL1 [Vibrio fischeri
           ES114]
 gi|197315965|gb|ACH65412.1| flagellar basal body-associated protein FliL [Vibrio fischeri MJ11]
          Length = 161

 Score = 84.4 bits (207), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 57/181 (31%), Gaps = 31/181 (17%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+      +  +       +    +   + I  G      M    A +  E+    +  N
Sbjct: 1   MAEQGDVPKGKKK-----LMIIIALVALLLIGGGVAAWFFMSSEPAPEPTEQDIAALEAN 55

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                           +  L +   QP I N         ++L + ++ +   ++     
Sbjct: 56  ----------------MPALYLNLPQPFIFNVTGDKRDRLVQLKVQVMMRGTDNEAVAKQ 99

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
               +   +++     +++Q+   +G    +E     ++     + ++  V  V+F  F+
Sbjct: 100 HTPLIESALLSTFAAATVEQLREPRGRIELREQATRDIQDAFTKITAKPVVEKVLFTDFV 159

Query: 171 I 171
           +
Sbjct: 160 M 160


>gi|84388117|ref|ZP_00991013.1| flagellar basal body-associated protein [Vibrio splendidus 12B01]
 gi|84377184|gb|EAP94054.1| flagellar basal body-associated protein [Vibrio splendidus 12B01]
          Length = 162

 Score = 84.4 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 23/181 (12%), Positives = 54/181 (29%), Gaps = 30/181 (16%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +       +G    L +   VV   +GI          L       E + Q      
Sbjct: 1   MAEEQD---APKGKSKLLIIIIAVVVLLLGIGGALFFF---LGSDDSASESQSQPATAVV 54

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
             +                + +   QP + N         +++   L+ +   ++     
Sbjct: 55  AAE--------------PVMYVNIPQPFLFNVTGDKKDRLVQIKAQLMVRGSKNEDLARY 100

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++A   + ++ Q+    G    ++   E +     +   Q  +  V+F  F+
Sbjct: 101 HSPLVESTLLATFASATVDQLRSPTGRIELRDKATEDIKASLAQAVGQPVIEKVLFTDFV 160

Query: 171 I 171
           I
Sbjct: 161 I 161


>gi|291277313|ref|YP_003517085.1| flagellar protein [Helicobacter mustelae 12198]
 gi|290964507|emb|CBG40359.1| possible flagellar protein [Helicobacter mustelae 12198]
          Length = 168

 Score = 84.4 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 30/176 (17%), Positives = 64/176 (36%), Gaps = 14/176 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +   ++  +G    L      V  F+ I    +  ++M       K+E         
Sbjct: 1   MAEE---AKQEKGKSKALLFVILGVVVFLIIVIALVVMLLMGGEKQEAKQEVPAASKTQA 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI----PDKVF 116
                   +  G   S+ K  I +L         S + +L+  I     +       +  
Sbjct: 58  PGTKDTSLLSIGPLYSMPKPFIVNL------VTQSGRRYLKTSITFELSNPKLQQEVEQK 111

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              L   I+  + + SI++I   +G    K++I +RV  +   G++ ++ F  F++
Sbjct: 112 TSILQDIIIDVLSSKSIEEIVTTKGKERIKDEILQRVNQILVDGYMKNIFFTEFVV 167


>gi|124516302|gb|EAY57810.1| putative flagellar basal body-associated protein FliL
           [Leptospirillum rubarum]
 gi|206603145|gb|EDZ39625.1| Putative flagellar basal body-associated protein FliL
           [Leptospirillum sp. Group II '5-way CG']
          Length = 168

 Score = 84.4 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/171 (15%), Positives = 52/171 (30%), Gaps = 27/171 (15%)

Query: 9   QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRS 68
                N  KL +    V   +G         +        +     K +      +    
Sbjct: 16  AKPPRNIKKLVLAGVAVLALLGGG---AFFFLKHGHKNDSQVAMTPKEMEKMIKAHP--- 69

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDI----PDKVFLETLH 121
                        I  L+P + N +++      +L++ IA    +          +  + 
Sbjct: 70  -------------IIDLKPFVVNLNTASAENSRYLKVRIAFKLDNPQVAKEVDYRMPEIQ 116

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
             I+  + + +   +    G    +  I  RV  + + G VSSV F  F+I
Sbjct: 117 NIILILLGSETADDLGTTGGKLALRNQIRHRVNSILTLGRVSSVYFTEFVI 167


>gi|329888224|ref|ZP_08266822.1| flagellar fliL protein [Brevundimonas diminuta ATCC 11568]
 gi|328846780|gb|EGF96342.1| flagellar fliL protein [Brevundimonas diminuta ATCC 11568]
          Length = 220

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 23/186 (12%), Positives = 53/186 (28%), Gaps = 18/186 (9%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           +D  +   +     LF+        +G        ++         +             
Sbjct: 34  EDGEAAPAKKKIPLLFIIIPAALVVLGGGGATAFLLMKPKSAEAAGDHAAPAKEEKKEKK 93

Query: 64  NS-----------VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD 110
                                      +  ++L  +I N  S+     +L+L + L  KD
Sbjct: 94  EGGGHGGGAKEGEAAEGAGKIAAGPDGVTFYTLPDMIVNIQSADGRPTYLKLRLTLEMKD 153

Query: 111 IPDKVF----LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVI 165
                        +      ++R +  + + G+ G    + +I  RV L  + G V +V+
Sbjct: 154 AAVASHLQAEAPRMQDMFQGFLRELRPEDLAGSAGSYQLRAEILRRVNLIAAPGKVDAVL 213

Query: 166 FRTFII 171
               ++
Sbjct: 214 IEEMLV 219


>gi|254418238|ref|ZP_05031962.1| flagellar basal body-associated protein FliL [Brevundimonas sp.
           BAL3]
 gi|196184415|gb|EDX79391.1| flagellar basal body-associated protein FliL [Brevundimonas sp.
           BAL3]
          Length = 225

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 25/200 (12%), Positives = 59/200 (29%), Gaps = 30/200 (15%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIV-------------MLFLFAGQ 48
           + +       +     LF+   V    +G        ++                    +
Sbjct: 25  AAEGEEGAPKKKKLPMLFIIAPVALLVLGGGGAAAFFLMKPKPAEAHGEEAAAAGHGEEK 84

Query: 49  KEEKYQKFILNNFYDNSVRSVHTGDTISLKK----------LQIFSLQPIITNFDSSPKD 98
            EEK          +            +             +  ++L  ++ N  S+   
Sbjct: 85  AEEKGGHGKEEKKAEGGGHGAPAEGGEADPALGKISEGPDGVTFYTLPDMVMNIQSADGR 144

Query: 99  --WLRLDIALICKDIPDKVF----LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER 152
             +L+L + L   D          +  L      ++R +  + ++G+ G    + +I  R
Sbjct: 145 PTFLKLKLTLEMHDAEVATHLQSEMPRLQDMFTGFVRELRPEDLSGSAGTYQLRAEILRR 204

Query: 153 VKLR-SQGFVSSVIFRTFII 171
           V L  + G V +V+    ++
Sbjct: 205 VNLVAAPGKVDAVLIEEMLV 224


>gi|88813207|ref|ZP_01128447.1| Flagellar basal body-associated protein FliL [Nitrococcus mobilis
           Nb-231]
 gi|88789529|gb|EAR20656.1| Flagellar basal body-associated protein FliL [Nitrococcus mobilis
           Nb-231]
          Length = 173

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 17/163 (10%), Positives = 55/163 (33%), Gaps = 17/163 (10%)

Query: 19  FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLK 78
            +   ++     I  G + G+       G +         +   D+              
Sbjct: 17  LIIVLILVVAALIGVGSVAGLYYSGYLGGNQAATAVAADASATEDS-------VSAPRKP 69

Query: 79  KLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSI 133
            + +     ++ NF+   +  +L+  + L+ ++       +  L  +   ++  + T S 
Sbjct: 70  PIYLPLEPALVVNFNRRGRVGYLQAGLQLMAREQSVIDAAQANLPMIRNSLLILLSTQSY 129

Query: 134 KQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
           ++++  +     ++   + V        + G + +V F  F++
Sbjct: 130 EELSSRESMERLRQKTLDEVNSVLDRVDAPGHIEAVYFTAFVM 172


>gi|260466614|ref|ZP_05812802.1| flagellar basal body-associated protein FliL [Mesorhizobium
           opportunistum WSM2075]
 gi|259029620|gb|EEW30908.1| flagellar basal body-associated protein FliL [Mesorhizobium
           opportunistum WSM2075]
          Length = 144

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 42/150 (28%), Positives = 72/150 (48%), Gaps = 7/150 (4%)

Query: 22  WFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQ 81
             +V T   I  GW+ G  +  + A        +         +     TG T       
Sbjct: 1   MLLVVTAAAIGMGWMSGGYLKGVGAPSSVPAAPENEGKTAEPAATHEPGTGST------- 53

Query: 82  IFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQG 141
           +  L PI TN  S  + WLR++++++          E +HQD++A++RT+ + QI GA G
Sbjct: 54  LVVLAPITTNIASPAETWLRMEVSVVYDAPQPPAMSEDIHQDLLAFVRTLKMHQIEGASG 113

Query: 142 FRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +++ K D++ER  +RSQG    V+ RT ++
Sbjct: 114 YQHLKADLDERASIRSQGHAKQVLIRTLLL 143


>gi|296186697|ref|ZP_06855099.1| flagellar basal body-associated protein FliL [Clostridium
           carboxidivorans P7]
 gi|296048734|gb|EFG88166.1| flagellar basal body-associated protein FliL [Clostridium
           carboxidivorans P7]
          Length = 174

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 20/173 (11%), Positives = 52/173 (30%), Gaps = 8/173 (4%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
                 +G     F+   +V   I    G+ G          QK               +
Sbjct: 2   ENKTEKKGGNKIKFIAIGLVALIIVGAGGYFGYSKFAKDKGTQKTAAPAAVQTAQTTTQA 61

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDI-----PDKVFLET 119
             + +      +   +   L   + N      K +++  I +                  
Sbjct: 62  KTTQNQSYLEQIVSEKNIGLDECLVNLADEDGKRYVKTKIFVGYDKNSKLETELTEKKPL 121

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +   ++A +R+    +I   +     K ++ +++  L  +G +++V F   ++
Sbjct: 122 IRDAVIAVLRSKKAAEI-TPKNMDSLKMELIQKINPLLKKGQINNVYFSDLLV 173


>gi|109947384|ref|YP_664612.1| flagellar basal body-associated protein FliL [Helicobacter
           acinonychis str. Sheeba]
 gi|109714605|emb|CAJ99613.1| flagellar protein FliL [Helicobacter acinonychis str. Sheeba]
          Length = 183

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 63/182 (34%), Gaps = 11/182 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +   +      + K  +   +    + +    +  ++++      KE   +      
Sbjct: 1   MAEEQENTAQQPPKKSKTLLFVIIGSVLVMLLLVGVIIMLLMGNKEESKENAPKNAQEVQ 60

Query: 61  FYDNSVRSVHTGDTI------SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI--- 111
               + ++    +         L  L        +     + + +L+  I+L   +    
Sbjct: 61  ANPMANKNQEAKEGSNIQQYLVLGPLYAIDTPFAVNLVSQNGRRYLKASISLELSNEKLL 120

Query: 112 -PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
              KV    +   I+  + + S++++   +G    K++I+  +      GF+ +V F  F
Sbjct: 121 NEVKVKDTAIKDTIIEILSSKSVEEVVTNKGKNKLKDEIKSHLNSFLIDGFIKNVFFTDF 180

Query: 170 II 171
           II
Sbjct: 181 II 182


>gi|253702498|ref|YP_003023687.1| flagellar basal body-associated protein FliL [Geobacter sp. M21]
 gi|251777348|gb|ACT19929.1| flagellar basal body-associated protein FliL [Geobacter sp. M21]
          Length = 172

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 25/177 (14%), Positives = 58/177 (32%), Gaps = 12/177 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +        KLF+    V   + I  G      +       ++      +   
Sbjct: 1   MAEQAKDTPPKD--NKKLFIIIGAVVAVLAIGGGA----ALFLGGGKGEKGAEGAKVEAK 54

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDI----PDKV 115
                  +       +     I+ ++P I N     +  +L++ +     +       + 
Sbjct: 55  AEGGGHGAPAKEGEGAAAGATIYPMEPFIVNIYDGAELRYLKVKVEFEMANPQVKPELEA 114

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
            +  L   I+  + T ++++I   QG    +E I   V K+     ++ V F  F++
Sbjct: 115 KMAPLRDAILILLTTKTMQEIQDLQGKNQLREQILAAVSKVVPPSKITKVYFTDFVV 171


>gi|319406981|emb|CBI80618.1| Flagellar basal body-associated protein FliL [Bartonella sp. 1-1C]
          Length = 166

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 73/175 (41%), Gaps = 15/175 (8%)

Query: 1   MSYDDTTSQY--IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +    +    R +  K+F+    V T +    GW  G  +    A       +    
Sbjct: 1   MAEESKKEENIVQRESSIKVFLIVGFVLTLVAAVSGWFLGAWVSREMAPTSSNLKE---- 56

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP--DKVF 116
                  +    T + +      I +L PI+TN       W+R++++L+ K     +   
Sbjct: 57  -------LPMTKTPENLIAADSHIVTLPPILTNIAVPENAWIRMEVSLVIKPDENIESTL 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
              +  D +A++R V+I Q+ G  G    + D+ +R ++RS   VS+++  + ++
Sbjct: 110 TADISNDFLAFLRQVTIDQVKGPSGLMNLRADLLDRARVRSDNKVSNILISSLVV 164


>gi|110677674|ref|YP_680681.1| flagellar basal body-associated protein FliL [Roseobacter
           denitrificans OCh 114]
 gi|109453790|gb|ABG29995.1| flagellar basal body-associated protein FliL [Roseobacter
           denitrificans OCh 114]
          Length = 163

 Score = 83.7 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 19/177 (10%), Positives = 46/177 (25%), Gaps = 21/177 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+              KL +    V   IG   G+      +              I   
Sbjct: 1   MTDATNEESAEAPKSGKLPLIVGAVLAIIGGGGGFYAASSGM--------------IFAT 46

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-----KDWLRLDIALICKDIPDKV 115
                        +     +    L+P+  +          +    L++         K 
Sbjct: 47  ESKKETVEEEKETSNEFSDISFLPLEPMTISMPRDSAYKHLRFRGELEVPKEY-AEDIKK 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
               +   +  Y+R + +  I         +  +  R+++    G V+ ++   F++
Sbjct: 106 VTPRIIDVLNGYLRALQVADIEEPASLTRLRSQMLRRIQIVAGPGRVNDLLIMEFVL 162


>gi|319403966|emb|CBI77554.1| Flagellar basal body-associated protein FliL [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 166

 Score = 83.7 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 73/175 (41%), Gaps = 15/175 (8%)

Query: 1   MSYDDTTSQY--IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +    +    R +  K+F+    V T +    GW  G  +    A       +    
Sbjct: 1   MAEESKKEENIVQRESSIKVFLIVGFVLTLVAAVSGWFLGAWVSREMAPTSSNLKE---- 56

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP--DKVF 116
                  +    T + +      I +L PI+TN       W+R++++L+ K     +   
Sbjct: 57  -------LPMTKTPENLIAADSHIVTLPPILTNIAVPENAWIRMEVSLVIKPDENIEATL 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
              +  D +A++R V+I Q+ G  G    + D+ +R ++RS   VS+++  + ++
Sbjct: 110 TADISNDFLAFLRQVTIDQVKGPSGLMNLRADLLDRARVRSGNKVSNILISSLVV 164


>gi|78777038|ref|YP_393353.1| flagellar basal body-associated protein FliL [Sulfurimonas
           denitrificans DSM 1251]
 gi|78497578|gb|ABB44118.1| Flagellar basal body-associated protein FliL [Sulfurimonas
           denitrificans DSM 1251]
          Length = 187

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 18/152 (11%), Positives = 52/152 (34%), Gaps = 13/152 (8%)

Query: 33  CGWLGGIVMLFLFAGQKEE-------KYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSL 85
            G     +++     ++           +    +    +   S  T +    +   ++ L
Sbjct: 35  GGAAIAFLLMGGDEKEQVAQQNIEQSAEKTQQKSASTRSREDSDDTDNRKFSQIGILYPL 94

Query: 86  QPIITNF-DSSPKDWLRLDIALICKDIPD----KVFLETLHQDIMAYIRTVSIKQITGAQ 140
                N    + + +L+  I+L                 +   I+  + + ++++I+  +
Sbjct: 95  DTFTVNLKSDAGRRYLKTTISLELNGKELSMELDSKAPVIRDRIIRILTSKTLEEISSKK 154

Query: 141 GFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           G +   E I + +  + S G +  + F  F+I
Sbjct: 155 GKQKISEQIMDTLNSMISDGSIKGIYFTEFVI 186


>gi|121602600|ref|YP_989395.1| flagellar basal body-associated protein FliL [Bartonella
           bacilliformis KC583]
 gi|120614777|gb|ABM45378.1| flagellar basal body-associated protein FliL [Bartonella
           bacilliformis KC583]
          Length = 165

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 72/175 (41%), Gaps = 16/175 (9%)

Query: 1   MSYDDTTSQYI--RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M  +    +    + N  K  +   ++ T I    GW   + +             + I 
Sbjct: 1   MDKEPKQEEATVNKDNSVKTLLIVGLILTLIAGAAGWFLSLWVS------------QEIR 48

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLE 118
                +   S+    +  +       L P++TN  S  K W+R++IALI K        E
Sbjct: 49  QTSGASKDSSIAIPASKIMADTHTVVLPPLVTNMASPEKAWIRVEIALIVKSGETISSTE 108

Query: 119 T--LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
              +  D +A++R ++I Q+ G  G  + + D+ +R K+RS   +S+++    +I
Sbjct: 109 VANISSDFLAFLRQITIDQVKGPSGLMHLRSDLFDRAKIRSGDKISNILISNLVI 163


>gi|298530628|ref|ZP_07018030.1| flagellar basal body-associated protein FliL [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510002|gb|EFI33906.1| flagellar basal body-associated protein FliL [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 167

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 14/119 (11%), Positives = 36/119 (30%), Gaps = 6/119 (5%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALIC----KDIPD 113
                              +   +  L+P + N      + +LR  + +           
Sbjct: 48  EQRDSEPDDPDAPEQDERPRDTVMVELEPFVVNLADPLGRRYLRTTLEVEAVNRSAANEL 107

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +     +   I+  + + + + +         + +I ER+  +  Q  V  V F  F++
Sbjct: 108 EDQRPQVRDAILLLLSSKTFEDLRTMDRKINLRNEIVERINQVIGQNKVYKVYFTEFVV 166


>gi|148256790|ref|YP_001241375.1| flagellar basal body-associated protein FliL [Bradyrhizobium sp.
           BTAi1]
 gi|146408963|gb|ABQ37469.1| Flagellar basal body-associated protein FliL [Bradyrhizobium sp.
           BTAi1]
          Length = 164

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 55/168 (32%), Gaps = 30/168 (17%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
             ++ KL +    V   +GI                                +     H 
Sbjct: 18  PKSKLKLIIMIVGVLALLGIGGAAYFFFF----------------------SHKNDEHHA 55

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLETLHQDI 124
               + K      +  ++ N   +P D ++       L++    +    K  L  +    
Sbjct: 56  EAAPAPKPPAFVEVPDLLVNLVGNPGDRVQYLKVKIVLEVKEEKQVEHIKPTLPRVTDIF 115

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
             Y+R +    + G+ G    KE++ +RV +  +   V++V+F+  ++
Sbjct: 116 QTYLRELRPSDLNGSAGLFRLKEELTKRVNVALAPNQVNAVLFKEIVV 163


>gi|332140588|ref|YP_004426326.1| flagellar basal body-associated protein FliL [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327550610|gb|AEA97328.1| flagellar basal body-associated protein FliL [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 179

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 57/181 (31%), Gaps = 13/181 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   +     + K+ +   +    +    G     ++      +   +        
Sbjct: 1   MADEELQVEDGGKKKGKMMLIIIIAVVLV--GGGAAAYFLLF-AGGDEPAAEQLAETDAA 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV---- 115
               +  +   G+      L +   +P + N   S +   +++ + L+ +   ++     
Sbjct: 58  AAAATAPAAGPGNAEMGTALYVAMPRPFVFNVPGSGRDRLVQIKVQLLVRGSDNEELAKT 117

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +  +   ++    T +   +    G    +E     V+     +     V  V+F  F+
Sbjct: 118 HIPLIEGTLLQAFSTSNADDLVTEAGKIELREQAVSEVQKALKDITGSDVVERVLFTGFV 177

Query: 171 I 171
           +
Sbjct: 178 M 178


>gi|54308122|ref|YP_129142.1| flagellar basal body-associated protein FliL [Photobacterium
           profundum SS9]
 gi|46912548|emb|CAG19340.1| hypothetical flagellar protein FliL [Photobacterium profundum SS9]
          Length = 164

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 19/181 (10%), Positives = 54/181 (29%), Gaps = 28/181 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D   +    G++ KLF+   +  T +         ++                    
Sbjct: 1   MADDVENT----GSKKKLFILIALAVTLLIGAGVAAWFLMGDDTPESGMAATSANQQ--- 53

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                         +      +   QP I N         +++ + L+ +   ++     
Sbjct: 54  -----------VSAVVEPAYYVIMPQPFIFNVVGDKRDRVVQVKVQLMVRGNNNEALAQQ 102

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +  +   ++      +++Q+    G    ++     ++     +  Q  V  V+F  F+
Sbjct: 103 HIPLIESTLLQSFGAATVEQLRTPNGRIDLRKQALFAIQSSMEKISGQQVVDRVLFTGFV 162

Query: 171 I 171
           +
Sbjct: 163 M 163


>gi|94987084|ref|YP_595017.1| flagellar basal body-associated protein [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731333|emb|CAJ54696.1| Flagellar basal body-associated protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 189

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/141 (14%), Positives = 44/141 (31%), Gaps = 9/141 (6%)

Query: 37  GGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS- 95
                L    G      ++    N  +    S  T     LK     SL  +  N     
Sbjct: 51  ATFKHLLEGGGNPGTSQEQSDNANKKEGGKGSSPTDPKPLLKP---VSLPSVTVNLADPS 107

Query: 96  PKDWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEE 151
              +LR+ + +                 +   I+  + + +  ++  A+G    K ++  
Sbjct: 108 GSKYLRIGMDVELSSEEAITNLLTQSARVRDAIILLLSSKTSDELVSAEGKVLLKNEVAS 167

Query: 152 RVK-LRSQGFVSSVIFRTFII 171
           R+  +  +  V  + F  F+I
Sbjct: 168 RLNQILGEPRVVRIYFTDFVI 188


>gi|221640812|ref|YP_002527074.1| Flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides KD131]
 gi|221161593|gb|ACM02573.1| Flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides KD131]
          Length = 162

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/176 (12%), Positives = 50/176 (28%), Gaps = 20/176 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+            +  L +   VV   +    G+      L L A              
Sbjct: 1   MADAGADQIETTKKRSLLPLILGVVLALVLGGGGFYATWSGLILGAS------------- 47

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALIC---KDIPDKVF 116
                          +L  +    + PI+ +         LR    L           + 
Sbjct: 48  --GGHEAEPAHEAPAALPDIAFVPIDPIVISLGRGSDLSHLRFAAQLEVPKANAAEVTML 105

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           +  +   I  Y+R V++ ++         +  +  R+++   +G V  ++   F++
Sbjct: 106 MPRIVDVINGYLRAVAVSRLEDPTALVELRAQMLRRIQIVTGEGRVRDLLVTEFVL 161


>gi|239997090|ref|ZP_04717614.1| flagellar basal body-associated protein FliL [Alteromonas macleodii
           ATCC 27126]
          Length = 179

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 56/181 (30%), Gaps = 13/181 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   +     + K+ +   +    +    G     ++      +   +        
Sbjct: 1   MAEEELQVEEGGKKKGKMMLIIIIAVVLL--GGGAAAYFLLF-AGGDEPAAEQLAETDAA 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV---- 115
               S  +   G       L +   +P + N   + +   +++ + L+ +   ++     
Sbjct: 58  AAAASAPASAAGKAEMGTALYVAMPRPFVFNVPGAGRDRLVQIKVQLLVRGSDNEELAKT 117

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +  +   ++    T +   +    G    +E     V+     +     V  V+F  F+
Sbjct: 118 HIPLIEGTLLQAFSTSNADDLVTEAGKIELREQAVTEVQKALKDITGSDVVERVLFTGFV 177

Query: 171 I 171
           +
Sbjct: 178 M 178


>gi|110632651|ref|YP_672859.1| flagellar basal body-associated protein FliL [Mesorhizobium sp.
           BNC1]
 gi|110283635|gb|ABG61694.1| flagellar basal body-associated protein FliL [Chelativorans sp.
           BNC1]
          Length = 150

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 43/153 (28%), Positives = 69/153 (45%), Gaps = 5/153 (3%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           +     +V T +    GWL G  +      ++    Q                  +  + 
Sbjct: 1   MQAAALLVMTALAGGMGWLTGAYL-----EERSASGQSENAGKTEVAVQEGQEGNEPDNE 55

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQIT 137
               I +L PI TN       W+R+++AL+ +   D     T+HQD+ AYIRT+ +KQI 
Sbjct: 56  SLSSIVALDPITTNLAEPTSIWVRMELALVFEGESDPTLARTIHQDLFAYIRTLRLKQIE 115

Query: 138 GAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFI 170
            A GF++ K DI ER ++RS   V  V+  +F+
Sbjct: 116 SASGFQHLKSDILERARIRSDDRVKQVLIMSFL 148


>gi|283853448|ref|ZP_06370692.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           FW1012B]
 gi|283571168|gb|EFC19184.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           FW1012B]
          Length = 198

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/197 (11%), Positives = 61/197 (30%), Gaps = 26/197 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLF---------AGQKEE 51
           M+      +  + +    ++   V+   +G    +                    GQ   
Sbjct: 1   MANAPEAPEGKKKSGFLKYIILVVLLLVLGGGGYFAYLKFFAAKPAATDAAAPAEGQPAP 60

Query: 52  KYQKFILNNFYDNSVRSVHTGDTISL-------------KKLQIFSLQPIITNFDSSP-K 97
           + QK    +      +    G   +                    +L P + N      +
Sbjct: 61  EAQKAEDGHAAKPEEKKAEGGHGEAKGGEAKGGHGGKDKAPSNNVALPPFVVNLADPNAR 120

Query: 98  DWLRLDIALICKDIPD--KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK- 154
            +L++ + +     P+  +     +   ++  + + + + +   +G    +++I +R+  
Sbjct: 121 RYLKIVLDVEMTGNPELLEANQAKIRDSLLMLLSSKTSQDLATLEGKILLRKEIVDRLNQ 180

Query: 155 LRSQGFVSSVIFRTFII 171
              Q  V+ V F  F+I
Sbjct: 181 ALGQAKVARVYFTDFVI 197


>gi|255261645|ref|ZP_05340987.1| flagellar basal body-associated protein FliL [Thalassiobium sp.
           R2A62]
 gi|255103980|gb|EET46654.1| flagellar basal body-associated protein FliL [Thalassiobium sp.
           R2A62]
          Length = 168

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/172 (13%), Positives = 52/172 (30%), Gaps = 18/172 (10%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           D TS+       KL +   +V    G   G+L       L + Q+               
Sbjct: 9   DATSESASKKSGKLPMIIGLVLAIAGGVGGFLAVDNGFILNSEQQV-------------V 55

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALIC---KDIPDKVFLETL 120
           +           L ++    L+P++ +     +   LR    L          +     +
Sbjct: 56  ADGYSSDQARTVLPEVAFVVLEPLVISLPHPTRRQHLRFSAQLEVVPDYQAQVEAIKPRI 115

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
              +  Y+R V +  +         +  +  R+++      V  ++   FI+
Sbjct: 116 VDVLNGYLRAVDVADLEDLSALTRLRAQMLRRIQVVTGPEQVRDLLIMEFIL 167


>gi|146282920|ref|YP_001173073.1| flagellar basal body-associated protein FliL [Pseudomonas stutzeri
           A1501]
 gi|145571125|gb|ABP80231.1| flagellar protein FliL [Pseudomonas stutzeri A1501]
 gi|327481260|gb|AEA84570.1| flagellar basal body-associated protein FliL [Pseudomonas stutzeri
           DSM 4166]
          Length = 177

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/176 (12%), Positives = 57/176 (32%), Gaps = 22/176 (12%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T        + +L +   +V   +      +GG +         E    +          
Sbjct: 13  TGPDAAPAGKGRLKLIILIVVAMLVAVGLSVGGTLYFMSKGDDLEGSKTQEAA------- 65

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKVFLETL 120
                T  +     +    +   + NF+   +  ++++ IAL+ +D       KV +  L
Sbjct: 66  -----TTVSGKQPAIYEVLMPAFVVNFNHKGRQRYMQVSIALMSRDQAALDALKVHMPLL 120

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
              ++  + +   + +    G    ++     V+  +Q       +  V+F  F++
Sbjct: 121 RNRLVMLLSSQDFEALKTPVGKEMLRQQATASVQELAQKEIGKLAIEQVLFTNFVL 176


>gi|46201207|ref|ZP_00055553.2| COG1580: Flagellar basal body-associated protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 181

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/173 (11%), Positives = 60/173 (34%), Gaps = 18/173 (10%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           + S   +    K+ +    +   +G   G     ++  L               + +  +
Sbjct: 19  SDSPSKKPPIKKILMIVLPILLLVGAGAGVYFSGLLDKLTGK-----------KDEHAPA 67

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD------WLRLDIALICKDIPDKVFLET 119
             +       +++      L  ++ N  ++ +        + L++  +      +  L  
Sbjct: 68  AEAAPPPPPKAVQAASFMDLPEMLVNLQTTGRKQAFLKLRVALELEAVTDQPRVEQMLPR 127

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +  +   Y+R + ++ + GA G    +E++  RV        V+ V+F+  ++
Sbjct: 128 IIDNFQIYLRELRVEDLQGASGMHLLREELLTRVNAAVKPVKVNDVLFKEMLV 180


>gi|312962267|ref|ZP_07776759.1| flagellar basal body-associated protein FliL [Pseudomonas
           fluorescens WH6]
 gi|311283604|gb|EFQ62193.1| flagellar basal body-associated protein FliL [Pseudomonas
           fluorescens WH6]
          Length = 168

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 60/182 (32%), Gaps = 26/182 (14%)

Query: 1   MSY-DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  +D  +      + KL +   +V   +      +GG   +   +  K     +   N
Sbjct: 1   MAKSEDAATAPAGKGKGKLKLILMIVVGLLLAIGASVGGTWYIMHSSASKPAPVAEAATN 60

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDK 114
                               +    L   + NF+ + +  +L++ I L+ ++       K
Sbjct: 61  AKQPA---------------IFEPMLPAFVANFNQNGRQRYLQVSITLLARNQADLEALK 105

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTF 169
           V +  +  +++      S   +    G    ++ +   V+  +Q       +   +F  F
Sbjct: 106 VHMPVIRNNLVMLFSGQSFDTLATPVGQEMLRQKVTASVQEVAQKELGKVVIEQALFTNF 165

Query: 170 II 171
           ++
Sbjct: 166 VL 167


>gi|225628630|ref|ZP_03786664.1| flagellar protein FliL [Brucella ceti str. Cudo]
 gi|237816669|ref|ZP_04595661.1| flagellar protein FliL [Brucella abortus str. 2308 A]
 gi|294853181|ref|ZP_06793853.1| flagellar basal body-associated protein FliL [Brucella sp. NVSL
           07-0026]
 gi|225616476|gb|EEH13524.1| flagellar protein FliL [Brucella ceti str. Cudo]
 gi|237787482|gb|EEP61698.1| flagellar protein FliL [Brucella abortus str. 2308 A]
 gi|294818836|gb|EFG35836.1| flagellar basal body-associated protein FliL [Brucella sp. NVSL
           07-0026]
          Length = 166

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 63/173 (36%), Gaps = 13/173 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS                 +    V T I    GW  G ++                 + 
Sbjct: 4   MSDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMIS-----------AGQQASA 52

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLE 118
                      G   S     +  LQPIITN       W+RL+ +L+ K           
Sbjct: 53  KPSGKEDKPKPGSFESRSIGAVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIPPAMAA 112

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 113 NVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 165


>gi|23499921|ref|NP_699361.1| flagellar protein FliL [Brucella suis 1330]
 gi|62317107|ref|YP_222960.1| flagellar protein FliL [Brucella abortus bv. 1 str. 9-941]
 gi|83269099|ref|YP_418390.1| flagellar basal body-associated protein FliL [Brucella melitensis
           biovar Abortus 2308]
 gi|148557885|ref|YP_001257217.1| putative flagellar protein FliL [Brucella ovis ATCC 25840]
 gi|161620241|ref|YP_001594127.1| flagellar basal body-associated protein FliL [Brucella canis ATCC
           23365]
 gi|189022372|ref|YP_001932113.1| Flagellar basal body-associated protein FliL [Brucella abortus S19]
 gi|225686017|ref|YP_002733989.1| flagellar basal body-associated protein FliL [Brucella melitensis
           ATCC 23457]
 gi|254691407|ref|ZP_05154661.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           6 str. 870]
 gi|254695295|ref|ZP_05157123.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           3 str. Tulya]
 gi|254698390|ref|ZP_05160218.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254702581|ref|ZP_05164409.1| flagellar basal body-associated protein FliL [Brucella suis bv. 3
           str. 686]
 gi|254706287|ref|ZP_05168115.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M163/99/10]
 gi|254711419|ref|ZP_05173230.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis B2/94]
 gi|254731837|ref|ZP_05190415.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           4 str. 292]
 gi|256014947|ref|YP_003104956.1| flagellar protein FliL, putative [Brucella microti CCM 4915]
 gi|256029951|ref|ZP_05443565.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M292/94/1]
 gi|256043078|ref|ZP_05446022.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256059604|ref|ZP_05449802.1| flagellar basal body-associated protein FliL [Brucella neotomae
           5K33]
 gi|256111938|ref|ZP_05452889.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 3 str. Ether]
 gi|256158113|ref|ZP_05456031.1| flagellar basal body-associated protein FliL [Brucella ceti
           M490/95/1]
 gi|256252933|ref|ZP_05458469.1| flagellar basal body-associated protein FliL [Brucella ceti B1/94]
 gi|256256593|ref|ZP_05462129.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           9 str. C68]
 gi|256262860|ref|ZP_05465392.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 2 str. 63/9]
 gi|260544346|ref|ZP_05820167.1| flagellar basal body-associated protein FliL [Brucella abortus NCTC
           8038]
 gi|260564308|ref|ZP_05834793.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. 16M]
 gi|260568511|ref|ZP_05838980.1| flagellar basal body-associated protein FliL [Brucella suis bv. 4
           str. 40]
 gi|260757021|ref|ZP_05869369.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           6 str. 870]
 gi|260759607|ref|ZP_05871955.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           4 str. 292]
 gi|260762849|ref|ZP_05875181.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260882831|ref|ZP_05894445.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           9 str. C68]
 gi|261215664|ref|ZP_05929945.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           3 str. Tulya]
 gi|261220024|ref|ZP_05934305.1| flagellar basal body-associated protein FliL [Brucella ceti B1/94]
 gi|261313731|ref|ZP_05952928.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M163/99/10]
 gi|261319027|ref|ZP_05958224.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis B2/94]
 gi|261323571|ref|ZP_05962768.1| flagellar basal body-associated protein FliL [Brucella neotomae
           5K33]
 gi|261753161|ref|ZP_05996870.1| flagellar basal body-associated protein FliL [Brucella suis bv. 3
           str. 686]
 gi|265986970|ref|ZP_06099527.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M292/94/1]
 gi|265989516|ref|ZP_06102073.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265993385|ref|ZP_06105942.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 3 str. Ether]
 gi|265996630|ref|ZP_06109187.1| flagellar basal body-associated protein FliL [Brucella ceti
           M490/95/1]
 gi|297249949|ref|ZP_06933650.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           5 str. B3196]
 gi|23463498|gb|AAN33366.1| flagellar protein FliL, putative [Brucella suis 1330]
 gi|62197300|gb|AAX75599.1| hypothetical FliL, flagellar protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82939373|emb|CAJ12323.1| Flagellar basal body-associated protein FliL [Brucella melitensis
           biovar Abortus 2308]
 gi|148369170|gb|ABQ62042.1| putative flagellar protein FliL [Brucella ovis ATCC 25840]
 gi|161337052|gb|ABX63356.1| flagellar basal body-associated protein FliL [Brucella canis ATCC
           23365]
 gi|189020946|gb|ACD73667.1| Flagellar basal body-associated protein FliL [Brucella abortus S19]
 gi|225642122|gb|ACO02035.1| flagellar basal body-associated protein FliL [Brucella melitensis
           ATCC 23457]
 gi|255997607|gb|ACU49294.1| flagellar protein FliL, putative [Brucella microti CCM 4915]
 gi|260097617|gb|EEW81491.1| flagellar basal body-associated protein FliL [Brucella abortus NCTC
           8038]
 gi|260151951|gb|EEW87044.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. 16M]
 gi|260155176|gb|EEW90257.1| flagellar basal body-associated protein FliL [Brucella suis bv. 4
           str. 40]
 gi|260669925|gb|EEX56865.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           4 str. 292]
 gi|260673270|gb|EEX60091.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260677129|gb|EEX63950.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           6 str. 870]
 gi|260872359|gb|EEX79428.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           9 str. C68]
 gi|260917271|gb|EEX84132.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           3 str. Tulya]
 gi|260918608|gb|EEX85261.1| flagellar basal body-associated protein FliL [Brucella ceti B1/94]
 gi|261298250|gb|EEY01747.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis B2/94]
 gi|261299551|gb|EEY03048.1| flagellar basal body-associated protein FliL [Brucella neotomae
           5K33]
 gi|261302757|gb|EEY06254.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M163/99/10]
 gi|261742914|gb|EEY30840.1| flagellar basal body-associated protein FliL [Brucella suis bv. 3
           str. 686]
 gi|262550927|gb|EEZ07088.1| flagellar basal body-associated protein FliL [Brucella ceti
           M490/95/1]
 gi|262764255|gb|EEZ10287.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 3 str. Ether]
 gi|263000185|gb|EEZ12875.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|263092695|gb|EEZ16904.1| flagellar basal body-associated protein FliL [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264659167|gb|EEZ29428.1| flagellar basal body-associated protein FliL [Brucella
           pinnipedialis M292/94/1]
 gi|297173818|gb|EFH33182.1| flagellar basal body-associated protein FliL [Brucella abortus bv.
           5 str. B3196]
 gi|326410340|gb|ADZ67404.1| Flagellar basal body-associated protein FliL [Brucella melitensis
           M28]
 gi|326553632|gb|ADZ88271.1| Flagellar basal body-associated protein FliL [Brucella melitensis
           M5-90]
          Length = 163

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 63/173 (36%), Gaps = 13/173 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS                 +    V T I    GW  G ++                 + 
Sbjct: 1   MSDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMIS-----------AGQQASA 49

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLE 118
                      G   S     +  LQPIITN       W+RL+ +L+ K           
Sbjct: 50  KPSGKEDKPKPGSFESRSIGAVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIPPAMAA 109

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 110 NVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|90423019|ref|YP_531389.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisB18]
 gi|90105033|gb|ABD87070.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisB18]
          Length = 159

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/176 (15%), Positives = 59/176 (33%), Gaps = 32/176 (18%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           +D   +    ++ KLF+    V   + I  G     +       ++  K +         
Sbjct: 7   EDKDGEAAPKSKRKLFIIVGAVVGVLLIGGGT--WFMFFRGHGAEETHKVE--------- 55

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVF 116
                        + K     +  +  N    P + ++       L++         K  
Sbjct: 56  -------------VVKPVFIDVPEMTINLAGMPGERIQYLRVKVVLEVKDEKAVEQIKPT 102

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
           +  +      Y+R +    I+G+ G    KE++  RV L  + G V+ V+F+  +I
Sbjct: 103 MPRVTDIFQTYLRELRSSDISGSAGLFRLKEEMLRRVNLAVAPGVVNVVLFKEVVI 158


>gi|306846273|ref|ZP_07478834.1| flagellar basal body-associated protein FliL [Brucella sp. BO1]
 gi|306273268|gb|EFM55137.1| flagellar basal body-associated protein FliL [Brucella sp. BO1]
          Length = 163

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 63/173 (36%), Gaps = 13/173 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS                 +    V T I    GW  G ++                 + 
Sbjct: 1   MSDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMIS-----------AGQQASA 49

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLE 118
                      G   +     +  LQPIITN       W+RL+ +L+ K           
Sbjct: 50  KPSGKEDKPKPGSFEARSIGAVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIPPAMAA 109

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 110 NVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|119476311|ref|ZP_01616662.1| flagellar protein [marine gamma proteobacterium HTCC2143]
 gi|119450175|gb|EAW31410.1| flagellar protein [marine gamma proteobacterium HTCC2143]
          Length = 176

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/186 (12%), Positives = 62/186 (33%), Gaps = 26/186 (13%)

Query: 1   MSYDDT-----TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQK 55
           M+ ++        +  +    KL +   V+ T + I     G + +L  F   +    + 
Sbjct: 1   MAQENEQLTNDDGEIGKTGGSKLTLIAIVLATLLAIAASIGGTLYLLGFFDVDEVLSDED 60

Query: 56  FILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD- 113
                       +V   +T     +          NF +  +  +L++D+A++ +D    
Sbjct: 61  Q-----------TVEVDNTRPRPAMYFPIKPAFTVNFPTRGRQRYLQVDVAVLTRDPEVF 109

Query: 114 ---KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVI 165
              +  L  +   ++         ++   +G    ++   E +     +      V  ++
Sbjct: 110 NALQTHLPLVKNRLIMLFGGEVYDELQTDEGKELLRQKALEVLQEIIKQEVGVNGVEEIL 169

Query: 166 FRTFII 171
           F  F++
Sbjct: 170 FTNFVM 175


>gi|291280093|ref|YP_003496928.1| flagellar FliL protein [Deferribacter desulfuricans SSM1]
 gi|290754795|dbj|BAI81172.1| flagellar FliL protein [Deferribacter desulfuricans SSM1]
          Length = 170

 Score = 82.1 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 40/100 (40%), Gaps = 6/100 (6%)

Query: 77  LKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTV 131
                ++SL   I N        +L++ + L           +     +   I+  + + 
Sbjct: 69  PAIGPLYSLDTFIVNLADPGGTRYLKVTMQLELDSEKVQEEMEKRKPQIRDVILTVLSSK 128

Query: 132 SIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
           +  +++ AQG    K+++  R+  + + G V ++ F  F+
Sbjct: 129 TYAEVSTAQGKLALKQELIRRINLILTTGSVKNIYFTEFV 168


>gi|322379504|ref|ZP_08053869.1| Flagellar biosynthesis protein [Helicobacter suis HS1]
 gi|322380300|ref|ZP_08054516.1| flagellar basal body-associated protein FliL [Helicobacter suis
           HS5]
 gi|321147283|gb|EFX41967.1| flagellar basal body-associated protein FliL [Helicobacter suis
           HS5]
 gi|321148059|gb|EFX42594.1| Flagellar biosynthesis protein [Helicobacter suis HS1]
          Length = 185

 Score = 82.1 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/179 (16%), Positives = 62/179 (34%), Gaps = 8/179 (4%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGI--VMLFLFAGQKEEKYQKFIL 58
           M+ +   ++  +     +     V+   +G+    L G          G +  + ++   
Sbjct: 6   MADEVKEAKKSKAFLFVVIGAVLVMLILVGVIAILLLGRNDKKSEGDTGNRMRQIREASK 65

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDI----PD 113
            N        +                 P + N    + + +L+  I+L   D       
Sbjct: 66  LNDNGGQSDLMVKSSDYLSLGPLYPLSDPFVVNLIAQNGRRYLKTSISLELSDPKLVEEV 125

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           KV    +   I+  + + SI++I+  +G    KE+I   +      GF+ +V F  F+I
Sbjct: 126 KVKETAIKDTIIEILSSKSIEEISTLKGKNKLKEEIRSNINSFLIDGFIKNVFFTDFVI 184


>gi|332559790|ref|ZP_08414112.1| FliL2 [Rhodobacter sphaeroides WS8N]
 gi|332277502|gb|EGJ22817.1| FliL2 [Rhodobacter sphaeroides WS8N]
          Length = 162

 Score = 82.1 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/176 (12%), Positives = 50/176 (28%), Gaps = 20/176 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+            +  L +   VV   +    G+      L L A              
Sbjct: 1   MADAGADQIETTKKRSLLPLILGVVLALVLGGGGFYATWSGLILGAS------------- 47

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALIC---KDIPDKVF 116
                          +L  +    + PI+ +         LR    L           + 
Sbjct: 48  --GGHEAEPAHEAPAALPDIAFVPIDPIVISLGRGSDLSHLRFAAQLEVAKANAAEVTML 105

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           +  +   I  Y+R V++ ++         +  +  R+++   +G V  ++   F++
Sbjct: 106 MPRIVDVINGYLRAVAVSRLEDPTALVELRAQMLRRIQIVTGEGRVRDLLVTEFVL 161


>gi|308182965|ref|YP_003927092.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           PeCan4]
 gi|261839376|gb|ACX99141.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           52]
 gi|308065150|gb|ADO07042.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           PeCan4]
          Length = 183

 Score = 82.1 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/182 (13%), Positives = 64/182 (35%), Gaps = 11/182 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +   +      + K  +   +    + +    +  ++++      KE   +      
Sbjct: 1   MAEEQENTAQQPQKKSKALLFVIIGSVLVMLLLVGVIIMLLMGNKEESKENASKNTQEVQ 60

Query: 61  FYDNSVRSVHTGDTI------SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI--- 111
               + ++  T +         L  L        +     + + +L+  I+L   +    
Sbjct: 61  ANPMANKNQETKEGSNIQQYLVLGPLYAIDAPFAVNLVSQNGRRYLKASISLELSNEKLL 120

Query: 112 -PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
              KV    +   I+  + + S++++   +G    K++I+  +      GF+ +V F  F
Sbjct: 121 NEVKVKDTAIKDTIIEILSSKSVEEVVTNKGKNKLKDEIKSHLNSFLIDGFIKNVFFTDF 180

Query: 170 II 171
           II
Sbjct: 181 II 182


>gi|330445372|ref|ZP_08309024.1| flagellar basal body-associated FliL family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328489563|dbj|GAA03521.1| flagellar basal body-associated FliL family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 159

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 20/168 (11%), Positives = 52/168 (30%), Gaps = 23/168 (13%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
            + KL +    V   +        G  +L      + ++  +          V S +   
Sbjct: 4   GKKKLMIISAAVVVLLLAGG---IGFWLLSGDDAAEPQQAAEVAQQGAVKAPVMSAY--- 57

Query: 74  TISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV----FLETLHQDIMAYI 128
                   +   QP   N     +   +++ + L+ +   ++         +   ++   
Sbjct: 58  -------YVVLPQPFTFNVTGDSRDRVVQIKVQLMVRGDKNEALAKQHTPLIESTLLQAF 110

Query: 129 RTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
              +++Q+    G    ++   E      VK+     V  V+F  F++
Sbjct: 111 GVATVEQLRNPNGRDQLRQQALEAVKATMVKVAGTPAVERVLFTGFVM 158


>gi|91714690|gb|ABE54616.1| flagellar basal body-associated protein FliL [Shewanella
           denitrificans OS217]
          Length = 200

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/181 (10%), Positives = 59/181 (32%), Gaps = 19/181 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +++      G      V +  +   + +  G     +M    A          + + 
Sbjct: 28  MADEESLELKNEGKGKSKLVLFGGIGLVLVLVIGAGLWFLMGSSDAP---------VADP 78

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD----KV 115
             D S  +         +   I   +P + N   + +   + + + L+ +   D    + 
Sbjct: 79  DSDPSSAAAPAVKAPVAEANYISMPRPFLFNLPGADRPRIVEIKVQLMVRGSDDGTLTQK 138

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +  +   ++       +++++   G    ++     V+     +  +  V  V+F  F+
Sbjct: 139 HIPLIEDALLTTFSGADVQKLSTQAGKDELRQLALLNVQNTLQPVIGRTVVEKVLFTGFV 198

Query: 171 I 171
           +
Sbjct: 199 M 199


>gi|160876171|ref|YP_001555487.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS195]
 gi|160861693|gb|ABX50227.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS195]
 gi|315268367|gb|ADT95220.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS678]
          Length = 174

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/184 (10%), Positives = 57/184 (30%), Gaps = 24/184 (13%)

Query: 1   MSYDDT---TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ +++    +     ++ KLF+   V      +  G L   +     A    +   + I
Sbjct: 1   MAKEESLELENTEAPKSKKKLFIFIGVGVLVALLIAGALWFFLGSSEDAATPTDGAVQTI 60

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK-- 114
                                   +   +P + N     +   + + + L+ +   D   
Sbjct: 61  TPAESGA-----------LTTASYVPMPRPFLFNLPGPDRARLVEIKVQLMVRGTDDDVL 109

Query: 115 --VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFR 167
               +  +   ++       +++++   G    ++     V+     +  +  V  V+F 
Sbjct: 110 TQKHIPLIEDALLTTFSGADVQKLSTQAGKDELRQLALLSVQNTLQSVTGRKVVEKVLFT 169

Query: 168 TFII 171
            F++
Sbjct: 170 GFVM 173


>gi|259417047|ref|ZP_05740966.1| flagellar basal body-associated protein FliL [Silicibacter sp.
           TrichCH4B]
 gi|259345953|gb|EEW57767.1| flagellar basal body-associated protein FliL [Silicibacter sp.
           TrichCH4B]
          Length = 185

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/170 (11%), Positives = 54/170 (31%), Gaps = 11/170 (6%)

Query: 8   SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVR 67
                  + K+ +   +V    G   G+      L  F  +        +     +    
Sbjct: 20  ETDEPAKKSKMPLIIGLVLGIAGAGGGFFAVQSGLLPFGNKPA----PEVAQVTKEAPEG 75

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSP-----KDWLRLDIALICKDIPDKVFLETLHQ 122
                    +  L    ++PI+   + +      +   +L++         +  L  +  
Sbjct: 76  VDKGESAEEIANLAFIEMEPIVVTLNRASGVQQLRFRAQLEVN-QADQAEVETVLPRVVD 134

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
            + +Y+R + ++ +T        +  +  R+ +   QG V  ++   F++
Sbjct: 135 VLNSYLRALELEDLTDPMALPKLRAQMLRRINIVTGQGRVRDLLIMDFVL 184


>gi|15887893|ref|NP_353574.1| flagellar protein [Agrobacterium tumefaciens str. C58]
 gi|1086566|gb|AAB68973.1| orfC; Method: conceptual translation supplied by author
           [Agrobacterium tumefaciens]
 gi|2459719|gb|AAB71795.1| FliL [Agrobacterium tumefaciens]
 gi|15155485|gb|AAK86359.1| flagellar protein [Agrobacterium tumefaciens str. C58]
          Length = 166

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 85/168 (50%), Gaps = 4/168 (2%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  ++  + +   +     VV   +    G      M+      K    +         
Sbjct: 2   ENEQAEGKKKSSPLVMTIAGVVILTLLGAGGGWLVGGMIAP----KVAATEAHATAAAGG 57

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
           +  +     D I  +   I  L PI TN      +W+RL++AL+ K   +    E +HQD
Sbjct: 58  HGEKKGEGLDKIDAEANGIVQLDPITTNLAYPSTNWVRLEVALMFKGPVEVGLAEDIHQD 117

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           IMAY+RTVS++Q+ G +GF+Y K+DI+ERV LRSQG VS V+FRTF+I
Sbjct: 118 IMAYVRTVSLQQLEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTFVI 165


>gi|306841044|ref|ZP_07473768.1| flagellar basal body-associated protein FliL [Brucella sp. BO2]
 gi|306288933|gb|EFM60233.1| flagellar basal body-associated protein FliL [Brucella sp. BO2]
          Length = 163

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 63/173 (36%), Gaps = 13/173 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS                 +    V T I    GW  G ++                 + 
Sbjct: 1   MSDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMIS-----------AGQQASA 49

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLE 118
                      G   +     +  LQPIITN       W+RL+ +L+ K           
Sbjct: 50  KPSGKEDKPKRGSFEARSIGAVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIPPAMAA 109

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 110 NVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|217034144|ref|ZP_03439564.1| hypothetical protein HP9810_868g37 [Helicobacter pylori 98-10]
 gi|216943428|gb|EEC22884.1| hypothetical protein HP9810_868g37 [Helicobacter pylori 98-10]
          Length = 183

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 63/182 (34%), Gaps = 11/182 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +   +      + K  +   +    + +    +  ++++      KE   +      
Sbjct: 1   MAEEQENTAQQPPKKSKALLFVIIGSVLVMLLLVGVIIMLLMGNKEESKENASKNAQEVQ 60

Query: 61  FYDNSVRSVHTGDTI------SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI--- 111
               + ++    +         L  L        +     + + +L+  I+L   +    
Sbjct: 61  ANPMANKNQEAKEGSNIQQYLVLGPLYAIDAPFAVNLVSQNGRRYLKASISLELSNEKLL 120

Query: 112 -PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
              KV    +   I+  + + S++++   +G    K++I+  +      GF+ +V F  F
Sbjct: 121 NEVKVKDTAIKDTIIEILSSKSVEEVVTNKGKNKLKDEIKSHLNSFLIDGFIKNVFFTDF 180

Query: 170 II 171
           II
Sbjct: 181 II 182


>gi|78224293|ref|YP_386040.1| flagellar basal body-associated protein FliL [Geobacter
           metallireducens GS-15]
 gi|78195548|gb|ABB33315.1| Flagellar basal body-associated protein FliL [Geobacter
           metallireducens GS-15]
          Length = 174

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/176 (15%), Positives = 61/176 (34%), Gaps = 11/176 (6%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           + ++ +++    N+  LF+        I            +     +K E  +  +    
Sbjct: 3   AEENASAEGAPKNKKMLFIIIGAAAVVIIALAVVF-----MGGKKEKKGEGAEAKVEQKA 57

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDI----PDKVF 116
                 S    +  +     IF ++P I N     +  +LR+ +             ++ 
Sbjct: 58  EGGGAASSGGKEGAAGAAANIFPMEPFIVNIYDGQELRYLRVKVEFETASADAKKEIELR 117

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              L   I+  + T +++ +   QG    +++I   V  +   G VS V F  F++
Sbjct: 118 QAPLRDAILVLLTTKTLQDVQDLQGKNQLRDEIMVAVNKILPPGKVSKVYFTDFVV 173


>gi|254458621|ref|ZP_05072046.1| flagellar basal body-associated protein FliL [Campylobacterales
           bacterium GD 1]
 gi|207084929|gb|EDZ62216.1| flagellar basal body-associated protein FliL [Campylobacterales
           bacterium GD 1]
          Length = 184

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/183 (12%), Positives = 63/183 (34%), Gaps = 12/183 (6%)

Query: 1   MSYDDTTSQYI---RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ + TT++     + + + L +   VV   I +    +  ++M          +     
Sbjct: 1   MAEESTTAEGATKEKKSSNMLMIIIIVVLILIIVGGAVVALLLMGGDDEQATMNQAAPQA 60

Query: 58  LNNFYDNSVRSVHTG---DTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPD 113
                    +S                ++ L     N    S + +L++ ++L  +    
Sbjct: 61  NEKSASQPKKSNSGEYSNSRKLNDIGILYPLDSFTVNLKSDSGRRYLKVTMSLELEGEEL 120

Query: 114 ----KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRT 168
                     L   ++  + + S+++I+  +G +   + I + +    S G +  + F  
Sbjct: 121 SLELDKKAPVLRDRVIRILTSKSLEEISSKKGKQKISDQIMDTLNAMISDGRIKGIYFTE 180

Query: 169 FII 171
           F++
Sbjct: 181 FVV 183


>gi|254720605|ref|ZP_05182416.1| flagellar basal body-associated protein FliL [Brucella sp. 83/13]
 gi|265985645|ref|ZP_06098380.1| flagellar basal body-associated protein FliL [Brucella sp. 83/13]
 gi|306838567|ref|ZP_07471404.1| flagellar basal body-associated protein FliL [Brucella sp. NF 2653]
 gi|264664237|gb|EEZ34498.1| flagellar basal body-associated protein FliL [Brucella sp. 83/13]
 gi|306406353|gb|EFM62595.1| flagellar basal body-associated protein FliL [Brucella sp. NF 2653]
          Length = 163

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 63/173 (36%), Gaps = 13/173 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS                 +    V T I    GW  G ++                 + 
Sbjct: 1   MSDAAREKDGKAKGSMMGLLAVVAVLTAIAGGGGWYLGNIIS-----------AGQQASA 49

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLE 118
                      G   S     +  LQPIITN       W+RL+ +L+ K           
Sbjct: 50  KPSGKEDKPKPGSFESRSIGAVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIPPAMAA 109

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 110 NVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|330814984|ref|YP_004358689.1| Flagellar protein FliL [Burkholderia gladioli BSR3]
 gi|327367377|gb|AEA58733.1| Flagellar protein FliL [Burkholderia gladioli BSR3]
          Length = 164

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/176 (11%), Positives = 51/176 (28%), Gaps = 30/176 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
            + +     + K  V + ++   I    G      +L            + +        
Sbjct: 8   ASPERPPTGKFKRIVLFALIGLVIAAAGGAAAWYFLLRHEGPAAAHAAPQSLA------- 60

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLETL 120
                            F L+ +  N  S     +LR+ + L   D          +  +
Sbjct: 61  -------------TPVFFPLESMTVNLQSDDGLHYLRIGLTLKLTDPTAQDYLTHHMPEI 107

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
              I+  +     + +    G R   +++   ++  +Q       V +V+F  F++
Sbjct: 108 RSRILLALSNKHPEDLATLDGKRQLADELRTLIEQPTQPGNRSARVDAVLFTDFVV 163


>gi|15611812|ref|NP_223463.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           J99]
 gi|254779218|ref|YP_003057323.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           B38]
 gi|298736512|ref|YP_003729038.1| flagellar FliL protein [Helicobacter pylori B8]
 gi|4155301|gb|AAD06317.1| putative FLAGELLAR BIOSYNTHESIS PROTEIN [Helicobacter pylori J99]
 gi|254001129|emb|CAX29084.1| Flagellar FliL protein [Helicobacter pylori B38]
 gi|298355702|emb|CBI66574.1| flagellar FliL protein [Helicobacter pylori B8]
 gi|307637499|gb|ADN79949.1| Flagellar biosynthesis protein [Helicobacter pylori 908]
 gi|317014218|gb|ADU81654.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           Gambia94/24]
 gi|325996088|gb|ADZ51493.1| Flagellar biosynthesis protein [Helicobacter pylori 2018]
 gi|325997684|gb|ADZ49892.1| Flagellar biosynthesis protein [Helicobacter pylori 2017]
          Length = 183

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 63/182 (34%), Gaps = 11/182 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +   +      + K  +   +    + +    +  ++++      KE   +      
Sbjct: 1   MAEEQENTAQQPQKKSKALLFVIIGSVLVMLLLVGVIIMLLMGNKEESKENASKNTQEVQ 60

Query: 61  FYDNSVRSVHTGDTI------SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI--- 111
               + ++    +         L  L        +     + + +L+  I+L   +    
Sbjct: 61  ANPMANKNQEAKEGSNIQQYLVLGPLYAIDAPFAVNLVSQNGRRYLKASISLELSNEKLL 120

Query: 112 -PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
              KV    +   I+  + + S++++   +G    K++I+  +      GF+ +V F  F
Sbjct: 121 NEVKVKDTAIKDTIIEILSSKSVEEVVTNKGKNKLKDEIKSHLNSFLIDGFIKNVFFTDF 180

Query: 170 II 171
           II
Sbjct: 181 II 182


>gi|15645428|ref|NP_207602.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           26695]
 gi|108563219|ref|YP_627535.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           HPAG1]
 gi|188527347|ref|YP_001910034.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           Shi470]
 gi|208434720|ref|YP_002266386.1| putative flagellar biosynthesis protein [Helicobacter pylori G27]
 gi|308184594|ref|YP_003928727.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           SJM180]
 gi|2313942|gb|AAD07860.1| predicted coding region HP0809 [Helicobacter pylori 26695]
 gi|107836992|gb|ABF84861.1| putative flagellar biosynthesis protein [Helicobacter pylori HPAG1]
 gi|188143587|gb|ACD48004.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           Shi470]
 gi|208432649|gb|ACI27520.1| putative flagellar biosynthesis protein [Helicobacter pylori G27]
 gi|261837961|gb|ACX97727.1| flagellar biosynthesis protein [Helicobacter pylori 51]
 gi|297380007|gb|ADI34894.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           v225d]
 gi|308060514|gb|ADO02410.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           SJM180]
 gi|308063404|gb|ADO05291.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           Sat464]
 gi|315586527|gb|ADU40908.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           35A]
 gi|317009181|gb|ADU79761.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           India7]
 gi|317011025|gb|ADU84772.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           SouthAfrica7]
 gi|317012620|gb|ADU83228.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           Lithuania75]
 gi|317177361|dbj|BAJ55150.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           F16]
 gi|317178831|dbj|BAJ56619.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           F30]
 gi|317180572|dbj|BAJ58358.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           F32]
 gi|332673386|gb|AEE70203.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           83]
          Length = 183

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 63/182 (34%), Gaps = 11/182 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +   +      + K  +   +    + +    +  ++++      KE   +      
Sbjct: 1   MAEEQENTAQQPPKKSKALLFVIIGSVLVMLLLVGVIIMLLMGNKEESKENASKNTQEVQ 60

Query: 61  FYDNSVRSVHTGDTI------SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI--- 111
               + ++    +         L  L        +     + + +L+  I+L   +    
Sbjct: 61  ANPMANKNQEAKEGSNIQQYLVLGPLYAIDAPFAVNLVSQNGRRYLKASISLELSNEKLL 120

Query: 112 -PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
              KV    +   I+  + + S++++   +G    K++I+  +      GF+ +V F  F
Sbjct: 121 NEVKVKDTAIKDTIIEILSSKSVEEVVTNKGKNKLKDEIKSHLNSFLIDGFIKNVFFTDF 180

Query: 170 II 171
           II
Sbjct: 181 II 182


>gi|217972622|ref|YP_002357373.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS223]
 gi|217497757|gb|ACK45950.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS223]
          Length = 174

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/184 (10%), Positives = 57/184 (30%), Gaps = 24/184 (13%)

Query: 1   MSYDDT---TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ +++    +     ++ KLF+   V      +  G L   +     A    +   + I
Sbjct: 1   MAKEESLELENTEAPKSKKKLFIFIGVGVFVALLIAGALWFFLGSSEDAATPTDGAVQTI 60

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK-- 114
                                   +   +P + N     +   + + + L+ +   D   
Sbjct: 61  TPAESGA-----------LTTASYVPMPRPFLFNLPGPDRARLVEIKVQLMVRGTDDDVL 109

Query: 115 --VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFR 167
               +  +   ++       +++++   G    ++     V+     +  +  V  V+F 
Sbjct: 110 TQKHIPLIEDALLTTFSGADVQKLSTQAGKDELRQLALLSVQNTLQSVTGRKVVEKVLFT 169

Query: 168 TFII 171
            F++
Sbjct: 170 GFVM 173


>gi|83720504|ref|YP_440586.1| flagellar basal body-associated protein FliL [Burkholderia
           thailandensis E264]
 gi|83654329|gb|ABC38392.1| flagellar protein FliL [Burkholderia thailandensis E264]
          Length = 180

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 57/182 (31%), Gaps = 29/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +     +  KL      +   I       GG   + L  G +           
Sbjct: 16  MATTANPTVDKPASSGKLKRIVLFLLIGIVAAAAAAGGTYFVLLKEGARGSAPSA----- 70

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPDKV--- 115
                           L     F L+P+  N  S      +LR+ ++L   D   +    
Sbjct: 71  -------------PPPLAVPAFFPLEPLTVNLQSDDGVQHYLRVGLSLKLTDPKAQEYLT 117

Query: 116 -FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTF 169
             +  L   I+  +     +Q+   +G R   ++++  ++  +Q       V  V+F  F
Sbjct: 118 QHMPELRSRILLALSNKHPEQLATLEGKRALADELKTLIEQPTQPGNQSARVDDVLFTEF 177

Query: 170 II 171
           ++
Sbjct: 178 VV 179


>gi|84514810|ref|ZP_01002173.1| flagellar biosynthesis protein, FliL [Loktanella vestfoldensis
           SKA53]
 gi|84510969|gb|EAQ07423.1| flagellar biosynthesis protein, FliL [Loktanella vestfoldensis
           SKA53]
          Length = 195

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 20/178 (11%), Positives = 53/178 (29%), Gaps = 26/178 (14%)

Query: 20  VTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN----------------FYD 63
           +  F V   + +  G   G  +        E+   + I  N                   
Sbjct: 17  ILIFAVVGLVMMGAGLGVGYFLFGTATNTPEQIAAQIIEKNRGAVPEVAEVETEEAADGG 76

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP-----DKVFLE 118
              +         + +   + L   +T      + +L++ + L  +         +  L 
Sbjct: 77  PPEKVSKDSLKSEVFETLYYELPGSLTTNLKDSRRFLQIGVGLSTQYDEAILENVESNLP 136

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-----GFVSSVIFRTFII 171
            +   I+A +     + + G +      +D++  +    +     G V  V+  +F++
Sbjct: 137 AIRAAILATLSDYGEEDVVGREARTALSDDLKATINATLEELEGFGGVEGVLLTSFVM 194


>gi|115523558|ref|YP_780469.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisA53]
 gi|115517505|gb|ABJ05489.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisA53]
          Length = 164

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/178 (13%), Positives = 55/178 (30%), Gaps = 31/178 (17%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +  +  +      + KL +        + +  G                           
Sbjct: 9   AKGEDGAATAPKGKLKLIIIAGAAAVLLLVGGGVWFVFF--------------------- 47

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDK 114
              +    H    + + K     +  +  N    P + ++       L++         K
Sbjct: 48  --RAPAEHHEPVAVVVPKPVFIDVPDMTINLAGQPGERIQYLRVKAVLEVKDDKMVEQIK 105

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
             +  +      Y+R +    I+G+ G    KE++  RV L  + G V++V+F+  +I
Sbjct: 106 PAMPRVTDTFQTYLRELRSSDISGSAGLFRLKEEMLRRVNLTVAPGQVTTVLFKEIVI 163


>gi|301165892|emb|CBW25465.1| putative flagellar protein [Bacteriovorax marinus SJ]
          Length = 188

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 55/179 (30%), Gaps = 8/179 (4%)

Query: 1   MSY-DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  D  T +       K  +   V+   + +         +        E        +
Sbjct: 9   MADGDANTGKPSNSGSGKNPLLTIVMILQLVLMGTIAYFQYLAHQKLAATESVMDVVKSD 68

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD--SSPKDWLRLDIALICK----DIPD 113
                ++           +   +F L     N      P+ ++RL+  L       +   
Sbjct: 69  MKSAGAIDESSETGEAREEDGILFPLDNFTANLAQGDGPRRFVRLNAVLKFNRDSSEEEF 128

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           K     +   I++ + +   + +   +G  Y KE+++  +      G V  V + +F I
Sbjct: 129 KARKPQIRDTIISILNSKRAEDLLKVEGKNYLKEEVKAAINSFLVDGKVVDVFYVSFQI 187


>gi|308062128|gb|ADO04016.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           Cuz20]
          Length = 183

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 63/182 (34%), Gaps = 11/182 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +   +      + K  +   +    + +    +  ++++      KE   +      
Sbjct: 1   MAEEQENTAQRPPKKSKALLFVIIGSVLVMLLLVGVIIMLLMGNKEESKENASKNTQEVQ 60

Query: 61  FYDNSVRSVHTGDTI------SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI--- 111
               + ++    +         L  L        +     + + +L+  I+L   +    
Sbjct: 61  ANPMANKNQEVKEGSNIQQYLVLGPLYAIDAPFAVNLVSQNGRRYLKASISLELSNEKLL 120

Query: 112 -PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
              KV    +   I+  + + S++++   +G    K++I+  +      GF+ +V F  F
Sbjct: 121 NEVKVKDTAIKDTIIEILSSKSVEEVVTNKGKNKLKDEIKSHLNSFLIDGFIKNVFFTDF 180

Query: 170 II 171
           II
Sbjct: 181 II 182


>gi|317182121|dbj|BAJ59905.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           F57]
          Length = 183

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 63/182 (34%), Gaps = 11/182 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +   +      + K  +   +    + +    +  ++++      KE   +      
Sbjct: 1   MAEEQENTAQQPPKKSKALLFVIMGSVLVMLLLVGVIIMLLMGNKEESKENASKNTQEVQ 60

Query: 61  FYDNSVRSVHTGDTI------SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI--- 111
               + ++    +         L  L        +     + + +L+  I+L   +    
Sbjct: 61  ANPMANKNQEAKEGSNIQQYLVLGPLYAIDAPFAVNLVSQNGRRYLKASISLELSNEKLL 120

Query: 112 -PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
              KV    +   I+  + + S++++   +G    K++I+  +      GF+ +V F  F
Sbjct: 121 NEVKVKDTAIKDTIIEILSSKSVEEVVTNKGKNKLKDEIKSHLNSFLIDGFIKNVFFTDF 180

Query: 170 II 171
           II
Sbjct: 181 II 182


>gi|319781676|ref|YP_004141152.1| flagellar basal body-associated protein FliL [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317167564|gb|ADV11102.1| flagellar basal body-associated protein FliL [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 164

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 75/171 (43%), Gaps = 8/171 (4%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +   Q  +G    +     ++ T   I  GW+ G  +  + A        +     
Sbjct: 1   MANIEQV-QPRKGPSPVIQAGMLLLVTAAAIGVGWMSGGYLKGVGAPASVPVAPENEGKI 59

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
               +                +  L PI TN  S    W+R++++++      +   + +
Sbjct: 60  MQPAA-------AEQPGLGPMLVVLAPITTNIASPAGTWIRMEVSVVYDAPQPQAMSDDI 112

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           HQD++A +RT+ + QI GA G+++ K D+EER  +RSQG    V+ RT ++
Sbjct: 113 HQDLLALVRTLKMHQIEGASGYQHLKADLEERAAIRSQGHAKQVLIRTLLL 163


>gi|90411029|ref|ZP_01219043.1| flagellar basal body-associated protein [Photobacterium profundum
           3TCK]
 gi|90328242|gb|EAS44553.1| flagellar basal body-associated protein [Photobacterium profundum
           3TCK]
          Length = 164

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 59/181 (32%), Gaps = 28/181 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D   +    G++ KLF+   +  T +      +   +++     + E          
Sbjct: 1   MADDVENT----GSKKKLFILIALAVTLLIGAA--VAAWLLMGDETPEPEMATTSANQQV 54

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                        T+      +   QP I N         +++ + L+ +   ++     
Sbjct: 55  ------------STVVEPAYYVIMPQPFIFNVVGDKRDRVVQVKVQLMVRGNNNEALAQQ 102

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +  +   ++      +++Q+    G    ++     ++     +  Q  V  V+F  F+
Sbjct: 103 HIPLIESTLLQSFGAATVEQLRTPNGRIDLRKQALFAIQSSMEKISGQQVVDRVLFTGFV 162

Query: 171 I 171
           +
Sbjct: 163 M 163


>gi|83594173|ref|YP_427925.1| flagellar basal body-associated protein FliL [Rhodospirillum rubrum
           ATCC 11170]
 gi|83577087|gb|ABC23638.1| Flagellar basal body-associated protein FliL [Rhodospirillum rubrum
           ATCC 11170]
          Length = 196

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 22/145 (15%), Positives = 53/145 (36%), Gaps = 7/145 (4%)

Query: 34  GWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD 93
           G + G     LF        ++         +      G          + L  ++ + +
Sbjct: 51  GGVAGAYFAGLFDSSTPPTAEEGAAPPAGTPAAGEGEKGAPPVAAGPVFYDLDQVVVDLN 110

Query: 94  SSPKD--WLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKE 147
           SS +   +L+L ++L           +  +  +    +A++R + ++ + G  G    +E
Sbjct: 111 SSGRRRSYLQLRLSLQLASSLDIPRVEEAMPRIMDTFIAFLRELRLEDLQGTAGMYRIQE 170

Query: 148 DIEERVK-LRSQGFVSSVIFRTFII 171
           ++  RV    +   V  V+F+  +I
Sbjct: 171 ELLIRVNAAAAPARVEDVLFKEMLI 195


>gi|219854403|ref|YP_002471525.1| hypothetical protein CKR_1060 [Clostridium kluyveri NBRC 12016]
 gi|219568127|dbj|BAH06111.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 183

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 19/171 (11%), Positives = 49/171 (28%), Gaps = 7/171 (4%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
              +  +G      +              + G    L        E      +      +
Sbjct: 12  ENKEKKKGGVGLKVILIVFFLVAAVGAGVFFGYSKFLSDKNTDSNENMTTSNVTQAQTQT 71

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICKD----IPDKVFLETL 120
               ++     +   + F L     N        +L++++ L                 +
Sbjct: 72  QSGENSSYLQHVVSAKTFDLSEFTINLADEGGKNYLKVNVYLGYDSKKLTDELTEKTPII 131

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
              I+  +RT  ++ I   +     K +I +R+  +  +G +++V F   +
Sbjct: 132 RDAIIEVLRTKKVEDIND-KNMDNIKIEIIQRINPMLEKGKINNVYFSDIL 181


>gi|326796459|ref|YP_004314279.1| flagellar basal body-associated protein FliL [Marinomonas
           mediterranea MMB-1]
 gi|326547223|gb|ADZ92443.1| flagellar basal body-associated protein FliL [Marinomonas
           mediterranea MMB-1]
          Length = 174

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/184 (13%), Positives = 59/184 (32%), Gaps = 24/184 (13%)

Query: 1   MSYDDT---TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ +D    +++  +    K  +   V    +    G    + +        EE      
Sbjct: 1   MADEDNLDVSAEDGKKGGKKKLIIILVAVLILLGGGGAAAYLFLFSGDEPLPEESSVDDA 60

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IP 112
                                 + +   QP + +F  S +  +L+L + L  +D      
Sbjct: 61  AAQAVQTD-----------GPAIYLELDQPFVVDFMVSGRQRYLQLKMTLKSRDQVQIDA 109

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFR 167
            K+ +  +   ++    + S  ++   +G +  K+   E V          G +  V+F 
Sbjct: 110 VKIHMPLIRNSLVLLFSSQSFDELQTLEGKKALKQAALESVNNILTQETGVGGMQDVLFT 169

Query: 168 TFII 171
            F++
Sbjct: 170 NFVM 173


>gi|332702325|ref|ZP_08422413.1| flagellar basal body-associated protein FliL [Desulfovibrio
           africanus str. Walvis Bay]
 gi|332552474|gb|EGJ49518.1| flagellar basal body-associated protein FliL [Desulfovibrio
           africanus str. Walvis Bay]
          Length = 173

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 19/177 (10%), Positives = 52/177 (29%), Gaps = 11/177 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +   +Q        +     VV   +    GW    + L       + +        
Sbjct: 1   MADEALDTQATNKKSGAIKWIILVVLLIVLGVGGWFAWDMFLKEKLMGGDPQAAAGEQAP 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDI----PDKV 115
                + +            Q+ SL   I N      + +L++ + +   +         
Sbjct: 61  PEGQPIGTPIATGNE-----QLVSLPTFIVNLADPLGRRYLKITLDVEVINDKAARDLTA 115

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               +   ++  + + S + ++  +     K+++ ER+        V  V     ++
Sbjct: 116 KEARIRDAVILLLSSKSYQDLSTMESKILLKKEVAERLNQALGGPQVLRVYITEMVV 172


>gi|163794149|ref|ZP_02188122.1| Flagellar basal body-associated protein [alpha proteobacterium
           BAL199]
 gi|159180763|gb|EDP65282.1| Flagellar basal body-associated protein [alpha proteobacterium
           BAL199]
          Length = 175

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 28/175 (16%), Positives = 66/175 (37%), Gaps = 17/175 (9%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           DD   +  +       +  F     + +  G +G   ML LF+       ++        
Sbjct: 10  DDVGGEPNKKKLSGKRLIVFAAILLLVLVGGGVGAAFMLGLFSSPPPPPTEEEGHAPAPV 69

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPDKVFL---- 117
             V+               F +  +I N +++ +   +L++ IAL  +   D   +    
Sbjct: 70  APVQQRA----------FFFEVPDLIVNLNTNGRKSTFLKIKIALELEGPQDVDRINEVL 119

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-FVSSVIFRTFII 171
             +  +   Y+R + +  + G+ G    +E++  RV + ++   V  V+F+  ++
Sbjct: 120 PRIFDNFQVYLRELRVDDLNGSAGMYRLREELLRRVNIAARPIKVRDVLFKEMLV 174


>gi|94264050|ref|ZP_01287850.1| Flagellar basal body-associated protein FliL [delta proteobacterium
           MLMS-1]
 gi|94269367|ref|ZP_01291444.1| Flagellar basal body-associated protein FliL [delta proteobacterium
           MLMS-1]
 gi|93451248|gb|EAT02145.1| Flagellar basal body-associated protein FliL [delta proteobacterium
           MLMS-1]
 gi|93455561|gb|EAT05748.1| Flagellar basal body-associated protein FliL [delta proteobacterium
           MLMS-1]
          Length = 196

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 17/110 (15%), Positives = 48/110 (43%), Gaps = 6/110 (5%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDIPD----KVFLETLHQ 122
           +    +    +   + SL+P I N      K +L++ + +  +        +  +  L  
Sbjct: 86  APVADEDAPEEMGYVLSLEPFIINLADPTGKRYLKIQVEIELESERAWERAERNIPRLRD 145

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           +++  I ++S +++   +G    +++++ER  +      V +V F  F++
Sbjct: 146 NVIMLISSLSFEEVMTPEGKIRIRDELQERFNVVMRPDRVRNVYFSEFVV 195


>gi|210135008|ref|YP_002301447.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           P12]
 gi|210132976|gb|ACJ07967.1| flagellar biosynthesis protein [Helicobacter pylori P12]
          Length = 183

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 63/182 (34%), Gaps = 11/182 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +   +      + K  +   +    + +    +  ++++      KE   +      
Sbjct: 1   MAEEQENTAQQPQKKSKALLFVIIGSVLVMLLLVGVIIMLLMGNKEESKENASKNTQEVQ 60

Query: 61  FYDNSVRSVHTGDTI------SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI--- 111
               + ++    +         L  L        +     + + +L+  I+L   +    
Sbjct: 61  ANSMANKNQEAKEGSNIQQYLVLGPLYAIDAPFAVNLVSQNGRRYLKASISLELSNEKLL 120

Query: 112 -PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
              KV    +   I+  + + S++++   +G    K++I+  +      GF+ +V F  F
Sbjct: 121 NEVKVKDTAIKDTIIEILSSKSVEEVVTNKGKNKLKDEIKSHLNSFLIDGFIKNVFFTDF 180

Query: 170 II 171
           II
Sbjct: 181 II 182


>gi|153001446|ref|YP_001367127.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS185]
 gi|151366064|gb|ABS09064.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS185]
          Length = 175

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 18/184 (9%), Positives = 56/184 (30%), Gaps = 23/184 (12%)

Query: 1   MSYDDT---TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ +++    +     ++ KLF+   V      +  G L   +              +  
Sbjct: 1   MAKEESLELENTEAPKSKKKLFIFIGVGVLVALLIAGALWFFLGSSS----------EDA 50

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK-- 114
           +            T          +   +P + N     +   + + + L+ +   D   
Sbjct: 51  VTPTDGAVQTETPTESGALTTASYVPMPRPFLFNLPGPDRARLVEIKVQLMVRGTDDDVL 110

Query: 115 --VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFR 167
               +  +   ++       +++++   G    ++     V+     +  +  V  V+F 
Sbjct: 111 TQKHIPLIEDALLTTFSGADVQKLSTQAGKDELRQLALLSVQNTLQSVTGRKVVEKVLFT 170

Query: 168 TFII 171
            F++
Sbjct: 171 GFVM 174


>gi|300311369|ref|YP_003775461.1| flagellar transmembrane protein FliL [Herbaspirillum seropedicae
           SmR1]
 gi|300074154|gb|ADJ63553.1| flagellar FliL transmembrane protein [Herbaspirillum seropedicae
           SmR1]
          Length = 171

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 18/177 (10%), Positives = 59/177 (33%), Gaps = 31/177 (17%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           +  +   + ++  LF+    V   +           M+     + E+  ++         
Sbjct: 13  EADAAPAKSSKKMLFIIVGAVLVLVIGG---AAAFFMMGGKGKKGEDHAEEKAEAK---- 65

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKD----IPDKVFLET 119
                               ++P + N        +L++ + L   D       K+++  
Sbjct: 66  --------------APTFVVIEPFVVNLQQESGDQYLQVAMTLQVPDGQTAEALKLYMPQ 111

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
           +   ++  + +    ++  ++G R   ++I +++     G      ++ V + +F+I
Sbjct: 112 VRSRLLMVLSSKKASELLTSEGKRRLTDEIIDQLGEPFSGKGKGPQITDVFYTSFVI 168


>gi|146341902|ref|YP_001206950.1| flagellar basal body-associated protein FliL [Bradyrhizobium sp.
           ORS278]
 gi|146194708|emb|CAL78733.1| Flagellar basal body-associated protein FliL [Bradyrhizobium sp.
           ORS278]
          Length = 164

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 26/165 (15%), Positives = 55/165 (33%), Gaps = 28/165 (16%)

Query: 15  QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDT 74
           + KL +   VV     +  G           A +                     H    
Sbjct: 19  KSKLKLIIMVVGALALLGIGGAAYFFFFSHKADEH--------------------HAEAA 58

Query: 75  ISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLETLHQDIMAY 127
            + K      +  ++ N   +P D ++       L++    +    K  L  +      Y
Sbjct: 59  PAPKPPAFVEVPDLLVNLVGNPGDRVQYLKVKIVLEVKEEKQIEHIKPTLPRVTDIFQTY 118

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
           +R +    + G+ G    KE++ +RV +  +   V++V+F+  +I
Sbjct: 119 LRELRPSDLNGSAGLFRLKEELTKRVNVALAPNQVNAVLFKEIVI 163


>gi|148976419|ref|ZP_01813125.1| flagellar basal body-associated protein FliL [Vibrionales bacterium
           SWAT-3]
 gi|145964242|gb|EDK29498.1| flagellar basal body-associated protein FliL [Vibrionales bacterium
           SWAT-3]
          Length = 162

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 53/181 (29%), Gaps = 30/181 (16%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+         +G    L +   VV   +GI       +      +  + +     +   
Sbjct: 1   MAE---VQDAPKGKSKLLIIIIAVVVLLLGIGGALFFFLGSDDSASESESQPATAVVAAE 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                              + +   QP + N         +++   L+ +   ++     
Sbjct: 58  -----------------PVMYVNIPQPFLFNVTGDKKDRLVQIKAQLMVRGSKNEDLARY 100

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++A   + ++ Q+    G    ++   E +     +   Q  +  V+F  F+
Sbjct: 101 HSPLVESTLLATFASATVDQLRSPTGRVELRDKATEDIKASLAQAVGQPVIEKVLFTDFV 160

Query: 171 I 171
           I
Sbjct: 161 I 161


>gi|114777573|ref|ZP_01452554.1| flagellar protein FliL [Mariprofundus ferrooxydans PV-1]
 gi|114552044|gb|EAU54561.1| flagellar protein FliL [Mariprofundus ferrooxydans PV-1]
          Length = 173

 Score = 80.2 bits (196), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 23/176 (13%), Positives = 55/176 (31%), Gaps = 11/176 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   +    +   L     +V   + +  G      M+ +     +   Q      
Sbjct: 1   MADEEKEEKGNGKSSGGLLPIINLVLLLLVLAVGGFIAWKMMSIEQPATDSDKQAVAQTE 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKV 115
                       +  +     +  +  I  N   + +  +LR  I L  ++         
Sbjct: 61  DTTIPEA-----EDENTGPPIMIDIDDITVNLADADESRFLRAKIKLEVRNDDAKVKVTE 115

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-VSSVIFRTFI 170
            +  ++  I+  + +     I   QG    KED+  R+     G  + ++ F  F+
Sbjct: 116 NMVKVNDLIITVLASKKFSDIRTPQGKYALKEDLVYRLNRIVGGKPIKNLYFTDFV 171


>gi|153953787|ref|YP_001394552.1| hypothetical protein CKL_1162 [Clostridium kluyveri DSM 555]
 gi|146346668|gb|EDK33204.1| FliL [Clostridium kluyveri DSM 555]
          Length = 173

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 19/171 (11%), Positives = 49/171 (28%), Gaps = 7/171 (4%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
              +  +G      +              + G    L        E      +      +
Sbjct: 2   ENKEKKKGGVGLKVILIVFFLVAAVGAGVFFGYSKFLSDKNTDSNENMTTSNVTQAQTQT 61

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICKD----IPDKVFLETL 120
               ++     +   + F L     N        +L++++ L                 +
Sbjct: 62  QSGENSSYLQHVVSAKTFDLSEFTINLADEGGKNYLKVNVYLGYDSKKLTDELTEKTPII 121

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
              I+  +RT  ++ I   +     K +I +R+  +  +G +++V F   +
Sbjct: 122 RDAIIEVLRTKKVEDIND-KNMDNIKIEIIQRINPMLEKGKINNVYFSDIL 171


>gi|323491451|ref|ZP_08096635.1| flagellar basal body-associated protein FliL [Vibrio brasiliensis
           LMG 20546]
 gi|323314320|gb|EGA67400.1| flagellar basal body-associated protein FliL [Vibrio brasiliensis
           LMG 20546]
          Length = 165

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 60/181 (33%), Gaps = 27/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++  ++  +G    + +   VV    G          ++    G + E+  +  +  
Sbjct: 1   MAVEEVETEAPKGKGKLIIIIIAVVVLLAGGGG---AAFFLMGSDEGAETEQTAQQQVTT 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
             D                  +   QP + N         +++ + L+ +   ++     
Sbjct: 58  PED--------------PVAYVNIPQPFLFNVTGDKKDRLVQIKVQLMVRGTENENLARY 103

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
               +   +++   + ++ Q+  A G    +E   + +K        Q  +  V+F  F+
Sbjct: 104 HSPLIESSLLSTFASATVDQLRTANGRVELREKATDDIKASLNRAVGQPVIERVLFTDFV 163

Query: 171 I 171
           +
Sbjct: 164 M 164


>gi|42522630|ref|NP_968010.1| flagellar protein FliL [Bdellovibrio bacteriovorus HD100]
 gi|39575162|emb|CAE79003.1| flagellar protein FliL [Bdellovibrio bacteriovorus HD100]
          Length = 168

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 52/178 (29%), Gaps = 18/178 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+    TS   + N   LF   F V     +  G                          
Sbjct: 1   MAEAQETSAKPK-NTAMLFQIIFAVLNLAVMGAGGYMVY----------ASTMGWESPKI 49

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP------DK 114
             ++  R + +    +     ++++     N    PK  +RL+I L            + 
Sbjct: 50  TEEDVDRELASVSDETDLAPLVYTMDKFTVNLGGEPKRTIRLEINLQMLGKEGFEEVMEP 109

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
                    I+  +       +   QG  + K+ I   V  +  +G V  V F  F++
Sbjct: 110 ENRAKARDRIVRLLNEKPFSDLDSIQGKLFLKDKIAGEVNGILRRGVVKDVFFSDFVV 167


>gi|146278779|ref|YP_001168938.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145557020|gb|ABP71633.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 161

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 19/176 (10%), Positives = 47/176 (26%), Gaps = 21/176 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+            +  + +    V        G+      L L                
Sbjct: 1   MADAAADQVETGKKRSLMPLIGGAVLALALGGVGFYATWSGLILSPTGH----------- 49

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALIC---KDIPDKVF 116
                         + L  +    + PI+ +         LR    L           + 
Sbjct: 50  -----GGPTVEAGPVPLPDIAFVPVDPIVISLGRDTTLSHLRFTAQLEVAKANAADVALL 104

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           +  +   I  Y+R V++ ++         +  +  R+++   +G V  ++   F++
Sbjct: 105 MPRIIDVINGYLRAVAVSRLENPGALVELRAQMLRRIQMVTGEGRVRDLLVTEFVL 160


>gi|20807878|ref|NP_623049.1| flagellar basal body-associated protein [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516442|gb|AAM24653.1| Flagellar basal body-associated protein [Thermoanaerobacter
           tengcongensis MB4]
          Length = 135

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 17/107 (15%), Positives = 39/107 (36%), Gaps = 5/107 (4%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD----KVFLETLHQDIM 125
              +         +S              ++++ + L   D       +     +   I+
Sbjct: 28  AHPNKTPEVTYYNYSPGGEFITNLKGDGKFIKVVVELQVTDPKVLKKLEENTPQIRDAII 87

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
             +R+ + +++ G QG    K DI+  +  +  +G V +V F  FI+
Sbjct: 88  QILRSKTAQEVEGPQGQEMLKNDIKNEINKIIGEGKVVNVYFNDFIV 134


>gi|167579273|ref|ZP_02372147.1| flagellar basal body-associated protein FliL [Burkholderia
           thailandensis TXDOH]
          Length = 165

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 56/182 (30%), Gaps = 29/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +     +  KL      +   I       GG   + L  G +           
Sbjct: 1   MATTANPTVDKPASSGKLKRIVLFLLIGIVAAAAAAGGTYFVLLKEGARGSAPSA----- 55

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPDKV--- 115
                           L     F L+P+  N  S      +LR+ ++L   D   +    
Sbjct: 56  -------------PPPLAVPAFFPLEPLTVNLQSDDGVQHYLRVGLSLKLTDPKAQEYLT 102

Query: 116 -FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTF 169
             +  L   I+  +     +Q+    G R   ++++  ++  +Q       V  V+F  F
Sbjct: 103 QHMPELRSRILLALSNKHPEQLATLDGKRALADELKTLIEQPTQPGNQSARVDDVLFTEF 162

Query: 170 II 171
           ++
Sbjct: 163 VV 164


>gi|68164514|gb|AAY87243.1| predicted flagellar basal body-associated protein [uncultured
           bacterium BAC17H8]
          Length = 192

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/192 (14%), Positives = 61/192 (31%), Gaps = 22/192 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQ-----------K 49
           M+ ++   +   G   KL +        I I  G    I                    +
Sbjct: 1   MADNEAEPKAGGGLVKKLAIFGGGGILLIAIGLGAGYFIFGSAQPDPSEEIEEIIERKMQ 60

Query: 50  EEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK 109
           E +  +   +N  + + +S  T +    + +         TN     +  L++ I +  +
Sbjct: 61  EREAAEEAADNSSEPTKQSKETPEEEVFETIYHEFPGTFTTNLAG-SRKMLQVGIGVSTQ 119

Query: 110 DIP-----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-----G 159
                    +     L   I+  I   S + + GA G       + + + ++ +     G
Sbjct: 120 YDDTVMMNVESHQLALRSIILGVISDFSEENVKGATGREALAVALRDAINMKLEALEGFG 179

Query: 160 FVSSVIFRTFII 171
            V  V F +F++
Sbjct: 180 GVEEVHFTSFVL 191


>gi|167617379|ref|ZP_02386010.1| flagellar basal body-associated protein FliL [Burkholderia
           thailandensis Bt4]
          Length = 165

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 57/182 (31%), Gaps = 29/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +     +  KL      +   I       GG   + L  G +           
Sbjct: 1   MATTANPTVDKPASSGKLKRIVLFLLIGIVAAAAAAGGTYFVLLKEGARGSAPSA----- 55

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPDKV--- 115
                           L     F L+P+  N  S      +LR+ ++L   D   +    
Sbjct: 56  -------------PPPLAVPAFFPLEPLTVNLQSDDGVQHYLRVGLSLKLTDPKAQEYLT 102

Query: 116 -FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTF 169
             +  L   I+  +     +Q+   +G R   ++++  ++  +Q       V  V+F  F
Sbjct: 103 QHMPELRSRILLALSNKHPEQLATLEGKRALADELKTLIEQPTQPGNQSARVDDVLFTEF 162

Query: 170 II 171
           ++
Sbjct: 163 VV 164


>gi|89075519|ref|ZP_01161930.1| flagellar basal body-associated protein [Photobacterium sp. SKA34]
 gi|89048791|gb|EAR54362.1| flagellar basal body-associated protein [Photobacterium sp. SKA34]
          Length = 160

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 18/169 (10%), Positives = 53/169 (31%), Gaps = 23/169 (13%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
           G +  + ++   V   +        G  +L     ++  +    +  N            
Sbjct: 4   GKKKLMLISAVAVIVILAAG----IGFWLLNGDDAKESPQVAATVQENTA---------S 50

Query: 73  DTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV----FLETLHQDIMAY 127
               +    +   QP   N    +    +++ + L+ +   ++      +  +   ++  
Sbjct: 51  PAPVMSAYYVVLPQPFTFNVTGDTRDRVVQIKVQLMVRGDKNEALAKLHIPLIESTLLQA 110

Query: 128 IRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
               +++Q+    G    ++   E      VK+     V  V+F  F++
Sbjct: 111 FGVATVEQLRSPNGRDQLRQQALEAVKATMVKVAGTPAVERVLFTGFVM 159


>gi|254485967|ref|ZP_05099172.1| flagellar basal body-associated protein FliL [Roseobacter sp.
           GAI101]
 gi|214042836|gb|EEB83474.1| flagellar basal body-associated protein FliL [Roseobacter sp.
           GAI101]
          Length = 161

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 17/175 (9%), Positives = 51/175 (29%), Gaps = 21/175 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +      + K+ +   +V   +G   G+      L +    + +  +      
Sbjct: 1   MTDTPEDTAEASPKKSKMPLILSLVLALVGGGGGFYLSWSGLIMGDKPETDVAE------ 54

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD---IPDKVF 116
                     T     +       + P++ +     +   LR    +          +  
Sbjct: 55  ----------TDGPAPIGDFVYVPIDPLVISLRQPAQSKHLRFRAQMEVPSRYVADVEKL 104

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
           L  +   +  Y+R V ++ +         +  +  R++ +     V  ++   F+
Sbjct: 105 LPRVTDVLNGYLRAVKVEDLESPAILVRLRSQMLHRIEVVVGPDRVKDLLIMEFV 159


>gi|90579933|ref|ZP_01235741.1| flagellar basal body-associated protein [Vibrio angustum S14]
 gi|90438818|gb|EAS64001.1| flagellar basal body-associated protein [Vibrio angustum S14]
          Length = 160

 Score = 79.4 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 17/169 (10%), Positives = 53/169 (31%), Gaps = 23/169 (13%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
           G +  + ++   V   +        G  +L     ++  +    +  +            
Sbjct: 4   GKKKLMLISAVAVIVILAAG----IGFWLLNGDDTKESPQVAATVQESTA---------S 50

Query: 73  DTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV----FLETLHQDIMAY 127
               +    +   QP   N    +    +++ + L+ +   ++      +  +   ++  
Sbjct: 51  PAPVMSAYYVVLPQPFTFNVTGDTRDRVVQIKVQLMVRGDKNEALAKQHIPLIESTLLQA 110

Query: 128 IRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
               +++Q+    G    ++   E      VK+     V  V+F  F++
Sbjct: 111 FGVATVEQLRSPNGRDQLRQQALEAVKATMVKVAGTPAVERVLFTGFVM 159


>gi|157371193|ref|YP_001479182.1| flagellar basal body-associated protein FliL [Serratia
           proteamaculans 568]
 gi|157322957|gb|ABV42054.1| flagellar basal body-associated protein FliL [Serratia
           proteamaculans 568]
          Length = 161

 Score = 79.4 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/183 (14%), Positives = 52/183 (28%), Gaps = 35/183 (19%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS +   +   +     L     V+ T +           +    +G +     +     
Sbjct: 1   MSQNSLPTASKK---RPLLAYLLVLITLLACGAAGYSWWQLKQHQSGAQPADKPQ----- 52

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD---SSPKDWLRLDIALICKDIP----D 113
                                   L     N     ++P   L + + L   D       
Sbjct: 53  ---------------PPAAPVFMPLDTFTVNLMTPDNNPDRVLYIGLTLRLPDENTRRQL 97

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRT 168
             FL  +   ++  +      Q++  QG +     I++      VK + +  VS V+F  
Sbjct: 98  NDFLPEVRSRLLMLLSRQEAGQLSSEQGKQQLVAQIKDVLSPPLVKGQPKQVVSDVLFTA 157

Query: 169 FII 171
           FI+
Sbjct: 158 FIL 160


>gi|254251030|ref|ZP_04944348.1| flagellar basal body protein [Burkholderia dolosa AUO158]
 gi|124893639|gb|EAY67519.1| flagellar basal body protein [Burkholderia dolosa AUO158]
          Length = 178

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 42/116 (36%), Gaps = 11/116 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFD--SSPKDWLRLDIALICKDIP----DKVFLETL 120
               + +   L     F L P+  N       + +LR+ ++L   D          +  +
Sbjct: 62  HPAASAEPAPLAAPVFFPLDPLTVNLQSDDGGQHYLRVGLSLKLTDPKAQEQLTARMPEI 121

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
              I+  +     +++    G R   +++ E ++  +Q       +  V+F  F++
Sbjct: 122 RSRILLALSNKHPEELATPDGKRTLAKELRELIEQPTQPGNQRAKIDDVLFTEFVV 177


>gi|289548899|ref|YP_003473887.1| flagellar basal body-associated protein FliL [Thermocrinis albus
           DSM 14484]
 gi|289182516|gb|ADC89760.1| flagellar basal body-associated protein FliL [Thermocrinis albus
           DSM 14484]
          Length = 158

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 16/177 (9%), Positives = 52/177 (29%), Gaps = 28/177 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +   +   +  +         V   +    G    +++       K    +      
Sbjct: 1   MAEEAKGAGQEKKGKKGKLFLILAVILLVTAGAGVGAYLLLYSKDRRDKSLTPKDQ---- 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDI----PDKV 115
                                +  L     N     +  ++R+ I +   D       + 
Sbjct: 57  ------------------VGVMMELGTFTLNLADKDRDAYIRISITVELSDEKVRQEVEK 98

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            L  +   ++  I + +   +   +G    + ++ +R+  +  +G + ++ F  F++
Sbjct: 99  RLPIIKDAVIDVISSKTSSFVKTPEGRESLRLELIKRLNSVLVEGGIRNIYFTEFVV 155


>gi|308048758|ref|YP_003912324.1| flagellar basal body-associated protein FliL [Ferrimonas balearica
           DSM 9799]
 gi|307630948|gb|ADN75250.1| flagellar basal body-associated protein FliL [Ferrimonas balearica
           DSM 9799]
          Length = 173

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/183 (10%), Positives = 50/183 (27%), Gaps = 23/183 (12%)

Query: 1   MSYD--DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ D      + +R  +   ++        + I   +    ++      Q          
Sbjct: 1   MADDSLQVDVESVRKKRRLHWMAAIGGGVVLLIAVVFGVMSMIGGGDDPQPTAAGGDSQP 60

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWL-RLDIALICKD----IPD 113
                                L +   +P + N     + +L ++ + L  +        
Sbjct: 61  LRAGLAQDG-----------ALYVPMPRPFLFNLPGPDRTYLVQIKVQLQVRGTDAQNAA 109

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRT 168
           +  +  +   ++         QI   +G    +      V+     +  Q  V  V+F  
Sbjct: 110 RKHIPLIEDTLLTTFSAAEADQIRRKEGKDELRTQALLNVQNALQSITGQHQVERVLFTG 169

Query: 169 FII 171
           F++
Sbjct: 170 FVM 172


>gi|304311106|ref|YP_003810704.1| Flagellar basal body-associated protein [gamma proteobacterium
           HdN1]
 gi|301796839|emb|CBL45051.1| Flagellar basal body-associated protein [gamma proteobacterium
           HdN1]
          Length = 178

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 17/175 (9%), Positives = 52/175 (29%), Gaps = 24/175 (13%)

Query: 8   SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVR 67
                 +   + +    V   +G     +   +M     G+  +  +             
Sbjct: 16  EGDKPKSNKMMIIIVAAVALIVGGAGSGVAVFMMSKGSGGESADAAKAEA---------- 65

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD----KVFLETLHQ 122
                +    +        P + N+    +  ++++ ++ + +D       K     L  
Sbjct: 66  ---PVEQKPREASYFDFTTPFLVNYQWRGREHYMQVSLSFLFRDPAVQALIKEHEPLLRN 122

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF------VSSVIFRTFII 171
           +IM  ++      +   +G    ++ I + V+   +        +  V F  F++
Sbjct: 123 NIMLLLQAQDFDGLRTLEGKESIRQLIFDEVQNVLKAQDSSTEGIEQVYFTNFVL 177


>gi|254712019|ref|ZP_05173830.1| flagellar basal body-associated protein FliL [Brucella ceti
           M644/93/1]
 gi|254715088|ref|ZP_05176899.1| flagellar basal body-associated protein FliL [Brucella ceti
           M13/05/1]
 gi|261216797|ref|ZP_05931078.1| flagellar basal body-associated protein FliL [Brucella ceti
           M13/05/1]
 gi|261319664|ref|ZP_05958861.1| flagellar basal body-associated protein FliL [Brucella ceti
           M644/93/1]
 gi|260921886|gb|EEX88454.1| flagellar basal body-associated protein FliL [Brucella ceti
           M13/05/1]
 gi|261292354|gb|EEX95850.1| flagellar basal body-associated protein FliL [Brucella ceti
           M644/93/1]
          Length = 163

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 62/173 (35%), Gaps = 13/173 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M                  +    V T I    GW  G ++                 + 
Sbjct: 1   MRDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMIS-----------AGQQASA 49

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLE 118
                      G   S     +  LQPIITN       W+RL+ +L+ K           
Sbjct: 50  KPSGKEDKPKPGSFESRSIGAVVPLQPIITNLGIPQTTWVRLEASLVAKPGHEIPPAMAA 109

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
            +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 110 NVSDDFMRFLRSVNLMQLLGAAGLAYLRTDLEERARLRSEGAVDRVFISALVV 162


>gi|114764043|ref|ZP_01443282.1| flagellar basal body-associated protein FliL [Pelagibaca
           bermudensis HTCC2601]
 gi|114543401|gb|EAU46416.1| flagellar basal body-associated protein FliL [Roseovarius sp.
           HTCC2601]
          Length = 182

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 15/174 (8%), Positives = 51/174 (29%), Gaps = 7/174 (4%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            +D  +   +G++  + +   +     G         ++ F       E+          
Sbjct: 10  AEDEGTPKKKGSKLPMLIGLVLALAGGGGGFYAAWSGLLPFGGGHAPAEEAHGEGGQGAA 69

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICK---DIPDKVFLE 118
                        +        L+P++ +  +  +   LR   +L          +    
Sbjct: 70  GGHGGDPALPLPDTNVA--FVELEPLVISMGTIAELHHLRFRASLEVPPQYVAEVETLTP 127

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
            +   + +Y+R +    I         +  +  R+++   +  +  ++   F++
Sbjct: 128 RVIDVLNSYLRALRPSDIEAPGALIRLRSQMLRRIQMVAGEDRIRDLLVMEFVL 181


>gi|119775426|ref|YP_928166.1| flagellar basal body-associated protein FliL [Shewanella
           amazonensis SB2B]
 gi|119767926|gb|ABM00497.1| flagellar protein FliL [Shewanella amazonensis SB2B]
          Length = 175

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/184 (10%), Positives = 63/184 (34%), Gaps = 23/184 (12%)

Query: 1   MSYDDT---TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ +++        + ++  LF+   VV   +     WL                 +   
Sbjct: 1   MAEEESLQLEDTGAKKSKKGLFIIIGVVVAALLGVGAWLFLG----------SSDPEPVA 50

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD--- 113
                + +  +  + ++ S +   +   +P + N    P+   + + + L+ +   D   
Sbjct: 51  AEAATEAAGGAAASAESNSREAFYVAMPRPFLFNLPGQPRSRLVEIKVQLMVRGADDDVL 110

Query: 114 -KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFR 167
            K  +  +   ++       +++++   G    ++     V+     +  +  V  V+F 
Sbjct: 111 IKKHIPLIEDALLTTFSGGDVQKLSTQAGKDELRQLALLNVQNTLQPVTGRKVVEKVLFT 170

Query: 168 TFII 171
            F++
Sbjct: 171 GFVM 174


>gi|209964206|ref|YP_002297121.1| flagellar basal body-associated protein FliL [Rhodospirillum
           centenum SW]
 gi|209957672|gb|ACI98308.1| flagellar basal body-associated protein FliL [Rhodospirillum
           centenum SW]
          Length = 173

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 16/174 (9%), Positives = 50/174 (28%), Gaps = 20/174 (11%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           +      + +  K+ +   +    IG     +    +L                +  +  
Sbjct: 12  EQELPRKKLSGKKIVLFIVLPILVIGAAAAGVVFSGILHKG-------------DEEHAE 58

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD------WLRLDIALICKDIPDKVFLE 118
              +                   ++ N ++  +        ++L++            L 
Sbjct: 59  EEETHAAPPAECKGPPAFVDFPDVLVNLNTKERRPQFLKLNIKLELCSALDVPAVTAVLP 118

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
            +      Y+R + +  + G+ G    +E++  RV   +    V  V+ +  ++
Sbjct: 119 RITDTFQVYLRELRVDDLNGSAGVYRLREELLMRVNTAAYPTRVQDVLIQEILV 172


>gi|162210776|ref|YP_562339.2| flagellar basal body-associated protein FliL [Shewanella
           denitrificans OS217]
          Length = 173

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/181 (10%), Positives = 59/181 (32%), Gaps = 19/181 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +++      G      V +  +   + +  G     +M    A          + + 
Sbjct: 1   MADEESLELKNEGKGKSKLVLFGGIGLVLVLVIGAGLWFLMGSSDAP---------VADP 51

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD----KV 115
             D S  +         +   I   +P + N   + +   + + + L+ +   D    + 
Sbjct: 52  DSDPSSAAAPAVKAPVAEANYISMPRPFLFNLPGADRPRIVEIKVQLMVRGSDDGTLTQK 111

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +  +   ++       +++++   G    ++     V+     +  +  V  V+F  F+
Sbjct: 112 HIPLIEDALLTTFSGADVQKLSTQAGKDELRQLALLNVQNTLQPVIGRTVVEKVLFTGFV 171

Query: 171 I 171
           +
Sbjct: 172 M 172


>gi|144897830|emb|CAM74694.1| flagellar basal body-associated protein FliL [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 182

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 64/176 (36%), Gaps = 17/176 (9%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            D  +S   +    K+ +    +   +G   G     V+  L              ++  
Sbjct: 16  EDLPSSSSKKPPIKKILMIVLPILLLLGAGAGLFFSGVLDGLMGKG----------DHKA 65

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW------LRLDIALICKDIPDKVF 116
           +  V +       ++     ++L  ++ N  S+ +        + L++     +   +V 
Sbjct: 66  EAPVEAPKGDAPKAIGPAHFYNLPEMLVNLQSNGRKQAFLKILVALELESPLDEPKVQVV 125

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           L  +      Y+R + ++ + GA G    +E++  RV+       V+ V+FR  ++
Sbjct: 126 LPRIVDSFQVYLRELRVEDLQGAAGMHLLREELLTRVQAAVKPVKVNDVLFREMLV 181


>gi|289666106|ref|ZP_06487687.1| flagellar basal body-associated protein FliL [Xanthomonas
           campestris pv. vasculorum NCPPB702]
          Length = 209

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 14/164 (8%), Positives = 42/164 (25%), Gaps = 29/164 (17%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L V   VV         W                        +   +   +      +  
Sbjct: 62  LLVAIGVVVLAAAGGGAWFFFGH------------------KDDEKDGKHAAPKVAEVPK 103

Query: 78  KKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPDKVFL----ETLHQDIMAYIRTV 131
                     I+ N         +L++++ L+ +D  +   +      +   ++  +   
Sbjct: 104 PAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQT 163

Query: 132 SIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +    G +  ++      +        +  V  ++F +F+
Sbjct: 164 KATDVADLAGKQKLQKAALAEAQKVMTSETGKKCVEELLFTSFV 207


>gi|77457772|ref|YP_347277.1| flagellar basal body-associated protein FliL [Pseudomonas
           fluorescens Pf0-1]
 gi|77381775|gb|ABA73288.1| flagellar basal body-associated protein FliL [Pseudomonas
           fluorescens Pf0-1]
          Length = 167

 Score = 78.7 bits (192), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 16/181 (8%), Positives = 54/181 (29%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  +      + KL +   +V   +      +G        A  K     +     
Sbjct: 1   MAKSEAAAVKDPATKGKLKLIIVIVLGLLLAIGTSVGATWFFMHSAQSKPAATAEAA--- 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKV 115
                              +        + N++ + +  ++++ I ++ ++       KV
Sbjct: 58  ------------PVGKQPAIFEPMAPAFVANYNQNGRQRYMQVSITMLARNQADLEALKV 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +  +  +++          +    G    ++     V+  +Q       +  ++F  F+
Sbjct: 106 HMPVIRNNLVMLFSGQDFATLATPVGQEMLRQKATASVQEVAQKELGKVVIEQLLFTNFV 165

Query: 171 I 171
           +
Sbjct: 166 L 166


>gi|120598256|ref|YP_962830.1| flagellar basal body-associated protein FliL [Shewanella sp.
           W3-18-1]
 gi|146293666|ref|YP_001184090.1| flagellar basal body-associated protein FliL [Shewanella
           putrefaciens CN-32]
 gi|120558349|gb|ABM24276.1| flagellar basal body-associated protein FliL [Shewanella sp.
           W3-18-1]
 gi|145565356|gb|ABP76291.1| flagellar basal body-associated protein FliL [Shewanella
           putrefaciens CN-32]
          Length = 171

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 19/184 (10%), Positives = 60/184 (32%), Gaps = 27/184 (14%)

Query: 1   MSYDDT---TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ +++    +     ++ KLF+   +      +  G L   +                 
Sbjct: 1   MANEESLELENTDTPKSKKKLFIFIGIGVLVALLIGGALWFFLGSSD------------- 47

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK-- 114
             +  +     V T     L    +   +P + N     +   + + + L+ +   D+  
Sbjct: 48  -ESSSEAVEAVVETPSNDKLVASYVPMPRPFLFNLPGPDRARLVEIKVQLMVRGSDDEVL 106

Query: 115 --VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFR 167
               +  +   ++    +  +++++   G    ++     V+     +  +  V  V+F 
Sbjct: 107 IQKHIPLIEDALLTTFSSSDVQKLSTQAGKDEARQLALLSVQNTLQSVTGRKVVEKVLFT 166

Query: 168 TFII 171
            F++
Sbjct: 167 GFVM 170


>gi|126175122|ref|YP_001051271.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS155]
 gi|125998327|gb|ABN62402.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS155]
          Length = 175

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 15/170 (8%), Positives = 49/170 (28%), Gaps = 20/170 (11%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
             ++ KLF+   V      +  G +   +                         + +   
Sbjct: 15  PKSKKKLFIFAGVGVLVALLIGGGVWFFMGSSSEEVPVAAADGTVQAEAPATGDLAT--- 71

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK----VFLETLHQDIMA 126
                     +   +P + N     +   + + + L+ +   D       +  +   ++ 
Sbjct: 72  -------ASYVPMPRPFLFNLPGPDRARLVEIKVQLMVRGTDDDVLTQKHIPLIEDALLT 124

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
                 +++++   G    ++     V+     +  +  V  V+F  F++
Sbjct: 125 TFSGADVQKLSTQAGKDELRQLALLSVQNTLQSVTGRKVVEKVLFTGFVM 174


>gi|126730037|ref|ZP_01745849.1| flagellar basal body-associated protein FliL [Sagittula stellata
           E-37]
 gi|126709417|gb|EBA08471.1| flagellar basal body-associated protein FliL [Sagittula stellata
           E-37]
          Length = 173

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/171 (12%), Positives = 49/171 (28%), Gaps = 10/171 (5%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
                      KL +   VV    G   G+      L                     + 
Sbjct: 7   DEDGQEEKKPSKLPMIIGVVLALAGAGGGFFAVQSGLLGGG-----SDAHAEDAAAGADH 61

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICK---DIPDKVFLETLH 121
                  +T +L K+    +  ++ +         LR   +L          +V L  + 
Sbjct: 62  AEDQEHVETPALPKVSFIEVPQVMVSLGPGGHSQHLRFRASLEVPEQYAADVEVILPRVQ 121

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
             + +Y+R +  + I         +  +  RV+L   +  +  ++   F++
Sbjct: 122 DVLNSYLRALEARDIEAPGALVRLRGQMLRRVRLVAGEDRIRDLLVLEFVL 172


>gi|76810373|ref|YP_331655.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 1710b]
 gi|161579519|ref|YP_104283.2| flagellar basal body-associated protein FliL [Burkholderia mallei
           ATCC 23344]
 gi|161723215|ref|YP_106651.2| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei K96243]
 gi|76579826|gb|ABA49301.1| Flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 1710b]
          Length = 180

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 54/182 (29%), Gaps = 29/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +     +  KL      +   I       GG   +                  
Sbjct: 16  MATTANPTVDKPASSGKLKRLVLFLLIGIVAAAAAAGGTYFMLS---------------- 59

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPDKV--- 115
                  S        L     F L+P+  N  S      +LR+ ++L   D   +    
Sbjct: 60  --KEGAHSAAPSAPAPLAVPAFFPLEPLTVNLLSDDGIQHYLRVGLSLKLTDPKAQEYLT 117

Query: 116 -FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTF 169
             +  L   I+  +     +Q+   +G     ++++  ++  +Q       V  V+F  F
Sbjct: 118 QHMPELRSRILLALSNKHPEQLATLEGKHALADELKTLIEQPTQPGNQSARVDDVLFTEF 177

Query: 170 II 171
           ++
Sbjct: 178 VV 179


>gi|260776478|ref|ZP_05885373.1| flagellar biosynthesis protein FliL [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607701|gb|EEX33966.1| flagellar biosynthesis protein FliL [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 165

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 58/181 (32%), Gaps = 27/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++  ++  +G    L +   VV   +G          ++     ++ E+  +     
Sbjct: 1   MADEELEAEAPKGKSKLLIIIIAVVVLLVGGGGAAFF---LMGSSEPEQMEETTQQE--- 54

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                          +     +   QP + N         +++ + L+ +   ++     
Sbjct: 55  -----------VVVSTDPVSYVNIAQPFLFNVTGDKKDRLVQIKVQLMVRGTDNENLARY 103

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
               +   ++    + ++ Q+    G    ++   E +K        Q  +  V+F  F+
Sbjct: 104 HSPLIESSLLGTFASATVDQLRSVNGRVELRDKATEDIKASLTRAVGQPVIERVLFTDFV 163

Query: 171 I 171
           I
Sbjct: 164 I 164


>gi|30248481|ref|NP_840551.1| flagellar basal body-associated protein FliL [Nitrosomonas europaea
           ATCC 19718]
 gi|30138367|emb|CAD84376.1| putative flagellar fliL transmembrane protein [Nitrosomonas
           europaea ATCC 19718]
          Length = 162

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/178 (14%), Positives = 55/178 (30%), Gaps = 30/178 (16%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           + T     GN+ K+ +   +    +G   G     +                        
Sbjct: 3   EATLPAGTGNKKKMILFVLIGVLSVGAGIGGTWYYM-------------------KQQQE 43

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DKVFLE 118
               V        K      L+    N  S  +   +L+++++L   +       +    
Sbjct: 44  EGSEVTVEKKKKKKPTTFIKLESFTVNLQSDDREPHYLQVELSLKVNESDAVKIIEDKKP 103

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
            +   I+  + +    +I   +G +   EDI + V+        +  +  V+F +FII
Sbjct: 104 EVRNQILLLLSSKKPSEINTLEGKQKLSEDIIQAVRSKIDSEELEDDILDVLFTSFII 161


>gi|304409953|ref|ZP_07391572.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS183]
 gi|307302334|ref|ZP_07582092.1| flagellar basal body-associated protein FliL [Shewanella baltica
           BA175]
 gi|304351362|gb|EFM15761.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS183]
 gi|306914372|gb|EFN44793.1| flagellar basal body-associated protein FliL [Shewanella baltica
           BA175]
          Length = 175

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 15/170 (8%), Positives = 48/170 (28%), Gaps = 20/170 (11%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
             ++ KLF+   V         G +   +                         + +   
Sbjct: 15  PKSKKKLFIFAGVGVLVALFIGGGVWFFMGSSSEEVPVAAADGTVQAEAPATGDIAT--- 71

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK----VFLETLHQDIMA 126
                     +   +P + N     +   + + + L+ +   D       +  +   ++ 
Sbjct: 72  -------ASYVPMPRPFLFNLPGPDRARLVEIKVQLMVRGTDDDVLTQKHIPLIEDALLT 124

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
                 +++++   G    ++     V+     +  +  V  V+F  F++
Sbjct: 125 TFSGADVQKLSTQAGKDELRQLALLSVQNTLQSVTGRKVVEKVLFTGFVM 174


>gi|221201775|ref|ZP_03574812.1| flagellar basal body-associated protein FliL [Burkholderia
           multivorans CGD2M]
 gi|221207720|ref|ZP_03580728.1| flagellar basal body-associated protein FliL [Burkholderia
           multivorans CGD2]
 gi|221172566|gb|EEE05005.1| flagellar basal body-associated protein FliL [Burkholderia
           multivorans CGD2]
 gi|221178195|gb|EEE10605.1| flagellar basal body-associated protein FliL [Burkholderia
           multivorans CGD2M]
          Length = 165

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 40/116 (34%), Gaps = 11/116 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DKVFLETL 120
            +  + +   L     F L P+  N  S      +LR+ ++L   D          +  +
Sbjct: 49  ATHASAEPAPLAAPVFFPLDPLTVNLQSDDGVQHYLRVGLSLKLTDPKAQEQLTARMPEI 108

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
              ++  +     + I    G +   + +   ++  +Q       V  V+F  F++
Sbjct: 109 RSRVLLALSNKHPEDIATPDGKQALAQQLRNLIEEPTQPGNQRTKVDDVLFTEFVV 164


>gi|90021821|ref|YP_527648.1| flagellar basal body-associated protein FliL [Saccharophagus
           degradans 2-40]
 gi|89951421|gb|ABD81436.1| flagellar basal body-associated protein FliL [Saccharophagus
           degradans 2-40]
          Length = 180

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 20/179 (11%), Positives = 56/179 (31%), Gaps = 20/179 (11%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
             D   +  +       +    V   + +     G + +L +          +       
Sbjct: 11  EKDGAEEGAKKGGGLKRIIILAVVCLVIVGISVGGTLTVLKMTQPPAAPAEGEEGAAEPV 70

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKVFL 117
           +   +            +       II N+ +  +  +LR DI L+ +D       +  +
Sbjct: 71  EEVKKD----------AIYFPIKPEIIVNYTARGRQRYLRTDITLLIRDVDVIAAIETHM 120

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
             +   +   I     ++I  A+G    ++   + ++        +  +  V+F +F++
Sbjct: 121 PMIRNTLNMIIGGQVYQEIQTAEGKELMRQQCLQALRKNLEAEIGKPGIEEVLFTSFVM 179


>gi|85859176|ref|YP_461378.1| flagellar basal body-associated protein [Syntrophus aciditrophicus
           SB]
 gi|85722267|gb|ABC77210.1| flagellar basal body-associated protein [Syntrophus aciditrophicus
           SB]
          Length = 164

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 16/111 (14%), Positives = 42/111 (37%), Gaps = 6/111 (5%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWL----RLDIALICKDIPDKVFLETLH 121
           +      +       ++ ++P + N    +   +L    +++++                
Sbjct: 53  KGTENQKSGKSSVGILWPMEPFVVNLADSTGDRYLKAVIQIEVSDQENTAALDQLKPKFR 112

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
             I+  + + S K++    G +  +EDI  ++    S+G +  V F  F+I
Sbjct: 113 DSILDILSSKSYKELMEVSGKQRLREDIAFKLNSFLSKGRIMRVYFTEFVI 163


>gi|325917741|ref|ZP_08179928.1| flagellar basal body-associated protein [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325536040|gb|EGD07849.1| flagellar basal body-associated protein [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 206

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 13/164 (7%), Positives = 39/164 (23%), Gaps = 29/164 (17%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +   VV         W                                       +  
Sbjct: 59  LLIAIGVVVLAAAGGGAWFF------------------LGHKGDEKGGKHDAPKVAEVPK 100

Query: 78  KKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPDKVFL----ETLHQDIMAYIRTV 131
                     I+ N         +L++++ L+ +D  +   +      +   ++  +   
Sbjct: 101 PAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQT 160

Query: 132 SIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +    G +  ++      +        +  V  ++F +F+
Sbjct: 161 KAADVADLAGKQKLQKAALTEAQKVMTSETGKKCVEELLFTSFV 204


>gi|313673295|ref|YP_004051406.1| flagellar basal body-associated protein flil [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312940051|gb|ADR19243.1| flagellar basal body-associated protein FliL [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 178

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 55/136 (40%), Gaps = 6/136 (4%)

Query: 42  LFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWL 100
           LFLF  +  +               ++     +    K  ++S+  II N      + +L
Sbjct: 42  LFLFKSKSADHNAVAKEEKAPAKEEKAKKDKKSGEKAKTVVYSMGAIIVNLADQGVQRYL 101

Query: 101 RLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-L 155
           ++ IA+   +       K     +   I++ + + ++  +   QG    K++I +R   +
Sbjct: 102 KVQIAVELDNPKLEEEVKKREPQIKDIIISVLSSKTVSDVNTPQGKIALKQEILKRANMV 161

Query: 156 RSQGFVSSVIFRTFII 171
            ++G ++ + F  FI+
Sbjct: 162 LTEGEITDLFFSEFIV 177


>gi|24374734|ref|NP_718777.1| flagellar basal body-associated protein FliL [Shewanella oneidensis
           MR-1]
 gi|24349394|gb|AAN56221.1|AE015759_13 flagellar protein FliL [Shewanella oneidensis MR-1]
          Length = 174

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 17/171 (9%), Positives = 52/171 (30%), Gaps = 21/171 (12%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVH 70
              ++ KLF+   V      +  G L   +     A  +             +    +  
Sbjct: 14  APKSKKKLFIFIGVGVLAALLIGGALWFFLGSSDDAPVEAA-----------EGVKTTAE 62

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK----VFLETLHQDIM 125
                      +   +P + N     +   + + + L+ +   D+      +  +   ++
Sbjct: 63  APAAEPALAAYVPMPRPFLFNLPGPDRARLVEIKVQLMVRGQDDEVLTQKHIPLIEDALL 122

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
                  +++++   G    ++     V+     +  +  V  V+F  F++
Sbjct: 123 TTFSGADVQKLSTQAGKDELRQLALLSVQNTLQPVTGRKVVEKVLFTGFVM 173


>gi|329901245|ref|ZP_08272770.1| Flagellar biosynthesis protein fliL [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549177|gb|EGF33769.1| Flagellar biosynthesis protein fliL [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 173

 Score = 77.5 bits (189), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 24/169 (14%), Positives = 51/169 (30%), Gaps = 27/169 (15%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
           G + K  +   ++   +    G   G  ++   A    E  ++                 
Sbjct: 21  GGKKKSKLKLIIIAVVVLALAGGGAGYFLMGKKAKPAGEHAEESHEAAKAP--------- 71

Query: 73  DTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKD----IPDKVFLETLHQDIMAY 127
                       L P   N        +L++ + +   D       KV+L  +   ++  
Sbjct: 72  --------VFLVLDPFTVNLQQEAGDQYLQIAMTVQVADDKQSEEIKVYLPQIRSRVLMV 123

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
           + +    +I    G +   +DI   +K           V+ V F +F+I
Sbjct: 124 LSSKKASEINTPDGKKQLADDIITAIKKPFSERGKPQKVNDVFFTSFVI 172


>gi|39995528|ref|NP_951479.1| flagellar protein FliL [Geobacter sulfurreducens PCA]
 gi|39982291|gb|AAR33752.1| flagellar protein FliL [Geobacter sulfurreducens PCA]
 gi|298504528|gb|ADI83251.1| flagellar basal body-associated protein FliL [Geobacter
           sulfurreducens KN400]
          Length = 173

 Score = 77.5 bits (189), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/178 (14%), Positives = 57/178 (32%), Gaps = 13/178 (7%)

Query: 1   MSYDDTTS-QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ D+    +    ++ KLF+        I                  +++ K  +    
Sbjct: 1   MAADEKAPVEGAPKDKKKLFIIIGAAAVVIIALAVVFL------GGGKKEKGKEGEAEAK 54

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDI----PDK 114
                        +  +      F+L+P I N     +  +LR+ +             +
Sbjct: 55  VEQKAEGGHGGGKEGAAGAVATAFALEPFIVNIYDGQELRYLRVKVEFETATPDAKAEIE 114

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
                L   I+  + T +++ I   QG    +++I      +   G V+ V F  F++
Sbjct: 115 SRQAPLRDAILVLLTTKTLQDIQDLQGKNQLRDEILVAANKILPPGKVTKVYFTDFVV 172


>gi|114562366|ref|YP_749879.1| flagellar basal body-associated protein FliL [Shewanella
           frigidimarina NCIMB 400]
 gi|114333659|gb|ABI71041.1| flagellar basal body-associated protein FliL [Shewanella
           frigidimarina NCIMB 400]
          Length = 173

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 13/177 (7%), Positives = 54/177 (30%), Gaps = 22/177 (12%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++ +    +  +  +F    +V   +     W      +     +  +   +        
Sbjct: 9   NEASEGGKKSKKLVIFGGIGLVLALLIGGGVWFF----MGSDEPENTDSQTETET----- 59

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP---DKVFLET 119
               S+        +   +   +P + N     +   + + + L+ +       +  +  
Sbjct: 60  ----SIDAKPMSMEEANYVGMPRPFLFNLPGVDRARLVEIKVQLMVRGDDSVLTQKHIPL 115

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
           +   ++       +++++   G    ++     V+     +  +  V  V+F  F++
Sbjct: 116 IEDALLTTFSAADVQKLSTQAGKDELRQLALLNVQNTLQPITGKKVVEKVLFTGFVM 172


>gi|303326578|ref|ZP_07357021.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           3_1_syn3]
 gi|302864494|gb|EFL87425.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           3_1_syn3]
          Length = 113

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 16/112 (14%), Positives = 34/112 (30%), Gaps = 5/112 (4%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKD---IPDKVFLETL 120
               +     +      +  L PI  N      + +L+L + +          K     +
Sbjct: 1   DAPRIERQSDLPRSAGLVLPLPPITVNLSDPGGRRYLKLGMEVEVNADVSEALKAQNARI 60

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              ++  +   S   I    G    K ++  R+  +     V  V F  F++
Sbjct: 61  RDAVIMLLAGKSFTDIATPDGKVLLKAEVAARLNQILGAQRVIRVYFTDFVV 112


>gi|127512303|ref|YP_001093500.1| flagellar basal body-associated protein FliL [Shewanella loihica
           PV-4]
 gi|126637598|gb|ABO23241.1| flagellar basal body-associated protein FliL [Shewanella loihica
           PV-4]
          Length = 173

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 14/168 (8%), Positives = 53/168 (31%), Gaps = 21/168 (12%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
              K  + +  +   + +  G    + +                 +       ++  +  
Sbjct: 16  KSKKKLIIFAAIGALLVVLLGVGAWLFLSGG-----------EPSDETMAEGEQTEQSEP 64

Query: 74  TISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD----KVFLETLHQDIMAYI 128
             S +   +   +P + N     +   + + + L+ +   D    K  +  +   ++   
Sbjct: 65  ANSREAFYVGMPRPFLFNLPGQNRSRLVEIKVQLMVRGSDDDVLIKKHIPLIEDALLTTF 124

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
            +  +++++   G    ++     V+     +  +  V  V+F  F++
Sbjct: 125 SSADVQKLSSLAGKDELRQLALLNVQNTLQPVTGRKVVEKVLFTGFVM 172


>gi|225849154|ref|YP_002729318.1| flagellar basal body-associated protein FliL [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225644683|gb|ACN99733.1| flagellar basal body-associated protein FliL [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 169

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 21/120 (17%), Positives = 39/120 (32%), Gaps = 6/120 (5%)

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIPDK-- 114
            +   +     V        +      +   I N        ++++ I +  +D   K  
Sbjct: 47  ASKNEEKPAEKVTKEVKNVEEHGVELEVGTFIANLADKDADRYIKVTIVMEVQDEKVKEE 106

Query: 115 --VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
               +  +   I   + T + + +   +G    KE+I  RV      G V  V F  FII
Sbjct: 107 ATKRMPQIKDSINTLLFTKTSEDLKSPEGIERLKEEIIRRVNAILPTGGVKDVYFTEFII 166


>gi|319409182|emb|CBI82826.1| Flagellar basal body-associated protein FliL [Bartonella
           schoenbuchensis R1]
          Length = 165

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 73/160 (45%), Gaps = 14/160 (8%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
           N  K  +   VV T +    GWL G+ +             K +  +  D+         
Sbjct: 16  NSVKTLLIVGVVLTVVAAASGWLLGMWVS------------KEVTPSSNDSKEPVAKASA 63

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD--KVFLETLHQDIMAYIRTV 131
           ++ +   ++  L PI+TN     K W+R++IAL+ K   +     +  +  D ++++  +
Sbjct: 64  SLIMDDSRMIILPPILTNIAVPDKTWIRMEIALVVKPGENISPDMVADISNDFVSFLHQM 123

Query: 132 SIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +I+Q+ G  G    + D+ +R K+RS   +S+++  + +I
Sbjct: 124 TIEQVKGPSGLMNLRSDLFDRAKIRSDDKISNILISSLVI 163


>gi|117919796|ref|YP_868988.1| flagellar basal body-associated protein FliL [Shewanella sp. ANA-3]
 gi|117612128|gb|ABK47582.1| flagellar basal body-associated protein FliL [Shewanella sp. ANA-3]
          Length = 174

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 15/172 (8%), Positives = 50/172 (29%), Gaps = 22/172 (12%)

Query: 10  YIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSV 69
             +  +  +F+   V+   +     W      L           +          +    
Sbjct: 14  APKSKKKFIFIGAGVLAALLIGGALWFF----LGSSDEAPAASAE--------GTAPTES 61

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK----VFLETLHQDI 124
            T    +     +   +P + N     +   + + + L+ +   D       +  +   +
Sbjct: 62  TTPAADAAMAAYVPMPRPFLFNLPGPDRARLVEIKVQLMVRGQDDDVLTQKHIPLIEDAL 121

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
           +       +++++   G    ++     V+     +  +  V  V+F  F++
Sbjct: 122 LTTFSGADVQKLSTQAGKDELRQLALLSVQNTLQSVTGRKVVEKVLFTGFVM 173


>gi|242281269|ref|YP_002993398.1| flagellar basal body-associated protein FliL [Desulfovibrio
           salexigens DSM 2638]
 gi|242124163|gb|ACS81859.1| flagellar basal body-associated protein FliL [Desulfovibrio
           salexigens DSM 2638]
          Length = 166

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 17/177 (9%), Positives = 49/177 (27%), Gaps = 18/177 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D+      +G   K  +   ++    G                       Q      
Sbjct: 1   MA-DEGQEPKKKGGMLKWIILILLLAILGGGGFFAYKKFF-----------AAQPEDAVE 48

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDIP----DKV 115
              ++  +               +L   + N      + +L+L + +             
Sbjct: 49  EPKDNQAAEGEDPGTLPGDGFTVTLPTFVVNLADPLGRRYLKLGVDVEVISEEAVAELSK 108

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               +   ++  + + + + ++  +     K++I +R+  +     V  V F   +I
Sbjct: 109 KEPMVKDTLILLLSSKTYQDLSTMESKILLKKEIVDRLNQILGGSKVLQVYFTDMVI 165


>gi|330502772|ref|YP_004379641.1| flagellar basal body-associated protein FliL [Pseudomonas mendocina
           NK-01]
 gi|328917058|gb|AEB57889.1| flagellar basal body-associated protein FliL [Pseudomonas mendocina
           NK-01]
          Length = 172

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 22/183 (12%), Positives = 54/183 (29%), Gaps = 24/183 (13%)

Query: 1   MSYDDTTSQY--IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+  +           + KL +   +V   +      +GG   +                
Sbjct: 1   MAKKEAAPAADGQPAGKSKLKLIMLIVVGLLLAVGLSIGGTWFILSKGD----------- 49

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD-SSPKDWLRLDIALICKD----IPD 113
               +           +    +    +   + NF+  +   +L++ +AL+ +D       
Sbjct: 50  -KHEEAKPEEAAAAAPVRQPAIYQDLMPAFVVNFNYQNRTRYLQVSMALMSRDAAGMEKL 108

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRT 168
           KV +  L   ++  +       +    G     +     V+  +Q       V  V+F  
Sbjct: 109 KVHMPVLRNRLVMLLSGQDFAALQTPLGKEMLLQQALASVQELAQKETGSTVVEQVLFTN 168

Query: 169 FII 171
           F++
Sbjct: 169 FVL 171


>gi|149203112|ref|ZP_01880083.1| possible flagellar synthesis protein [Roseovarius sp. TM1035]
 gi|149143658|gb|EDM31694.1| possible flagellar synthesis protein [Roseovarius sp. TM1035]
          Length = 167

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 22/178 (12%), Positives = 52/178 (29%), Gaps = 19/178 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLG---GIVMLFLFAGQKEEKYQKFI 57
           M     T         K  +   +V   +G   G+     G++ L    G   +      
Sbjct: 1   MPETGDTETAPEAKPSKRPLMIGIVLALLGAAAGFYTMWSGLIPLGGGHGSIAQGPAAGA 60

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI---PDK 114
             +              + +   Q             + +  LR    L  K       +
Sbjct: 61  AASDMPMGDLVFVPVVPVVVSVGQ------------GAARSHLRFAAELEVKAAHKSDVE 108

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
             +  +      Y+R + +  I  AQ     +  +  R+++   +G ++ ++   F++
Sbjct: 109 NLMPRIVDVTNTYLRALKLADIEDAQSLIRLRAQLLRRMQVVTGEGRINDLLIMEFVL 166


>gi|67641905|ref|ZP_00440670.1| flagellar protein FliL [Burkholderia mallei GB8 horse 4]
 gi|121600910|ref|YP_994776.1| flagellar basal body-associated protein FliL [Burkholderia mallei
           SAVP1]
 gi|124386222|ref|YP_001027843.1| flagellar basal body-associated protein FliL [Burkholderia mallei
           NCTC 10229]
 gi|126450837|ref|YP_001082209.1| flagellar basal body-associated protein FliL [Burkholderia mallei
           NCTC 10247]
 gi|126452861|ref|YP_001064313.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 1106a]
 gi|134281516|ref|ZP_01768224.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 305]
 gi|167000457|ref|ZP_02266271.1| flagellar protein FliL [Burkholderia mallei PRL-20]
 gi|167717394|ref|ZP_02400630.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei DM98]
 gi|167736437|ref|ZP_02409211.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 14]
 gi|167822053|ref|ZP_02453524.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 9]
 gi|167843666|ref|ZP_02469174.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei B7210]
 gi|167892137|ref|ZP_02479539.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 7894]
 gi|167900649|ref|ZP_02487854.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei NCTC 13177]
 gi|167908869|ref|ZP_02495960.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 112]
 gi|167916908|ref|ZP_02503999.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei BCC215]
 gi|217424017|ref|ZP_03455517.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 576]
 gi|226193178|ref|ZP_03788788.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei Pakistan 9]
 gi|237814421|ref|YP_002898872.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei MSHR346]
 gi|242315063|ref|ZP_04814079.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 1106b]
 gi|254175292|ref|ZP_04881953.1| flagellar protein FliL [Burkholderia mallei ATCC 10399]
 gi|254184091|ref|ZP_04890682.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 1655]
 gi|254186557|ref|ZP_04893074.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254194704|ref|ZP_04901135.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei S13]
 gi|254201360|ref|ZP_04907724.1| flagellar protein FliL [Burkholderia mallei FMH]
 gi|254206702|ref|ZP_04913053.1| flagellar protein FliL [Burkholderia mallei JHU]
 gi|254259029|ref|ZP_04950083.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 1710a]
 gi|254298641|ref|ZP_04966092.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 406e]
 gi|254357365|ref|ZP_04973639.1| flagellar protein FliL [Burkholderia mallei 2002721280]
 gi|52208079|emb|CAH34009.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei K96243]
 gi|52427326|gb|AAU47919.1| flagellar protein FliL [Burkholderia mallei ATCC 23344]
 gi|121229720|gb|ABM52238.1| flagellar protein FliL [Burkholderia mallei SAVP1]
 gi|124294242|gb|ABN03511.1| flagellar protein FliL [Burkholderia mallei NCTC 10229]
 gi|126226503|gb|ABN90043.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 1106a]
 gi|126243707|gb|ABO06800.1| flagellar protein FliL [Burkholderia mallei NCTC 10247]
 gi|134247183|gb|EBA47269.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 305]
 gi|147747254|gb|EDK54330.1| flagellar protein FliL [Burkholderia mallei FMH]
 gi|147752244|gb|EDK59310.1| flagellar protein FliL [Burkholderia mallei JHU]
 gi|148026429|gb|EDK84514.1| flagellar protein FliL [Burkholderia mallei 2002721280]
 gi|157808617|gb|EDO85787.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 406e]
 gi|157934242|gb|EDO89912.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160696337|gb|EDP86307.1| flagellar protein FliL [Burkholderia mallei ATCC 10399]
 gi|169651454|gb|EDS84147.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei S13]
 gi|184214623|gb|EDU11666.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 1655]
 gi|217393080|gb|EEC33102.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 576]
 gi|225934778|gb|EEH30755.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei Pakistan 9]
 gi|237505454|gb|ACQ97772.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei MSHR346]
 gi|238522918|gb|EEP86360.1| flagellar protein FliL [Burkholderia mallei GB8 horse 4]
 gi|242138302|gb|EES24704.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 1106b]
 gi|243063645|gb|EES45831.1| flagellar protein FliL [Burkholderia mallei PRL-20]
 gi|254217718|gb|EET07102.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 1710a]
          Length = 165

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 54/182 (29%), Gaps = 29/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +     +  KL      +   I       GG   +                  
Sbjct: 1   MATTANPTVDKPASSGKLKRLVLFLLIGIVAAAAAAGGTYFMLS---------------- 44

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPDKV--- 115
                  S        L     F L+P+  N  S      +LR+ ++L   D   +    
Sbjct: 45  --KEGAHSAAPSAPAPLAVPAFFPLEPLTVNLLSDDGIQHYLRVGLSLKLTDPKAQEYLT 102

Query: 116 -FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTF 169
             +  L   I+  +     +Q+   +G     ++++  ++  +Q       V  V+F  F
Sbjct: 103 QHMPELRSRILLALSNKHPEQLATLEGKHALADELKTLIEQPTQPGNQSARVDDVLFTEF 162

Query: 170 II 171
           ++
Sbjct: 163 VV 164


>gi|149377879|ref|ZP_01895608.1| Flagellar basal body-associated protein [Marinobacter algicola
           DG893]
 gi|149357821|gb|EDM46314.1| Flagellar basal body-associated protein [Marinobacter algicola
           DG893]
          Length = 169

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 17/179 (9%), Positives = 53/179 (29%), Gaps = 19/179 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   +          +    V   + +    +G +  L        +  Q+     
Sbjct: 1   MAENNAPPEAPAKKGKLKLILMLTVVIVLAVGLSVVGTMWFLGGGIPGMGDAEQE----- 55

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK----VF 116
                  S    +        +     + T      + + ++ +A   +D          
Sbjct: 56  ------DSSEQVEVFVPSTYTVLEKALVTTVQAEGRQRYAQVYLAFEAQDPAALAAANQH 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK----LRSQGFVSSVIFRTFII 171
           +  L   ++  +      ++   +G +   +D+   V        +  + +V+FR F++
Sbjct: 110 MPLLRSKLIGVLGGRDFNELQTPEGRKALADDMLATVNNALEQEGEPPLLAVLFRNFVV 168


>gi|159045803|ref|YP_001534597.1| flagellar basal body-associated protein FliL [Dinoroseobacter
           shibae DFL 12]
 gi|157913563|gb|ABV94996.1| flagellar basal body-associated protein FliL [Dinoroseobacter
           shibae DFL 12]
          Length = 166

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/166 (12%), Positives = 51/166 (30%), Gaps = 21/166 (12%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVH 70
            +    KLF+   +V    G   G+      L L    +  + +                
Sbjct: 16  PKKKGGKLFLIIGLVLLLAGGGGGFYAVYSGLILAPATETAETEPE-------------- 61

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICKD---IPDKVFLETLHQDIMA 126
                   ++    L P++     + ++ +LR    L  +             +   +  
Sbjct: 62  --PRDQGPEVAFVPLDPLVVTLGENGRNSYLRFTAELEVESRYETEVAHLRPRVLDVLNG 119

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           Y+R V  + +         +  +  RV++   +G V  ++   F++
Sbjct: 120 YLRAVQAQDLEAPAALARLRSQMLHRVQIVTGEGRVRDLLVTEFVL 165


>gi|254439277|ref|ZP_05052771.1| flagellar basal body-associated protein FliL [Octadecabacter
           antarcticus 307]
 gi|198254723|gb|EDY79037.1| flagellar basal body-associated protein FliL [Octadecabacter
           antarcticus 307]
          Length = 194

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/197 (10%), Positives = 57/197 (28%), Gaps = 30/197 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL-- 58
           MS ++      +       +  F V   + +  G   G  +    +   E+     I   
Sbjct: 1   MSEEEEP----KKKSGLGTILTFGVIGLVMMGVGIGAGYFLFGGQSNSPEQLAAAIIERN 56

Query: 59  --------------NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDI 104
                             +   R         + +   + +   +T      + +L++ +
Sbjct: 57  DGALTAEVEEDASDETEGEIPERQSKDSARDDVFQTLYYEIPGTMTTNLKDSRRFLQIGV 116

Query: 105 ALICKDIPD-----KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ- 158
            +  +         +  L  +   I+A +       + G +      ED++  +    + 
Sbjct: 117 GISTQYDEVILQNVEANLLAIKAAILATLSDYGEADVVGREARNALSEDLKATINAELEA 176

Query: 159 ----GFVSSVIFRTFII 171
               G V  V+  +F++
Sbjct: 177 LEGFGGVEGVLLTSFVM 193


>gi|170747254|ref|YP_001753514.1| flagellar basal body-associated protein FliL [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653776|gb|ACB22831.1| cyclic nucleotide-binding protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 184

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/175 (13%), Positives = 60/175 (34%), Gaps = 5/175 (2%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           S ++  +      + K  +   V    + +     G  VM+     ++  +       + 
Sbjct: 9   SAEEGETGAEGAPKGKKKLMIMVAVAVLVVGGAGAGAFVMMGRGDSKQAAQGGDHGGGHG 68

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----IPDKVFL 117
             ++  +   G    +       L  +          + ++ I+L  KD       +  +
Sbjct: 69  GGDAKGAGPEGKKPVVFVDVREMLLNLSPELPQDKGRFAKVRISLELKDAKVEEEVRPLM 128

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
             +   +  Y+R +    IT + G    +E++  RV +      V +V+F+  I+
Sbjct: 129 PRVEDALQVYMRELRASDITNSVGLFRLREELLRRVNIALYPAKVDAVLFKDVIV 183


>gi|296283226|ref|ZP_06861224.1| flagellar basal body-associated protein [Citromicrobium
           bathyomarinum JL354]
          Length = 183

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 57/176 (32%), Gaps = 10/176 (5%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +  +  ++  R ++ K  +        +G   G     +M      + +E          
Sbjct: 9   AKPEEGAKPPRFSKKKKIIAAAGAVLLVGGGAG---AFLMGGGSDAEAKESGDHSGKEAK 65

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPD----KV 115
            D        G         +  + P++ N  ++     +L+L I L      D    + 
Sbjct: 66  KDAGHGEKSGGGHGEEGGSGLVEVAPLMVNLRTNDGQARFLKLRIMLAPGSPEDATTIEE 125

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKED-IEERVKLRSQGFVSSVIFRTFI 170
            L  +      ++R +  + + G+      KE+ I        +G V+ V+ +  +
Sbjct: 126 NLPMIIDRYQPFLRELRPEDLAGSAAVYRLKEELILRAADTVGEGVVADVLIQDMV 181


>gi|161523224|ref|YP_001578236.1| flagellar basal body-associated protein FliL [Burkholderia
           multivorans ATCC 17616]
 gi|189348919|ref|YP_001944547.1| flagellar basal body-associated protein FliL [Burkholderia
           multivorans ATCC 17616]
 gi|160340653|gb|ABX13739.1| flagellar basal body-associated protein FliL [Burkholderia
           multivorans ATCC 17616]
 gi|189332941|dbj|BAG42011.1| flagellar FliL protein [Burkholderia multivorans ATCC 17616]
          Length = 177

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 38/119 (31%), Gaps = 11/119 (9%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DKVFL 117
                    +   L     F L P+  N  S      +LR+ ++L   D          +
Sbjct: 58  QGATHASAAEPAPLAAPVFFPLDPLTVNLQSDDGVQHYLRVGLSLKLTDPKAQEQLTARM 117

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
             +   ++  +     + I    G +   + +   ++  +Q       V  V+F  F++
Sbjct: 118 PEIRSRVLLALSNKHPEDIATPDGKQALAQQLRNLIEEPTQPGNQRTKVDDVLFTEFVV 176


>gi|330808224|ref|YP_004352686.1| flagellar basal body-associated protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327376332|gb|AEA67682.1| flagellar basal body-associated protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 167

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 16/181 (8%), Positives = 51/181 (28%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  +      + KL +   +V   +      +G        A  K     +     
Sbjct: 1   MAKSEAAAVKDPATKGKLKLIIMIVVGLLLAIGVSVGATWYFMHSAQSKPAVAVEAA--- 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDKV 115
                              +        + N+  + +  ++++ I L           +V
Sbjct: 58  ------------PVGKQPAIFEPMAPAFVANYTQNGRQRYMQVSITLLGRNQADLEALRV 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +  +  +++      +   +    G    ++     V+  +Q       +  ++F  F+
Sbjct: 106 HMPLIRNNLVMLFSGQNFDTLATPVGQEMLRQKATASVQEVAQKELGKVVIEQLLFTNFV 165

Query: 171 I 171
           +
Sbjct: 166 L 166


>gi|253990100|ref|YP_003041456.1| flagellar basal body-associated protein FliL [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253781550|emb|CAQ84713.1| flagellar flil protein [Photorhabdus asymbiotica]
          Length = 181

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 51/175 (29%), Gaps = 34/175 (19%)

Query: 9   QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRS 68
            Y R  ++  ++   V+   IG   G                                  
Sbjct: 28  SYERKRKNPFWMILLVLIAVIGAAIGGYSWWAF----------------------KQAEK 65

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKVFL----ETLH 121
             +  + +++     +L+P   N   +   +   L + + L   D   +         + 
Sbjct: 66  SDSVASKTIEVPVFMTLEPFTVNLIDNEDHFDRVLYVGVTLRLADEKTRQRFHEYLPEIR 125

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGF----VSSVIFRTFII 171
             ++  +      ++    G      DI++ +      G     ++ V+F TFI+
Sbjct: 126 SRMLLLLSRQKSAELAHDNGKLRLMNDIKQTLSPTLVPGEPDQVITDVLFTTFIL 180


>gi|157961195|ref|YP_001501229.1| flagellar basal body-associated protein FliL [Shewanella pealeana
           ATCC 700345]
 gi|157846195|gb|ABV86694.1| flagellar basal body-associated protein FliL [Shewanella pealeana
           ATCC 700345]
          Length = 172

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 18/182 (9%), Positives = 57/182 (31%), Gaps = 22/182 (12%)

Query: 1   MSYDDTTS-QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ +     +     + K  +  F V   + +    L   ++L      +     +    
Sbjct: 1   MAEEAALELEDSVKPKSKNKLIIFGVSGGVLLIAIVLTAWMLLGSEPVSESGSAAE---- 56

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK---- 114
                   +V      + +       +P + N   + +   + + + L+ +   D     
Sbjct: 57  -------GAVTEQAVRTGEAYYAAMPRPFLFNLSDNGRTRLVEIKVQLMVRGNDDDTLIR 109

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTF 169
             +  +   ++       ++++T   G    ++     V+     +  +  V  V+F  F
Sbjct: 110 KHIPLIEDALLTTFSGSDVQKLTSPAGKDELRQLALRNVQNTLQPVTGRTVVEKVLFTGF 169

Query: 170 II 171
           ++
Sbjct: 170 VM 171


>gi|170698081|ref|ZP_02889162.1| flagellar basal body-associated protein FliL [Burkholderia
           ambifaria IOP40-10]
 gi|170137042|gb|EDT05289.1| flagellar basal body-associated protein FliL [Burkholderia
           ambifaria IOP40-10]
          Length = 178

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 41/121 (33%), Gaps = 11/121 (9%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DKV 115
                 +    +   L     F L P+  N  S      +LR+ ++L   D         
Sbjct: 57  KAGVGHTSAPAEPAPLAAPVFFPLDPLTVNLQSDDGVQHYLRVGLSLKLTDPKAQEQLTA 116

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFI 170
            +  +   I+  +     + +   +G     +++ E ++  +Q       V  V+F  F+
Sbjct: 117 RMPEIRSRILLALSNKHPEDLATPEGKHSLAKELRELIEQPTQPGNQRAKVDDVLFTEFV 176

Query: 171 I 171
           +
Sbjct: 177 V 177


>gi|195953028|ref|YP_002121318.1| flagellar basal body-associated protein FliL [Hydrogenobaculum sp.
           Y04AAS1]
 gi|195932640|gb|ACG57340.1| flagellar basal body-associated protein FliL [Hydrogenobaculum sp.
           Y04AAS1]
          Length = 161

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 53/179 (29%), Gaps = 29/179 (16%)

Query: 1   MSYDDTTSQY--IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +    +     G + KL      V   +          ++       K+        
Sbjct: 1   MAEEQVKKEEIGKTGGKKKLIFILIPVILLLIGGGAGAYFFLIHKKRESTKQMVVASQ-- 58

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDI----PD 113
                              K   +++L   + N        + ++ I L   +       
Sbjct: 59  -------------------KLGVMYNLGSFLVNLADKNANTYAKVSITLELSNEKVQQEV 99

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              L  +   I+  + + +  +I   +G    + ++ +R+  +   G V ++ F  FI+
Sbjct: 100 VKRLPIIKDAIINLLSSKTYDEIRTPEGKEELRLELIKRINAILVTGGVQNIYFTQFIV 158


>gi|319787094|ref|YP_004146569.1| flagellar basal body-associated protein FliL [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465606|gb|ADV27338.1| flagellar basal body-associated protein FliL [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 172

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 50/175 (28%), Gaps = 29/175 (16%)

Query: 7   TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSV 66
           TS+   G +  L +T   V    G   GW                               
Sbjct: 14  TSRPRDGGKLPLVITLVAVLVACGAGGGWYW------------------SSRRAVAAEQA 55

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDS--SPKDWLRLDIALICKDI----PDKVFLETL 120
            +      +  +   +    P + N +       +L+++I L+ +D       +     +
Sbjct: 56  AAEAAKPKLPAQAQYLALEPPFVVNLNGGLDGPQYLQVEIQLMTRDNADLAELQRHAPAI 115

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
              ++  +   +   I    G    + +    V+        +    +++F +F+
Sbjct: 116 RARLLMLLAQQTADGIANRAGKEALQAEALAEVRKLMRTETGKPCAEALLFTSFV 170


>gi|115523184|ref|YP_780095.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisA53]
 gi|115517131|gb|ABJ05115.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisA53]
          Length = 163

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 44/174 (25%), Positives = 83/174 (47%), Gaps = 15/174 (8%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS +D      + +    +V   ++ T +G   G L  + ++     Q+    QK I + 
Sbjct: 1   MSDEDAPKVERKQSSALQWVAVMLLLTAVGAAAGVLSSLHLVSTV--QRIADSQKEIQDR 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK---DIPDKVFL 117
              ++               ++  L P++TN  S P  W+RL+ A++     +    + +
Sbjct: 59  PVASA----------FSPSARLRKLSPVVTNLASPPNTWVRLEAAVVTDQLSEEEANILV 108

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             + +D++AY+RT+S  QI GA+G +Y +ED+ ER  +RS G V  +I  T ++
Sbjct: 109 ARVGEDVVAYLRTISPAQIEGARGLQYLREDLNERAAIRSSGKVRELIIETLVV 162


>gi|27381979|ref|NP_773508.1| flagellar protein [Bradyrhizobium japonicum USDA 110]
 gi|27355149|dbj|BAC52133.1| flagellar protein [Bradyrhizobium japonicum USDA 110]
          Length = 148

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 68/156 (43%), Gaps = 15/156 (9%)

Query: 19  FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLK 78
            +   V  T + I  G L G+ +          +       +     + S + G      
Sbjct: 4   LIAAIVALTLVAIGAGALAGLHLF------AAAERVADAKKSPTPPPLASSYAGSA---- 53

Query: 79  KLQIFSLQPIITNFDSSPKDWLRLDIALICK---DIPDKVFLETLHQDIMAYIRTVSIKQ 135
             ++  L PI+TN  +   +W R++ +++     D    +    + +DI+ Y+R+ S  Q
Sbjct: 54  --RLRKLSPIVTNLAAPANNWARVEASMVTDSMSDEDAGILAAHISEDIVTYLRSASAAQ 111

Query: 136 ITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             G++G ++ ++D+ ER  +RS G V  +I  T +I
Sbjct: 112 FEGSRGLQHLRDDLAERANVRSSGKVRELIIETLVI 147


>gi|328543158|ref|YP_004303267.1| flagellar basal body-associated protein FliL [polymorphum gilvum
           SL003B-26A1]
 gi|326412904|gb|ADZ69967.1| Flagellar basal body-associated protein FliL [Polymorphum gilvum
           SL003B-26A1]
          Length = 167

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 50/163 (30%), Gaps = 22/163 (13%)

Query: 15  QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDT 74
           + K  +        + +  G      +               I                 
Sbjct: 20  KRKKLIIIGAGGLVLLLALGAGAYFFLFSSSEPPPMVGEDGAIREAQKP----------- 68

Query: 75  ISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICKDIP----DKVFLETLHQDIMAYIR 129
                +  + L  +  N  +  +  +L++ IAL  +D       K FL  +      Y+R
Sbjct: 69  -----VVFYDLPEMTVNLSTEGRTTYLKVRIALEVQDKEMIERIKPFLPRIMDAFQIYLR 123

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
            +    + G+ G    KE++  R+ L      V  V+F+  ++
Sbjct: 124 ELRPADLEGSAGLFRLKEELLRRINLSVHPARVDGVLFKEILV 166


>gi|304392501|ref|ZP_07374441.1| flagellar basal body-associated protein FliL [Ahrensia sp. R2A130]
 gi|303295131|gb|EFL89491.1| flagellar basal body-associated protein FliL [Ahrensia sp. R2A130]
          Length = 150

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 40/164 (24%), Positives = 68/164 (41%), Gaps = 16/164 (9%)

Query: 8   SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVR 67
           +   +       +  FV+ T IG   G+ G          +K     + +          
Sbjct: 2   AAEKKKGGVLGTIIMFVMVTAIGAGMGFGGLWF----QGQKKVAVEPEIVAKGEKPEPA- 56

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAY 127
                       L +  LQPI+TN  +    W+RL+++L+  D  D    E + QD+ A 
Sbjct: 57  -----------TLHVHDLQPILTNIAAPKDVWVRLELSLLTVDAIDAKLAEEIGQDLFAL 105

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +RT+ + Q+ G  GF   +  I++R K R    V  V+FRT ++
Sbjct: 106 MRTIRLDQMEGPSGFLALRHAIDQRAKFRGGEMVERVLFRTLVL 149


>gi|304316898|ref|YP_003852043.1| flagellar basal body-associated protein FliL [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778400|gb|ADL68959.1| flagellar basal body-associated protein FliL [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 132

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 13/104 (12%), Positives = 35/104 (33%), Gaps = 5/104 (4%)

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----IPDKVFLETLHQDIMAYI 128
              +      +S              +++  + L   D       K     +   I+  +
Sbjct: 28  SKPAKIVYYNYSPGDEFVTNLKGDDKFIKAGVELEVYDKNVLNELKDQNPKIRDAILQIL 87

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           R  + + + G+ G    + +I+  +  +     +++V F  FI+
Sbjct: 88  RNKTAQDLEGSAGQSKLQNEIKNEINKILGADKITNVYFDDFIV 131


>gi|115350089|ref|YP_771928.1| flagellar basal body-associated protein FliL [Burkholderia
           ambifaria AMMD]
 gi|115280077|gb|ABI85594.1| flagellar basal body-associated protein FliL [Burkholderia
           ambifaria AMMD]
          Length = 178

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 38/102 (37%), Gaps = 11/102 (10%)

Query: 81  QIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIK 134
             F L P+  N  S      +LR+ ++L   D          +  +   I+  +     +
Sbjct: 76  VFFPLDPLTVNLQSDDGVQHYLRVGLSLKLTDPKAQEQLTARMPEIRSRILLALSNKHPE 135

Query: 135 QITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
            +   +G     +++ E ++  +Q       V  V+F  F++
Sbjct: 136 DLATPEGKHSLAKELRELIEQPTQPGNQRAKVDDVLFTEFVV 177


>gi|85711036|ref|ZP_01042096.1| flagellar basal body-associated protein [Idiomarina baltica OS145]
 gi|85694949|gb|EAQ32887.1| flagellar basal body-associated protein [Idiomarina baltica OS145]
          Length = 177

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 17/183 (9%), Positives = 58/183 (31%), Gaps = 19/183 (10%)

Query: 1   MSYDDTTSQYIRG--NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +D   +         K ++        + +        +M    A    +       
Sbjct: 1   MAENDNQEESSEKAPGGKKKWLIIGAAAILLVVIIIVAVWFLMGTKQASSASDMGA---- 56

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV-- 115
                 S   + +        L +   +P +       +   +++++ L+ +    +   
Sbjct: 57  ---GGGSSEEMTSEPAQVGNALYVGMPRPFVFIVPGDSRDRTVQINVQLMVRGERSEELT 113

Query: 116 --FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRT 168
              +  +   +     + +  ++  A+G +  +E   ++V+     +  +G V  V+F  
Sbjct: 114 KQHIPLIEGTLHEVFSSSTADELRTAEGKQRIRELALKQVRSALESVTGEGLVEKVLFTG 173

Query: 169 FII 171
            ++
Sbjct: 174 LVM 176


>gi|319427065|gb|ADV55139.1| flagellar basal body protein, FliL [Shewanella putrefaciens 200]
          Length = 169

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 18/184 (9%), Positives = 60/184 (32%), Gaps = 29/184 (15%)

Query: 1   MSYDDT---TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ +++    +     ++ KLF+   +      +  G L     L        E  +  +
Sbjct: 1   MANEESLELENTDTPKSKKKLFIFIGIGVLVALLIGGALWFF--LGSSDESSSEAVEAVV 58

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK-- 114
                             ++    +   +P + N     +   + + + L+ +   D+  
Sbjct: 59  ET--------------PSNVVASYVPMPRPFLFNLPGPDRARLVEIKVQLMVRGSDDEVL 104

Query: 115 --VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFR 167
               +  +   ++    +  +++++   G    ++     V+     +  +  V  V+F 
Sbjct: 105 IQKHIPLIEDALLTTFSSSDVQKLSTQAGKDEARQLALLSVQNTLQSVTGRKVVEKVLFT 164

Query: 168 TFII 171
            F++
Sbjct: 165 GFVM 168


>gi|90415346|ref|ZP_01223280.1| hypothetical protein GB2207_08521 [marine gamma proteobacterium
           HTCC2207]
 gi|90332669|gb|EAS47839.1| hypothetical protein GB2207_08521 [marine gamma proteobacterium
           HTCC2207]
          Length = 191

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 18/190 (9%), Positives = 55/190 (28%), Gaps = 19/190 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGI-FCGWLGGIVMLFLFAG--------QKEE 51
           MS ++   +  +    K+ +    +   + I   G L          G          E 
Sbjct: 1   MSEENLEEEKAKSPILKIILIVVGILLLVAITVGGTLFATGFFDANEGLAAEEAIAALEA 60

Query: 52  KYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI 111
           +              +       ++  +   F L  ++    S+ +  ++  +A++    
Sbjct: 61  EAAAQAEAAAAAGPDKVKQDSPELTRFEPSYFVLPKVLVANISNSRKVMQATVAIMTHYD 120

Query: 112 P-----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FV 161
                        L   ++  +R ++  ++            ++  +    +G      +
Sbjct: 121 ERVIDNVDKHDFPLRFAMLKVMRNITEAEVADKDFQDNLAAALKTEMNAVLEGLEDFGGI 180

Query: 162 SSVIFRTFII 171
            +V F  F++
Sbjct: 181 EAVYFTEFVV 190


>gi|107021591|ref|YP_619918.1| flagellar basal body-associated protein FliL [Burkholderia
           cenocepacia AU 1054]
 gi|116688065|ref|YP_833688.1| flagellar basal body-associated protein FliL [Burkholderia
           cenocepacia HI2424]
 gi|170731415|ref|YP_001763362.1| flagellar basal body-associated protein FliL [Burkholderia
           cenocepacia MC0-3]
 gi|254246642|ref|ZP_04939963.1| Flagellar basal body-associated protein FliL [Burkholderia
           cenocepacia PC184]
 gi|105891780|gb|ABF74945.1| flagellar basal body-associated protein FliL [Burkholderia
           cenocepacia AU 1054]
 gi|116646154|gb|ABK06795.1| flagellar basal body-associated protein FliL [Burkholderia
           cenocepacia HI2424]
 gi|124871418|gb|EAY63134.1| Flagellar basal body-associated protein FliL [Burkholderia
           cenocepacia PC184]
 gi|169814657|gb|ACA89240.1| flagellar basal body-associated protein FliL [Burkholderia
           cenocepacia MC0-3]
          Length = 177

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/182 (14%), Positives = 56/182 (30%), Gaps = 28/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+   T +     +  K      +    +G      GG+ +    AG             
Sbjct: 12  MATTATPTADKPASSGKFKRIALIAVIALGAAAAAAGGMYVFLNKAGV------------ 59

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DK 114
                       +   L     F L P+  N  S      +LR+ ++L   D        
Sbjct: 60  -----GHPSAPAEPAPLAAPVFFPLDPLTVNLQSDDGAQHYLRVGLSLKLTDPKAQEQLT 114

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTF 169
             +  +   I+  +     +++   +G R    ++ E ++  +Q       V  V+F  F
Sbjct: 115 ARMPEIRSRILLALSNKHPEELATPEGKRSLATELRELIEQPTQPGNQRAKVDDVLFTEF 174

Query: 170 II 171
           ++
Sbjct: 175 VV 176


>gi|78064702|ref|YP_367471.1| flagellar basal body-associated protein FliL [Burkholderia sp. 383]
 gi|77965447|gb|ABB06827.1| Flagellar basal body-associated protein FliL [Burkholderia sp. 383]
          Length = 178

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 38/102 (37%), Gaps = 11/102 (10%)

Query: 81  QIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIK 134
             F L P+  N  S      +LR+ ++L   D          +  +   I+  +     +
Sbjct: 76  VFFPLDPLTVNLQSDDGAQHYLRVGLSLKLTDPKAQEQLTARMPEIRSRILLALSNKHPE 135

Query: 135 QITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
            +    G R   +++ E ++  +Q       V  V+F  F++
Sbjct: 136 DLATPDGKRSLAKELRELIEQPTQPGNQRAKVDDVLFTEFVV 177


>gi|157376192|ref|YP_001474792.1| flagellar basal body-associated protein FliL [Shewanella sediminis
           HAW-EB3]
 gi|157318566|gb|ABV37664.1| flagellar basal body-associated protein FliL [Shewanella sediminis
           HAW-EB3]
          Length = 173

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 17/172 (9%), Positives = 54/172 (31%), Gaps = 22/172 (12%)

Query: 10  YIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSV 69
               ++ KL +   +    + +  G L   +                         V + 
Sbjct: 13  QEPKSKKKLVIFGAIGLVLVLLIGGGLWFFLGSSD------------TAETVDTEEVATE 60

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD----KVFLETLHQDI 124
                 S +   +   +P + N   + +   + + + L+ +   D    K  +  +   +
Sbjct: 61  TGEPVNSGEAYYVGMPRPFLFNLPGANRSRLVEIKVQLMVRGSEDDLLIKKHIPLIEDAL 120

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
           +    +  +++++   G    ++     V+     +  +  V  V+F  F++
Sbjct: 121 LTTFSSADVQKLSSLAGKDEMRQMALLNVQNTLQPVTGRKVVEKVLFTGFVM 172


>gi|311695207|gb|ADP98080.1| flagellar basal body-associated protein FliL [marine bacterium
           HP15]
          Length = 169

 Score = 74.8 bits (182), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 20/179 (11%), Positives = 54/179 (30%), Gaps = 19/179 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++ +            +   VV   + I    +G +  L        E         
Sbjct: 1   MAENNESEAAPAKKGKLKLIIMLVVVVILAIVLSVVGTLWFLGGGLPGMGE--------- 51

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI----PDKVF 116
             +    +    +T       +     + T      + + +  +AL   D       K+ 
Sbjct: 52  --EEGDATEVPEETFIPSSYYLIEKAIVTTVQAEGRQRYAQAYLALESTDPQALEAAKLH 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR----SQGFVSSVIFRTFII 171
           +  +   ++  + + +  ++   +G     E +   V        +  +  V+FR F++
Sbjct: 110 MPLIRSQLVTVLGSSNFNELQTPEGRSGLAERMLTTVNQVLEQEGEPAIKRVLFRNFVV 168


>gi|307264878|ref|ZP_07546440.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|326389472|ref|ZP_08211039.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           ethanolicus JW 200]
 gi|306920136|gb|EFN50348.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|325994477|gb|EGD52902.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 135

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 16/104 (15%), Positives = 36/104 (34%), Gaps = 5/104 (4%)

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD----KVFLETLHQDIMAYI 128
           +         +S              +++  I L   D       +     +   I+  +
Sbjct: 31  NKPKEITYYNYSPGGEFITNLKGDGKFVKATIELQVADKNILKTLEERNPQIRDLIIQIL 90

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           R  + + + G +G    K DI+  +  +  +G + +V F  FI+
Sbjct: 91  RGKTEQDVEGPEGQEKLKNDIKNEINKIIGEGKIVNVYFDEFIV 134


>gi|78485774|ref|YP_391699.1| flagellar basal body-associated protein FliL [Thiomicrospira
           crunogena XCL-2]
 gi|78364060|gb|ABB42025.1| Flagellar basal body-associated protein FliL [Thiomicrospira
           crunogena XCL-2]
          Length = 197

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 21/196 (10%), Positives = 59/196 (30%), Gaps = 25/196 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +    +   G    + +   V+   + +    +  +++      Q     +      
Sbjct: 1   MAEEVQEEKKSSGGGKGMIIALLVIIVLLIVGVAVMTFVLLSGNGDNQTAHAEETTQHAP 60

Query: 61  FYDNSVRSVHT--------------GDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIA 105
              +    V +                       Q F+++P + NF    +  +L + + 
Sbjct: 61  AEHSDEPVVSSDGVVQQYSPKFKQYEPPEPGSPPQYFAMEPFVVNFKGEGQAKFLAVTLK 120

Query: 106 LICKDI----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF- 160
            +          + +   L  DI + +R  +   +    G    +E I  + +   +   
Sbjct: 121 FMSHYPQLITEMESYRPILRNDITSLLRVQTYSVMNKDDGPDILREKILTKARAVLEKRN 180

Query: 161 -----VSSVIFRTFII 171
                + +V F  F++
Sbjct: 181 IYPDLLENVYFERFVM 196


>gi|251772435|gb|EES53002.1| flagellar basal body-associated protein FliL [Leptospirillum
           ferrodiazotrophum]
          Length = 168

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 43/125 (34%), Gaps = 8/125 (6%)

Query: 55  KFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD---WLRLDIALICK-- 109
           K       ++  +         +K+  I  L+P + N          +L++ IAL     
Sbjct: 43  KAGARKEGEHHHQMTPKEMEKMIKEHPIVDLKPFVVNLSGPQGAAPQYLKVRIALKLDKA 102

Query: 110 --DIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIF 166
                 +  L  +   I+  +   +   I    G    K+ I  RV  R   G V+ V F
Sbjct: 103 LTAKEIEYRLPEIQSAILILLGAQTADAIQTTGGKLALKDAIRHRVNSRLDSGKVTDVYF 162

Query: 167 RTFII 171
             F++
Sbjct: 163 TEFVV 167


>gi|220924580|ref|YP_002499882.1| flagellar basal body-associated protein FliL [Methylobacterium
           nodulans ORS 2060]
 gi|219949187|gb|ACL59579.1| flagellar basal body-associated protein FliL [Methylobacterium
           nodulans ORS 2060]
          Length = 221

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 44/118 (37%), Gaps = 5/118 (4%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI----PDK 114
            +   ++ +                 +  + ++   S   +++L +AL  +D       +
Sbjct: 103 KSRAAHAEKQAAETKAPVAFMDLREMVMNLTSDIGQSQTRFIKLKVALEVRDAKVAAEIQ 162

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
             +  +      YIR +      G+ G    +E++  RV +      V +V+F+ F+I
Sbjct: 163 PLMPRVEDAFQVYIRELRPTDFEGSMGTYRLREELLRRVNVAVYPAKVDAVLFKEFVI 220


>gi|325527236|gb|EGD04618.1| flagellar basal body-associated protein FliL [Burkholderia sp.
           TJI49]
          Length = 167

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 41/121 (33%), Gaps = 11/121 (9%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DKV 115
              +  +    +   L     F L P+  N  S      +LR+ ++L   D         
Sbjct: 46  KQGASHAGAPAEPPPLAAPVFFPLDPLTVNLQSDDGVQHYLRVGLSLKLTDPKAQEQLTA 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFI 170
            +  +   I+  +     ++I    G     + + + ++  +Q       V  V+F  F+
Sbjct: 106 RMPEIRSRILLALSNKHPEEIATPDGKHALAQQLRDLIEQPTQPGNQRAKVDDVLFTEFV 165

Query: 171 I 171
           +
Sbjct: 166 V 166


>gi|167037658|ref|YP_001665236.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167040319|ref|YP_001663304.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           sp. X514]
 gi|256750751|ref|ZP_05491636.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|300914403|ref|ZP_07131719.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           sp. X561]
 gi|307724361|ref|YP_003904112.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           sp. X513]
 gi|320116073|ref|YP_004186232.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|166854559|gb|ABY92968.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           sp. X514]
 gi|166856492|gb|ABY94900.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256750334|gb|EEU63353.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|300889338|gb|EFK84484.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           sp. X561]
 gi|307581422|gb|ADN54821.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           sp. X513]
 gi|319929164|gb|ADV79849.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 135

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 15/107 (14%), Positives = 38/107 (35%), Gaps = 5/107 (4%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLHQDIM 125
            + +         +S            + +++  I L   D       +     +   I+
Sbjct: 28  ASSNKPKEITYYNYSPGGEFITNLKGDRKFVKATIKLQVADKNTLKILEERTPQIRDLII 87

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
             +R  + + + G +G    K DI+ ++  +  +  + +V F  FI+
Sbjct: 88  QILRGKTDQDVEGPEGQEKLKNDIKNQINKIIGERKIVNVYFEEFIV 134


>gi|172059108|ref|YP_001806760.1| flagellar basal body-associated protein FliL [Burkholderia
           ambifaria MC40-6]
 gi|171991625|gb|ACB62544.1| flagellar basal body-associated protein FliL [Burkholderia
           ambifaria MC40-6]
          Length = 178

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 39/102 (38%), Gaps = 11/102 (10%)

Query: 81  QIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIK 134
             F L P+  N  S      +LR+ ++L   D          +  +   I+  +     +
Sbjct: 76  VFFPLDPLTVNLQSDDGVQHYLRVGLSLKLTDPKAQEQLTARMPEIRSRILLALSNKHPE 135

Query: 135 QITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
            +   +G R   +++ E ++  +Q       V  V+F  F++
Sbjct: 136 DLATPEGKRSLAKELRELIEQPTQPGNQRAKVDDVLFTEFVV 177


>gi|316932825|ref|YP_004107807.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris DX-1]
 gi|315600539|gb|ADU43074.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris DX-1]
          Length = 166

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 21/166 (12%), Positives = 51/166 (30%), Gaps = 27/166 (16%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
              K  +        + I  G      +                      +   + H   
Sbjct: 19  KSKKKLIIIGAAAALVLIGGGGGAWFFLS-------------------AGHHKEAEHAEA 59

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLETLHQDIMA 126
             ++K      +  I+ N   +P + ++       L++         K  +  +      
Sbjct: 60  AKAVKPPSFIEVPEIMVNLAGTPGERVQYLKAKVVLEVKDEKLVEQIKPNMPRITDLFQT 119

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           Y+R +    + G+ G    KE++  RV    +   V++V+F+  ++
Sbjct: 120 YLRELRSGDLNGSVGMFRMKEELTRRVNMAIAPSQVTAVLFKEVLV 165


>gi|238796937|ref|ZP_04640441.1| Flagellar basal body-associated protein [Yersinia mollaretii ATCC
           43969]
 gi|238719197|gb|EEQ11009.1| Flagellar basal body-associated protein [Yersinia mollaretii ATCC
           43969]
          Length = 183

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 19/178 (10%), Positives = 46/178 (25%), Gaps = 26/178 (14%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
               +   G +   ++   ++   I                           I N   + 
Sbjct: 20  KKNQKANGGGKKFPWLVLLLMLISIAACALAGYTFY---------------EIKNMKANA 64

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNF---DSSPKDWLRLDIALICKDIP----DKVFL 117
                 T      +      +     +     +     L + + L  KD       + FL
Sbjct: 65  PDEGKKTASVKIPETPLYIPMDTFTVSLKPTSTESDRVLYIGLTLRVKDEDSKLLVEKFL 124

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG----FVSSVIFRTFII 171
             +   ++  +   + + ++   G     E I+  V           ++ V+F  FI+
Sbjct: 125 PEIRSRLLMILAHQTAEDLSVDDGKNQLIEKIKSVVSKPLAPNQSVMITDVLFNAFIL 182


>gi|158422253|ref|YP_001523545.1| flagellar basal body-associated protein [Azorhizobium caulinodans
           ORS 571]
 gi|158329142|dbj|BAF86627.1| flagellar basal body-associated protein [Azorhizobium caulinodans
           ORS 571]
          Length = 176

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 71/164 (43%), Gaps = 13/164 (7%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVH 70
              N  K  +   ++ T +G+  G   G+ +          K ++  +            
Sbjct: 22  KEQNGTKGLILAILILTVLGVATGGGLGVQLATTVEKVVAAKAKEEPVKKEQQ------- 74

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFLETLHQDIMAY 127
                      +  ++P+I N  S P  W+R++ + + K+       +   TL +D+M+Y
Sbjct: 75  ---LFYAGNTMMQPMKPVIVNLASPPNTWVRIESSFVFKNGALANPALTESTLREDMMSY 131

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +RT+++ Q  G    +  +ED+ ER ++RS+G V  +I  T ++
Sbjct: 132 LRTLTLSQFEGPSALQQLREDLNERARVRSEGRVDELIIETLVV 175


>gi|170725979|ref|YP_001760005.1| flagellar basal body-associated protein FliL [Shewanella woodyi
           ATCC 51908]
 gi|169811326|gb|ACA85910.1| flagellar basal body-associated protein FliL [Shewanella woodyi
           ATCC 51908]
          Length = 172

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 15/183 (8%), Positives = 57/183 (31%), Gaps = 24/183 (13%)

Query: 1   MSYDDTTSQYIRG--NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +++      G     K  +   +    +    G +   +                  
Sbjct: 1   MADEESLELEENGEPKSKKKLIFGVIGLVLLLAIGGGVWFFLGSS------------EPS 48

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD---- 113
           +        +    +  + +   +   +P + N   + +   + + + L+ +   D    
Sbjct: 49  DEAAVEGEAAEVVEEVNTGEAFYVGMPRPFLFNLPGASRSRLVEIKVQLMVRGGDDDVLI 108

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRT 168
           K  +  +   ++    +  +++++   G    ++     V+     +  +  V  V+F  
Sbjct: 109 KKHIPLIEDALLTTFSSADVQKMSSLAGKDELRQLALLNVQNTLQPVTGRKVVEKVLFTG 168

Query: 169 FII 171
           F++
Sbjct: 169 FVM 171


>gi|297617149|ref|YP_003702308.1| flagellar basal body-associated protein FliL [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297144986|gb|ADI01743.1| flagellar basal body-associated protein FliL [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 160

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 23/178 (12%), Positives = 65/178 (36%), Gaps = 26/178 (14%)

Query: 1   MSYDDTTSQYI-RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ +        + ++ +L +   VV   + + C      ++  L A    ++ +K   +
Sbjct: 1   MAEEKNNGDSKEKSSKSRLDLQIIVVGLVVFLMCMGGAYFMIRSLLAPLLPQEEEKKSSS 60

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDIPDKV--- 115
                               + +       TN    +   +L+ ++ L   D   +    
Sbjct: 61  GE------------------VVLVEAGEFTTNIYDINGTRYLKAEVYLQVPDKKVEKELE 102

Query: 116 -FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-FVSSVIFRTFII 171
             +  +  +I++ + + ++  +   +     ++ I+ER+  +  G  V+ V F +FI+
Sbjct: 103 TVMPVVKDEILSILSSQTVADL-DVRNRDNLRKTIKERLNRKLGGEKVTGVYFTSFIV 159


>gi|121997290|ref|YP_001002077.1| flagellar basal body-associated protein FliL [Halorhodospira
           halophila SL1]
 gi|121588695|gb|ABM61275.1| flagellar basal body-associated protein FliL [Halorhodospira
           halophila SL1]
          Length = 152

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 13/165 (7%), Positives = 46/165 (27%), Gaps = 28/165 (16%)

Query: 17  KLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTIS 76
           K+   +  +   + +      G +              +                     
Sbjct: 5   KIVYIFMGIMALMMVATMGTVGALAFGYITPPGMHAEAE------------------PDL 46

Query: 77  LKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTV 131
                +    P+  NF+   +  +L+ ++ ++ +        +  +  +  +++      
Sbjct: 47  GDPQYLKLEPPLTVNFERGQRISYLQAEVEVMARADEPLSGVERHMPVIRNNLLMLFSDQ 106

Query: 132 SIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
           S + +    G    +    E +          G + +V F +F++
Sbjct: 107 SFEDLNTRAGREELRHASLEEINNILDERGVDGEIEAVYFTSFVM 151


>gi|170742327|ref|YP_001770982.1| flagellar basal body-associated protein FliL [Methylobacterium sp.
           4-46]
 gi|168196601|gb|ACA18548.1| flagellar basal body-associated protein FliL [Methylobacterium sp.
           4-46]
          Length = 166

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 20/166 (12%), Positives = 45/166 (27%), Gaps = 27/166 (16%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVH 70
            +  +    V   +V   +                               +       V 
Sbjct: 22  AKRGKTLALVAGALVVLLLAGGGYGFV----------------------KYRAGKTEEVA 59

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI----PDKVFLETLHQDIMA 126
                         +  +  +       +++L +AL   D       +  +  +      
Sbjct: 60  EAKPAITFLDVRDLVMNLTPDVGQPNVRFIKLKVALEVHDPKTAAEIQPLMPRIEDAFQV 119

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
           YIR +      G+ G    +E++  RV +      V +V+F+ F+I
Sbjct: 120 YIREMRPADFDGSIGTYRLREELLRRVNVAVYPARVDAVLFKEFVI 165


>gi|330976005|gb|EGH76071.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. aptata str. DSM 50252]
          Length = 170

 Score = 74.0 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 18/180 (10%), Positives = 54/180 (30%), Gaps = 24/180 (13%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           S +          + KL +    V   +      +G    L   +  K +        N 
Sbjct: 4   SEEVKDPATTGKGKGKLKLIIIAVVALLLAGGLSVGATWFLMHKSESKVDPAAAAAAANV 63

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDKVF 116
              +V                      + NF+++ +  ++++ I +           KV 
Sbjct: 64  KPVAVFEP--------------MTPAFVVNFNANGRQRYMQVSITMLGRNAADMEALKVH 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
           +  +  +++     +  + +    G    ++     ++  +Q       +  ++F  F++
Sbjct: 110 MPLIRNNLVMLFAAIPFESLASPIGQEMLRQKATASIQEVAQKELGKTVIEQLLFTNFVL 169


>gi|171316891|ref|ZP_02906100.1| flagellar basal body-associated protein FliL [Burkholderia
           ambifaria MEX-5]
 gi|171097972|gb|EDT42790.1| flagellar basal body-associated protein FliL [Burkholderia
           ambifaria MEX-5]
          Length = 178

 Score = 74.0 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 38/102 (37%), Gaps = 11/102 (10%)

Query: 81  QIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIK 134
             F L P+  N  S      +LR+ ++L   D          +  +   I+  +     +
Sbjct: 76  VFFPLDPLTVNLQSDDGMQHYLRVGLSLKLTDPKAQEQLTARMPEIRSRILLALSNKHPE 135

Query: 135 QITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
            +   +G R   +++ E +   +Q       V  V+F  F++
Sbjct: 136 DLATPEGKRSLAKELRELIAQPTQPGNQRAKVDDVLFTEFVV 177


>gi|167834864|ref|ZP_02461747.1| flagellar basal body-associated protein FliL [Burkholderia
           thailandensis MSMB43]
          Length = 165

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 55/182 (30%), Gaps = 29/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +     +  KL      +   I       GG   +                  
Sbjct: 1   MATTANPTVDKPASSGKLKRVVLFLLIGIVAAAAAAGGTYFVLS---------------- 44

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPDKV--- 115
                 R         L     F+L+P+  N  S      +LR+ ++L   D   +    
Sbjct: 45  --KEGARGAAPSAPPPLAVPVFFALEPLTVNLQSDDGAQHYLRVGLSLKLTDPKAQEYLT 102

Query: 116 -FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTF 169
             +  L   I+  +     +Q+   +G     ++++  ++  +Q       V  V+F  F
Sbjct: 103 QHMPELRSRILLALSNKHPEQLATLEGKHALADELKTLIEQPTQPGNLSARVDDVLFTEF 162

Query: 170 II 171
           ++
Sbjct: 163 VV 164


>gi|221214536|ref|ZP_03587506.1| flagellar basal body-associated protein FliL [Burkholderia
           multivorans CGD1]
 gi|221165426|gb|EED97902.1| flagellar basal body-associated protein FliL [Burkholderia
           multivorans CGD1]
          Length = 166

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 38/119 (31%), Gaps = 11/119 (9%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DKVFL 117
                    +   L     F L P+  N  S      +LR+ ++L   D          +
Sbjct: 47  QGATHASAAEPAPLAAPVFFPLDPLTVNLQSDDGVQHYLRVGLSLKLTDPKAQEQLTARM 106

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
             +   ++  +     + I    G +   + +   ++  +Q       V  V+F  F++
Sbjct: 107 PEIRSRVLLALSNKHPEDIATPDGKQALAQQLRNLIEEPTQPGNQRTKVDDVLFTEFVV 165


>gi|83647850|ref|YP_436285.1| flagellar basal body-associated protein [Hahella chejuensis KCTC
           2396]
 gi|83635893|gb|ABC31860.1| Flagellar basal body-associated protein [Hahella chejuensis KCTC
           2396]
          Length = 174

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 16/166 (9%), Positives = 50/166 (30%), Gaps = 22/166 (13%)

Query: 16  HKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTI 75
            K  +    +   I +       +++L        +   +                   +
Sbjct: 20  SKKMIIIVSLVLLIAVGASVGVTMMLLKSSPDDGSDTSAEGGEQAA------------PV 67

Query: 76  SLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKVFLETLHQDIMAYIRT 130
             + +      P++  FD   K  +L+  I+L+ ++        + +  +   ++     
Sbjct: 68  KAEAIYYDMRPPLVVTFDYKGKQRFLQASISLLTRNQGVLDGVDLHMPVIRNRLINLYSG 127

Query: 131 VSIKQITGAQGFRYFKEDIEERVKLRSQ-----GFVSSVIFRTFII 171
              + +   +G      +  E +    +     G +  V+F  F++
Sbjct: 128 KDFENVQTDEGRLALLSESLEAINTALKEQGVDGEIEQVLFTNFVL 173


>gi|300113609|ref|YP_003760184.1| flagellar basal body-associated protein Flil [Nitrosococcus
           watsonii C-113]
 gi|299539546|gb|ADJ27863.1| flagellar basal body-associated protein FliL [Nitrosococcus
           watsonii C-113]
          Length = 171

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 21/184 (11%), Positives = 52/184 (28%), Gaps = 27/184 (14%)

Query: 1   MSYDDT-TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  DT  ++   G   K  +   +    I +     G + +  +   Q           
Sbjct: 1   MAESDTLDAETGNGGGSKKSLIILICALLILLIIAVAGALYLTGVIGPQVATNEVSAAAK 60

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK---DWLRLDIALICKDIPD--- 113
                               +        + NF    +    +L+  +  + +D      
Sbjct: 61  VSSQ--------------PAIYHSLDPVFVVNFQHQSQHRIRFLQTKMEAMARDQEVIDA 106

Query: 114 -KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFR 167
            K  +  +   ++  +     + +   +G    +E   E + L  +       V +V F 
Sbjct: 107 LKTHMPAIRNTLLLLLSQQDYETVRTLEGKERLREAAREEINLILEAQAGVSGVEAVFFT 166

Query: 168 TFII 171
            F++
Sbjct: 167 GFVM 170


>gi|253996305|ref|YP_003048369.1| flagellar basal body-associated protein FliL [Methylotenera mobilis
           JLW8]
 gi|253982984|gb|ACT47842.1| flagellar basal body-associated protein FliL [Methylotenera mobilis
           JLW8]
          Length = 163

 Score = 74.0 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 22/181 (12%), Positives = 52/181 (28%), Gaps = 29/181 (16%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D   +        K  +   +    + +  G     +                    
Sbjct: 1   MAQDPVQAPEEAAPASKKKLIIIIAAVVLALGGGGAAWFL-------------------T 41

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALIC----KDIPDKV 115
              +  +          K     +L     N      + +L++DI+L           K+
Sbjct: 42  QQKSHAKKEEVKKEEPAKAPVFLTLDTFTVNLQPDPDEKFLQVDISLQVASAEAAEAIKL 101

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-----RSQGFVSSVIFRTFI 170
            +  +   ++  + + S  +I+  +G +    +I   VK           V  V F +F+
Sbjct: 102 HMPAVKNRLLLLLTSKSAAEISTVEGKQDLSNEIIAEVKKPFAPNAKPQEVLDVFFTSFV 161

Query: 171 I 171
           +
Sbjct: 162 V 162


>gi|331016995|gb|EGH97051.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 167

 Score = 73.7 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 12/181 (6%), Positives = 51/181 (28%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +   +          +   VV   + +         ++       +          
Sbjct: 1   MAKSEEVVKDPAAKGKLKLIIIAVVALLLAVGLSVGATWFLMHKSESAPDPAAVATAA-- 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDKV 115
                         +    +        + NF+++ +  ++++ I +           KV
Sbjct: 59  -------------NVKPVAVFEPMTPAFVVNFNANGRQRYMQVSITMLGRNAADMEALKV 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +  +  +++     +  + +    G    ++     ++  +Q       +  ++F  F+
Sbjct: 106 HMPLIRNNLVMLFAAIPFESLASPIGQEMLRQKATASIQEVAQKELGKTVIEQLLFTNFV 165

Query: 171 I 171
           +
Sbjct: 166 L 166


>gi|148266213|ref|YP_001232919.1| flagellar basal body-associated protein FliL [Geobacter
           uraniireducens Rf4]
 gi|146399713|gb|ABQ28346.1| flagellar basal body-associated protein FliL [Geobacter
           uraniireducens Rf4]
          Length = 166

 Score = 73.7 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 51/149 (34%), Gaps = 6/149 (4%)

Query: 29  IGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPI 88
           + I  G +   V++   A     K  K         +                ++ L P 
Sbjct: 17  LIIIVGGVILAVVVIAVAVLLMSKDGKAEKVAKAPEAKSEKKGEGGEKGTSSTVYPLDPF 76

Query: 89  ITNFDSSPK-DWLRLDIALICKDIPDK----VFLETLHQDIMAYIRTVSIKQITGAQGFR 143
           I N     +  +L++ +         K         L   I+  + T +++++   QG  
Sbjct: 77  IVNIYDGQEIRYLKIKVEFEMAGPEVKPEIDARQSALRDAILVLLTTKTMREVQDLQGKN 136

Query: 144 YFKEDIEERV-KLRSQGFVSSVIFRTFII 171
             +++I     K+ S G V+ V F  F++
Sbjct: 137 QLRDEILATTGKILSVGRVTKVYFTDFVV 165


>gi|302878293|ref|YP_003846857.1| flagellar basal body-associated protein FliL [Gallionella
           capsiferriformans ES-2]
 gi|302581082|gb|ADL55093.1| flagellar basal body-associated protein FliL [Gallionella
           capsiferriformans ES-2]
          Length = 204

 Score = 73.7 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 20/193 (10%), Positives = 46/193 (23%), Gaps = 42/193 (21%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
              K+ V    V   +         +VM                     + +       +
Sbjct: 18  KSKKMLVIIIAVVVLLAAAGAGYYFLVMKPHSEK-------HAKPAVTEEAADEGDEEDE 70

Query: 74  TISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIPDKVF----LETLHQDIMAYI 128
                  +   +     N        +L++ I +       +         +   I   +
Sbjct: 71  AKPKVPPKFVEIGTFTANLMHEDADRYLQVAITIKLNKPELEEKVKESNPEIQHRINMLL 130

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVKLR------------------------------SQ 158
           ++    ++   +G      DI+  V+                                S+
Sbjct: 131 QSKRPSELATPEGKEILASDIKANVEYVLGLRKTPPALHQAQPAAEGETHHAAAEEKPSK 190

Query: 159 GFVSSVIFRTFII 171
             V+ V+F +FII
Sbjct: 191 KGVAEVLFTSFII 203


>gi|163781855|ref|ZP_02176855.1| flagellar biosynthesis FliL [Hydrogenivirga sp. 128-5-R1-1]
 gi|159883075|gb|EDP76579.1| flagellar biosynthesis FliL [Hydrogenivirga sp. 128-5-R1-1]
          Length = 168

 Score = 73.7 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 14/104 (13%), Positives = 36/104 (34%), Gaps = 6/104 (5%)

Query: 74  TISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIPD----KVFLETLHQDIMAYI 128
           +     +        I N        + R+ I L           +     +   I+  +
Sbjct: 62  SPEAVGVMYKLEPAFIVNLADPELTMYARVSITLELSSPEVVMEVQKREPIIRDAIIEIL 121

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              + +++   +G    K ++ +R+  +  QG V ++ F  F++
Sbjct: 122 SNKTSRELRSPEGREQLKLELIKRINTILVQGGVRNIYFTEFVV 165


>gi|254491559|ref|ZP_05104738.1| flagellar basal body-associated protein FliL [Methylophaga
           thiooxidans DMS010]
 gi|224463037|gb|EEF79307.1| flagellar basal body-associated protein FliL [Methylophaga
           thiooxydans DMS010]
          Length = 169

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 23/187 (12%), Positives = 59/187 (31%), Gaps = 35/187 (18%)

Query: 1   MSY---DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+    D   ++   GN+ KL +    V     I    L  ++++        E      
Sbjct: 1   MAEQRDDIEVTEEKSGNKTKLLIIVIAVMLLAAI---SLVAVMLMGGNDEDATESQDNAA 57

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK---DWLRLDIALICKDIPD- 113
                                 +      P I NF         ++++ + ++ +D    
Sbjct: 58  AVKQAP----------------IYFSVNDPFIVNFSEQSNDSVRYMQVKMKVMARDQRVI 101

Query: 114 ---KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS------QGFVSSV 164
                 L  L  +++    + +  ++  ++G +  ++   E +          +  + +V
Sbjct: 102 DAFNAHLPALQHELLMLFYSQNYDELQTSEGTKALQKKCLETINRVLKSETSMENELEAV 161

Query: 165 IFRTFII 171
            F +FI+
Sbjct: 162 YFTSFIM 168


>gi|27380937|ref|NP_772466.1| flagellar basal body-associated protein FliL [Bradyrhizobium
           japonicum USDA 110]
 gi|27354103|dbj|BAC51091.1| flagellar synthesis protein [Bradyrhizobium japonicum USDA 110]
          Length = 166

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 23/165 (13%), Positives = 52/165 (31%), Gaps = 28/165 (16%)

Query: 15  QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDT 74
           ++KL +    V     +  G             +                     H    
Sbjct: 21  KNKLKLIIMAVGLLAVLGGGAATWFFFFRHGDDEH--------------------HAEAA 60

Query: 75  ISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLETLHQDIMAY 127
              K      +  ++ N   +P + ++       L++    +    K  +  +      Y
Sbjct: 61  PPPKPPAFVEVPDMMVNLAGAPGERVQYLKLKIVLELKEEKQIEAIKPAMPRVTDIFQTY 120

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +R +    + G+ G    KE++ +RV    +   VS+V+F+  +I
Sbjct: 121 VRELRSSDLNGSAGIFRLKEELTKRVNAAVAPVQVSAVLFKEVVI 165


>gi|126438457|ref|YP_001057083.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 668]
 gi|167813511|ref|ZP_02445191.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 91]
 gi|126217950|gb|ABN81456.1| flagellar basal body-associated protein FliL [Burkholderia
           pseudomallei 668]
          Length = 165

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 54/182 (29%), Gaps = 29/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +     +  KL      +   I       GG   +                  
Sbjct: 1   MATTANPTVDKPASSGKLKRLVLFLLIGIVAAAAAAGGTYFMLS---------------- 44

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPDKV--- 115
                  S        L     F L+P+  N  S      +LR+ ++L   D   +    
Sbjct: 45  --KEGAHSAAPSAPAPLAAPAFFPLEPLTVNLLSDDGIQHYLRVGLSLKLTDPKAQEYLT 102

Query: 116 -FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTF 169
             +  L   I+  +     +Q+   +G     ++++  ++  +Q       V  V+F  F
Sbjct: 103 QHMPELRSRILLALSNKHPEQLATLEGKHALADELKTLIEQPTQPGNQSARVDDVLFTEF 162

Query: 170 II 171
           ++
Sbjct: 163 VV 164


>gi|289208343|ref|YP_003460409.1| flagellar basal body-associated protein FliL [Thioalkalivibrio sp.
           K90mix]
 gi|288943974|gb|ADC71673.1| flagellar basal body-associated protein FliL [Thioalkalivibrio sp.
           K90mix]
          Length = 162

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/185 (11%), Positives = 53/185 (28%), Gaps = 38/185 (20%)

Query: 1   MSYDD----TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKF 56
           M+  +          +G +   ++   +V  F G         +                
Sbjct: 1   MAEKEVELGEEGAGEKGKKGLTWIVILLVLVFAGAGAAAAWFFL---------------- 44

Query: 57  ILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD-- 113
                   S             +     L+P+  N D   +  +LRL+++++  D     
Sbjct: 45  --------SGGDEEETGEEGPAERHYHGLEPMTVNIDGPGRIRYLRLELSVVTTDPEVIA 96

Query: 114 --KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIF 166
             +  +  +  D++  +       +    G     E++ E +    +       V +V F
Sbjct: 97  ALERHMPAVRNDVLGLLGEKHYDDLNTRDGKESLAEELREAIAEILEERDAPHDVEAVRF 156

Query: 167 RTFII 171
              ++
Sbjct: 157 NELVM 161


>gi|134294174|ref|YP_001117909.1| flagellar basal body-associated protein FliL [Burkholderia
           vietnamiensis G4]
 gi|134137331|gb|ABO53074.1| flagellar basal body-associated protein FliL [Burkholderia
           vietnamiensis G4]
          Length = 178

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 42/121 (34%), Gaps = 11/121 (9%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DKV 115
                 S    +   L     F L P+  N  S      +LR+ ++L   D         
Sbjct: 57  KAGVGHSSAPAEPPPLAAPVFFPLDPLTVNLQSDDGIQHYLRVGLSLKLTDPKAQEQLTA 116

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFI 170
            +  +   I+  +     +++    G +   + + E V+  +Q       V +V+F  F+
Sbjct: 117 RMPEIRSRILLALSNKHPEELATPDGKQLLAKQLRELVEQPTQPGNQRAKVDAVLFTEFV 176

Query: 171 I 171
           +
Sbjct: 177 V 177


>gi|302392383|ref|YP_003828203.1| flagellar basal body-associated protein FliL [Acetohalobium
           arabaticum DSM 5501]
 gi|302204460|gb|ADL13138.1| flagellar basal body-associated protein FliL [Acetohalobium
           arabaticum DSM 5501]
          Length = 149

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 15/91 (16%), Positives = 38/91 (41%), Gaps = 6/91 (6%)

Query: 86  QPIITNFDSSPKDWLRLDIALICKDIPD----KVFLETLHQDIMAYIRTVSIKQITGAQG 141
                N   + + +LR+++ L   +       +     +   +++ +RT   + I    G
Sbjct: 59  GEFTVNLSDN-RRYLRMNLVLEVSNKDVINKLETRNPQVRDAVISIVRTKKPQDINTQAG 117

Query: 142 FRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            +  +E I   +    ++G V++V F  F++
Sbjct: 118 IKDLREQIRNELNKFIAEGKVTNVFFTQFVV 148


>gi|82702480|ref|YP_412046.1| flagellar basal body-associated protein FliL [Nitrosospira
           multiformis ATCC 25196]
 gi|82410545|gb|ABB74654.1| Flagellar basal body-associated protein FliL [Nitrosospira
           multiformis ATCC 25196]
          Length = 166

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/111 (17%), Positives = 42/111 (37%), Gaps = 10/111 (9%)

Query: 71  TGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPD----KVFLETLHQDIM 125
           TG     K     +L+    N      +  L+  + L  +D       K+ +  +   ++
Sbjct: 55  TGALPKPKPPVFLNLETFTVNLQPEHSEQHLQTSLTLKVEDESVVNLIKLHMPEVRNRVL 114

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
             +   +  QI+  +G +    ++   +       R  G V +V+F +F+I
Sbjct: 115 LLLSGKTATQISSIEGKKKLASELTAEINHQFSEERVTGSVENVLFTSFVI 165


>gi|330889051|gb|EGH21712.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. mori str. 301020]
          Length = 166

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 15/181 (8%), Positives = 53/181 (29%), Gaps = 26/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +         + KL +   VV   +G+         ++       +          
Sbjct: 1   MAKSEEVKDPATKGKLKL-IILAVVALLLGVGLSVGATWFLMHKSESTPDPAA------- 52

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDKV 115
                         +    +        + NF+S+ +  ++++ I +           K 
Sbjct: 53  --------AAAAANVKPVGVFEPMTPAFVVNFNSNGRQRYMQVSITMLARNAADMEALKA 104

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +  +  +++     +  + +    G    ++     ++  +Q       +  ++F  F+
Sbjct: 105 HMPLIRNNLVMLFAAIPFESLASPIGQEMLRQKATASIQEVAQKELGKTVIEQLLFTNFV 164

Query: 171 I 171
           +
Sbjct: 165 L 165


>gi|330953757|gb|EGH54017.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           Cit 7]
          Length = 170

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 15/180 (8%), Positives = 52/180 (28%), Gaps = 24/180 (13%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           S +          + KL +    V   +      +G    L                 + 
Sbjct: 4   SEEVKDPATTGKGKGKLKLIIIAVVALLLAVGLSVGATWFLMH--------------KSE 49

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDKVF 116
                 +      +    +        + NF+++ +  ++++ I +           KV 
Sbjct: 50  SKEDPAAAAAAANVKPVAVFEPMTPAFVVNFNANGRQRYMQVSITMLGRNAADMEALKVH 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
           +  +  +++     +  + +    G    ++     ++  +Q       +  ++F  F++
Sbjct: 110 MPLIRNNLVMLFAAIPFESLASPIGQEMLRQKATASIQEVAQKELGKTVIEQLLFTNFVL 169


>gi|206891032|ref|YP_002249869.1| flagellar basal body-associated protein FliL [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742970|gb|ACI22027.1| flagellar basal body-associated protein FliL [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 170

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 16/116 (13%), Positives = 41/116 (35%), Gaps = 6/116 (5%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDIPD----KVF 116
                            +   F+L+P + N        +L++ + +   D       K  
Sbjct: 54  KGAEHGKGSATKDSKEVQGINFALEPFVVNLMDQSGTKYLKVSVQIELSDAKLAEQAKNK 113

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              +   I+  +   +  ++   +G    K++I++R   +  +G V +V    F++
Sbjct: 114 TPQIRDAIITLLTNKTSDELITPEGKLLLKDEIKQRANQILGEGTVINVYLTDFVM 169


>gi|229591844|ref|YP_002873963.1| flagellar basal body-associated protein FliL [Pseudomonas
           fluorescens SBW25]
 gi|229363710|emb|CAY51097.1| flagellar basal body-associated protein FliL [Pseudomonas
           fluorescens SBW25]
          Length = 166

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/181 (12%), Positives = 59/181 (32%), Gaps = 26/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  D  ++   G      +   V+   + I     G   ++   A +     +      
Sbjct: 1   MAKSDDAAKAPAGKGKLKLILLIVLGLLLAIGASVGGTWYIMHSSASKPAPAAE------ 54

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKV 115
                     T   +    +    L   + NF+ + +  +L++ I L+ ++       KV
Sbjct: 55  ----------TASNVKQPAIFEPMLPAFVANFNQNGRQRYLQVSITLLARNQSDLDALKV 104

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +  +  +++      S   +    G    ++ +   V+  +Q       +   +F  F+
Sbjct: 105 HMPVIRNNLVMLFSGQSFDTLATPVGQEMLRQKVTASVQEVAQKELGKVVIEQALFTNFV 164

Query: 171 I 171
           +
Sbjct: 165 L 165


>gi|294140209|ref|YP_003556187.1| flagellar protein FliL [Shewanella violacea DSS12]
 gi|293326678|dbj|BAJ01409.1| flagellar protein FliL [Shewanella violacea DSS12]
          Length = 173

 Score = 72.9 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 18/170 (10%), Positives = 55/170 (32%), Gaps = 22/170 (12%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
             ++ KL V   +    + I  G L   +         E+      +             
Sbjct: 15  PKSKSKLIVFGVIGLVLVLIIAGALWFFMGTSDSPTDSEDLDGAEEIQ------------ 62

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD----KVFLETLHQDIMA 126
               + +   +   +P + N   + +   + + + L+ +   D    K  +  +   ++ 
Sbjct: 63  EPMNTGEAFYVGMPRPFLFNLPGANRSRLVEIKVQLMVRGADDDVLIKKHIPLIEDALLT 122

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
              +  +++++   G    ++     V+     +  +  V  V+F  F++
Sbjct: 123 TFSSADVQKLSTLAGKDEMRQLALLNVQNTLLPVTGRKIVEKVLFTGFVM 172


>gi|300024601|ref|YP_003757212.1| flagellar basal body-associated protein FliL [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526422|gb|ADJ24891.1| flagellar basal body-associated protein FliL [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 170

 Score = 72.9 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 63/168 (37%), Gaps = 9/168 (5%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
             S           V   +    +GI  G   G   + +             +      S
Sbjct: 9   NGSAPSAAPSTGDLVKSMIAAVVLGIAGGGAFGYFAVPVG-------PAPAPVEEAKPAS 61

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKV--FLETLHQD 123
           V                 S+  II +    PK  +RLD++++      +       + +D
Sbjct: 62  VAPEAPSAGRFPSDALEISIPSIIVDLSGEPKSRVRLDVSIVAVHGTSEASVLKNEVRED 121

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I+AY++ +++  I G +G +  +E +E+R K+R +G +  ++   F+I
Sbjct: 122 IIAYLKGLTVADIQGVRGLQNLREQLEDRAKIRGRGAILGLLIGGFVI 169


>gi|15606899|ref|NP_214280.1| flagellar biosynthesis FliL [Aquifex aeolicus VF5]
 gi|6225363|sp|O67712|FLIL_AQUAE RecName: Full=Flagellar protein FliL
 gi|2984141|gb|AAC07676.1| flagellar biosynthesis FliL [Aquifex aeolicus VF5]
          Length = 161

 Score = 72.9 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 38/104 (36%), Gaps = 6/104 (5%)

Query: 74  TISLKKLQIFSLQPIITNFDSSP-----KDWLRLDIALICKDIPDKVFLETLHQDIMAYI 128
                 +      P I N          +  + L++A        +     +   I+  I
Sbjct: 55  APPEVGIMYKLDPPFIVNLADPEATVYARISITLEVANQQVLQEVQKKEPVIRDAIIEII 114

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            + +  +I   +G    K ++ +R+  + S+G V +V F  F+I
Sbjct: 115 SSKTSNEIRTPEGREQLKLEVLKRINTILSEGGVRNVYFTEFVI 158


>gi|170748102|ref|YP_001754362.1| flagellar basal body-associated protein FliL [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654624|gb|ACB23679.1| flagellar basal body-associated protein FliL [Methylobacterium
           radiotolerans JCM 2831]
          Length = 160

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 63/143 (44%), Gaps = 13/143 (9%)

Query: 32  FCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITN 91
             G   G+ M+       +E+ +                   T   +   + SL  ++TN
Sbjct: 27  GVGAASGLHMIARVEKALDERRKAQDEQV----------RPVTAYAENDTLTSLGTVVTN 76

Query: 92  FDSSPKDWLRLDIALICKD---IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKED 148
                  W+RL+ ++I +       +  +  + QDI+ Y+RT+S+ QI G  G  + +ED
Sbjct: 77  LAGPGDVWVRLESSVIVRPGTFANPQAMVAEIRQDIVGYLRTLSVAQIEGPSGLSHLRED 136

Query: 149 IEERVKLRSQGFVSSVIFRTFII 171
           + ERV++RS G + +    T ++
Sbjct: 137 LTERVQIRSNGQIRTFFIETLVV 159


>gi|51894130|ref|YP_076821.1| flagellar synthesis protein [Symbiobacterium thermophilum IAM
           14863]
 gi|51857819|dbj|BAD41977.1| flagellar synthesis protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 154

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/161 (11%), Positives = 46/161 (28%), Gaps = 15/161 (9%)

Query: 16  HKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTI 75
             L          + +    L   V+  L                               
Sbjct: 3   RGLITALVAAVVILAVGVAGLAAYVIFIL----------PQSGGLVAAGGGGGTAVVAGE 52

Query: 76  SLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKVFL----ETLHQDIMAYIRT 130
            + +   + L   +TN     +  +++  +AL  +    +         +   +++ +R 
Sbjct: 53  PVLEAAYYELDEFVTNLADKDRLRYIKFSVALGLRSDNSEQIARDAAPQVRDVVLSQVRE 112

Query: 131 VSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           ++   ++GA G     + I+  +     G V+ V     +I
Sbjct: 113 LTAADLSGADGKERLAQAIKNGLDGLLPGHVTRVYVTDMVI 153


>gi|297538200|ref|YP_003673969.1| flagellar basal body-associated protein FliL [Methylotenera sp.
           301]
 gi|297257547|gb|ADI29392.1| flagellar basal body-associated protein FliL [Methylotenera sp.
           301]
          Length = 165

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 41/122 (33%), Gaps = 10/122 (8%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKVF-- 116
               +  +                +L+    N      + +L+ +I+L       +    
Sbjct: 43  THQKSDHKKEEAKHEEPAHAPVFVTLEAFTVNLQPDPDEKFLQTEISLQVASPEQEELLK 102

Query: 117 --LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-----RSQGFVSSVIFRTF 169
             +  +   ++  + + +   I+ ++G +   ++I   VK           V+ V F +F
Sbjct: 103 SQMPAVRSRLLMLLTSKTASDISTSEGKQKLSDEIVAEVKKPFSKGAKPQEVTGVFFTSF 162

Query: 170 II 171
           +I
Sbjct: 163 VI 164


>gi|329897653|ref|ZP_08272177.1| Flagellar protein [gamma proteobacterium IMCC3088]
 gi|328921102|gb|EGG28511.1| Flagellar protein [gamma proteobacterium IMCC3088]
          Length = 194

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/194 (9%), Positives = 58/194 (29%), Gaps = 24/194 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +DT  + ++     L            +          L  F  +++E+ +K +   
Sbjct: 1   MADEDTD-EVVKAKPPILRYVLIAFIFIFMMALSVGITAYFLGFFDAKQDEEIEKAVQQL 59

Query: 61  FYDNSVRSVHTGDTISLKKLQ-------------IFSLQPIITNFDSSPKDWLRLDIALI 107
             +         +                        ++  +     + +  +++ +A++
Sbjct: 60  EQEAEQARSRAEELARGPDKVSIDAPQLQRFKNSYLEIEAPLVANILNSRKVMQVKVAIM 119

Query: 108 CKDIP-----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ---- 158
                      +     +  +++  +R VS  ++      +   ED++       +    
Sbjct: 120 THYDDRVIANMETHAFAVRSEMLDVLRKVSESELAKDDFRKKLAEDLKMATNSVLERYED 179

Query: 159 -GFVSSVIFRTFII 171
            G V  V F  F++
Sbjct: 180 FGGVEEVFFTEFVV 193


>gi|167585017|ref|ZP_02377405.1| flagellar basal body-associated protein FliL [Burkholderia
           ubonensis Bu]
          Length = 167

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/116 (15%), Positives = 41/116 (35%), Gaps = 11/116 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKD----IPDKVFLETL 120
            +    +   L     F L P+  N  S      +LR+ ++L   D          +  +
Sbjct: 51  HASGPVEPPPLAAPVFFPLDPLTVNLQSEDGIQHYLRVGLSLKITDAKAQEQLTARMPEI 110

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
              I+  +     +++    G R    +++  ++  +Q       V  V+F  F++
Sbjct: 111 RSRILLALSNKHPEELATPDGKRALAGELKGLIEQPTQPGNQHAKVDDVLFTEFVV 166


>gi|66046677|ref|YP_236518.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. syringae B728a]
 gi|289678976|ref|ZP_06499866.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. syringae FF5]
 gi|302185371|ref|ZP_07262044.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. syringae 642]
 gi|63257384|gb|AAY38480.1| Flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. syringae B728a]
 gi|330940701|gb|EGH43712.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. pisi str. 1704B]
 gi|330972445|gb|EGH72511.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. aceris str. M302273PT]
          Length = 170

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/180 (10%), Positives = 54/180 (30%), Gaps = 24/180 (13%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           S +          + KL +    V   +      +G    L   +  K +        N 
Sbjct: 4   SEEVKDPATTGKGKGKLKLIIIAVVALLLAVGLSVGATWFLMHKSESKVDPAAAAAAANV 63

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDKVF 116
              +V                      + NF+++ +  ++++ I +           KV 
Sbjct: 64  KPVAVFEP--------------MTPAFVVNFNANGRQRYMQVSITMLGRNAADMEALKVH 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
           +  +  +++     +  + +    G    ++     ++  +Q       +  ++F  F++
Sbjct: 110 MPLIRNNLVMLFAAIPFESLASPIGQEMLRQKATASIQEVAQKELGKTVIEQLLFTNFVL 169


>gi|323700138|ref|ZP_08112050.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           ND132]
 gi|323460070|gb|EGB15935.1| flagellar basal body-associated protein FliL [Desulfovibrio
           desulfuricans ND132]
          Length = 167

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/177 (12%), Positives = 55/177 (31%), Gaps = 17/177 (9%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +    +  +  +  L     +V     +  G   G  M F    +          + 
Sbjct: 1   MAEEALLQEEGKKKKGGLLKWIILVVLLAALGVGGWFGYKMFFAAPAEDTAAQTDAAGDP 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDIP----DKV 115
                               QI +L   + N      + +L+L + +  +D         
Sbjct: 61  GKPAEQLE-----------GQIVALPTFLVNLADPLGRRYLKLGVEVEVRDADAQAALTK 109

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +   +   ++  + + + + ++  Q     K++I +R+  +   G V  V     +I
Sbjct: 110 YEAKVKDTLLLLLSSKTYEGLSTMQDKVELKQEIADRLNQIIGNGGVLRVYITEMVI 166


>gi|237799244|ref|ZP_04587705.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. oryzae str. 1_6]
 gi|331022099|gb|EGI02156.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. oryzae str. 1_6]
          Length = 168

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 13/182 (7%), Positives = 52/182 (28%), Gaps = 26/182 (14%)

Query: 1   MSYDDTTSQYI-RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  +       +G      +   VV   + +         ++                 
Sbjct: 1   MAQSEEVKDPAPKGKGKLKLIIIAVVALLLAVGLSVGATWFLM---------------HK 45

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDK 114
           +       +           +        + NF+++ +  ++++ I +           K
Sbjct: 46  SESKEDPAAAAAAANAKPVAVFEPMTPAFVVNFNANGRQRYMQVSITMLGRNAADMEALK 105

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTF 169
           V +  +  +++     +  + +    G    ++     ++  +Q       +  ++F  F
Sbjct: 106 VHMPLIRNNLVMLFAAIPFESLASPIGQEMLRQKATASIQEVAQKELGKTVIEQLLFTNF 165

Query: 170 II 171
           ++
Sbjct: 166 VL 167


>gi|238025701|ref|YP_002909932.1| flagellar basal body-associated protein FliL [Burkholderia glumae
           BGR1]
 gi|237874895|gb|ACR27228.1| Flagellar protein FliL [Burkholderia glumae BGR1]
          Length = 166

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 16/105 (15%), Positives = 36/105 (34%), Gaps = 11/105 (10%)

Query: 78  KKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTV 131
                F L+ +  N  S      +LR+ + L   D          +  +   I+  +   
Sbjct: 61  ATPVFFPLESMTVNLQSDDDGLHYLRIGLTLKLTDPTAQDYLTQHMPEIRSRILLALSNK 120

Query: 132 SIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
               +    G R   +++   ++  +Q       V +V+F  F++
Sbjct: 121 RPSDLATLDGKRALADELRALIEKPTQPGNRSARVDAVLFTDFVV 165


>gi|209884528|ref|YP_002288385.1| flagellar basal body-associated protein FliL [Oligotropha
           carboxidovorans OM5]
 gi|209872724|gb|ACI92520.1| flagellar basal body-associated protein FliL [Oligotropha
           carboxidovorans OM5]
          Length = 167

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/187 (12%), Positives = 61/187 (32%), Gaps = 37/187 (19%)

Query: 1   MSYDDTTSQYI--------RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEK 52
           M+ +D   +            ++ K+F+    V   + +       + +      Q  + 
Sbjct: 1   MADEDQVEESAAEVAVEAAPSSRRKIFMIAGAVVLALMVGA-LGWFVFLRSHDETQHADA 59

Query: 53  YQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIA 105
                                   +       +  I+ N  S+P + ++       L++ 
Sbjct: 60  AAA--------------------KVVPPVFLDVPDILVNLASNPGERIQYLKVKAVLELK 99

Query: 106 LICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSV 164
                   K  +  +      Y+R +    + G+ G    KE++ +RV +  +   V++V
Sbjct: 100 EAPLVDKVKPSMPRVTDLFQTYLRELRANDLNGSVGLFRMKEELTKRVNVAIAPERVNAV 159

Query: 165 IFRTFII 171
           +F+  +I
Sbjct: 160 LFKEVVI 166


>gi|206561844|ref|YP_002232609.1| flagellar basal body-associated protein FliL [Burkholderia
           cenocepacia J2315]
 gi|198037886|emb|CAR53830.1| flagellar FliL protein [Burkholderia cenocepacia J2315]
          Length = 166

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 55/182 (30%), Gaps = 28/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+     +     +  K      +    +G      GG+ +    AG             
Sbjct: 1   MATTANPTADKPASSGKFKRIALIAVIALGAAAAAAGGMYVFLGKAGV------------ 48

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DK 114
                  +    +   L     F L P+  N  S      +LR+ ++L   D        
Sbjct: 49  -----GHASAPAEPAPLAAPVFFPLDPLTVNLQSDDGAQHYLRVGLSLKLTDPKAQEQLT 103

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTF 169
             +  +   I+  +     +++    G R    ++ E ++  +Q       V  V+F  F
Sbjct: 104 ARMPEIRSRILLALSNKHPEELATPDGKRSLATELRELIEQPTQPGNQRAKVDDVLFTEF 163

Query: 170 II 171
           ++
Sbjct: 164 VV 165


>gi|70729039|ref|YP_258773.1| flagellar basal body-associated protein FliL [Pseudomonas
           fluorescens Pf-5]
 gi|68343338|gb|AAY90944.1| flagellar protein FliL [Pseudomonas fluorescens Pf-5]
          Length = 166

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/181 (9%), Positives = 53/181 (29%), Gaps = 26/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +   +   G      +   V+   + I          +     +     +      
Sbjct: 1   MAKSEAAEKPTAGKSKLKLILLIVLALLLAIGLSVGATWYFMHSAQSKPAPAAE------ 54

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKV 115
                     T   +    +        + NF  + +  ++++ I L+ ++       KV
Sbjct: 55  ----------TASNVKPAAIYEPMAPAFVANFTQNGRQRYMQVSITLLARNQADLDALKV 104

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +  +  +++      S   +    G    ++     V+  +Q       V  ++F  F+
Sbjct: 105 HMPVIRNNLVMLFSGQSFDTLATPVGQEMLRQKATASVQEVAQKEVGKVVVEQLLFTNFV 164

Query: 171 I 171
           +
Sbjct: 165 L 165


>gi|238782827|ref|ZP_04626856.1| Flagellar basal body-associated protein [Yersinia bercovieri ATCC
           43970]
 gi|238716250|gb|EEQ08233.1| Flagellar basal body-associated protein [Yersinia bercovieri ATCC
           43970]
          Length = 168

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/182 (12%), Positives = 51/182 (28%), Gaps = 26/182 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++T  +  +G +    V  F++   IG           +                  
Sbjct: 1   MTKNNT--KIAKGGKKSSLVILFMMLITIGACALAGYTFYEMKNI-------------KA 45

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF---DSSPKDWLRLDIALICKDIP----D 113
                                   +     +     +     L + + L  KD       
Sbjct: 46  HVSGDNNDTVATPISEPIIPLYIQMDTFTVSLKPTPTDDGRVLHIGLTLRVKDENSKVLI 105

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG----FVSSVIFRTF 169
           + FL  +   ++  +   + + I+  +G +   E I+  V           ++ V+F  F
Sbjct: 106 EKFLPEVRSRLLILLAQQTAENISADKGKQQLIEKIKSVVSEPLTPNQSVVITDVLFNAF 165

Query: 170 II 171
           I+
Sbjct: 166 IL 167


>gi|260574388|ref|ZP_05842392.1| flagellar basal body-associated protein FliL [Rhodobacter sp. SW2]
 gi|259023284|gb|EEW26576.1| flagellar basal body-associated protein FliL [Rhodobacter sp. SW2]
          Length = 161

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/176 (10%), Positives = 54/176 (30%), Gaps = 21/176 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +         + KL +   +V   +    G+      L                  
Sbjct: 1   MAEAEEPQDAAPKKKSKLPLIIGLVLALLLGGGGFYATYSGLLFG--------------- 45

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDI---PDKVF 116
              +   +       +L  +    ++P++ +   ++    LR+   L           + 
Sbjct: 46  -AAHEEVAADAHAASALPDIAFVPIEPVVISLGAAAQNAHLRMTAQLEVAKPYEAEVVLL 104

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           +  +   +  Y+R V + Q+         +  +  R+++    G V  ++   F++
Sbjct: 105 MPRVLDVLNGYLRAVEVAQLEDPAALVRLRAQMLRRIQIVTGDGRVRDLLITEFVL 160


>gi|330819959|ref|YP_004348821.1| Flagellar protein FliL [Burkholderia gladioli BSR3]
 gi|327371954|gb|AEA63309.1| Flagellar protein FliL [Burkholderia gladioli BSR3]
          Length = 165

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 15/118 (12%), Positives = 37/118 (31%), Gaps = 10/118 (8%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLE 118
             +          L     F L P+  N  S  +  ++R+ + L   D          + 
Sbjct: 47  EGMAEAAQAGPPPLSTPVYFPLDPMTVNLQSDDEMHYVRIGLTLKLTDPTAQDYLTQHMP 106

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
            +   I+  +     + +   +  R   + +   ++  +Q       V  V+   F++
Sbjct: 107 EIRSRILMALSNKHPEDLATLEDKRQLVDQLRALIERPTQPGNRSARVDEVLITDFVL 164


>gi|152988214|ref|YP_001349239.1| flagellar basal body-associated protein FliL [Pseudomonas
           aeruginosa PA7]
 gi|150963372|gb|ABR85397.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 173

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/184 (12%), Positives = 60/184 (32%), Gaps = 25/184 (13%)

Query: 1   MSYDDTTSQYIR---GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+  + T        G + KL +   +V   +      +GG     L    K EK ++  
Sbjct: 1   MAKKEATPAEAGAPGGGKSKLKLILLIVVGLLLAIGLSVGGTWFF-LSKSLKAEKTEEVA 59

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IP 112
                                 L        + NF+ + +  ++++ +AL+ +D      
Sbjct: 60  SEAVKPG-----------KQPALYEILAPAFVVNFNQNGRQRYMQVGVALMGRDKAQMDA 108

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFR 167
            +  +  +   ++    + +   +    G    ++     ++  ++       V  V+F 
Sbjct: 109 LREHMPLVRNKLVMLFSSQNFDSLVTPVGKEMLRQQATAGLQELAKKQTGQLAVEQVLFT 168

Query: 168 TFII 171
            F++
Sbjct: 169 NFVL 172


>gi|113969631|ref|YP_733424.1| flagellar basal body-associated protein FliL [Shewanella sp. MR-4]
 gi|113884315|gb|ABI38367.1| flagellar basal body-associated protein FliL [Shewanella sp. MR-4]
          Length = 175

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/171 (9%), Positives = 50/171 (29%), Gaps = 20/171 (11%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVH 70
              ++ KLF+          +  G L   +              +         +     
Sbjct: 14  APKSKKKLFIFVGAGVFAALLIGGALWFFLGSSD----------EVPEAAAEGAAPTETT 63

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK----VFLETLHQDIM 125
           T    +     +   +P + N     +   + + + L+ +   D       +  +   ++
Sbjct: 64  TPAADAAMAAYVPMPRPFLFNLPGPDRARLVEIKVQLMVRGQDDDVLTQKHIPLIEDALL 123

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
                  +++++   G    ++     V+     +  +  V  V+F  F++
Sbjct: 124 TTFSGADVQKLSTQAGKDELRQLALLSVQNTLQSVTGRKVVEKVLFTGFVM 174


>gi|326386952|ref|ZP_08208565.1| flagellar basal body-associated protein FliL [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208561|gb|EGD59365.1| flagellar basal body-associated protein FliL [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 199

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/199 (15%), Positives = 53/199 (26%), Gaps = 29/199 (14%)

Query: 1   MSYD-DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLG----GIVMLFLFAGQKEEKYQK 55
           MS   +  ++  +     +      V        G       G++        KE+ + K
Sbjct: 1   MSEKKEKDAKPAKKGGGMMIKIIGAVVLLAAGGGGVFALVTTGVIGGGTKTVVKEDNHPK 60

Query: 56  FILNNFYDNSVRSVHTGDTISLK-------------KLQIFSLQPIITNFDSSPKDWLRL 102
            I     D        GD                   L     +   +N        +++
Sbjct: 61  LIRKGEEDPYAPPKKEGDGGEGGGKEVDGDGGSEYHTLYYSFAEDFTSNLKG-SDALVQV 119

Query: 103 DIALICKDIP-----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR- 156
            IA             K     L   ++A +   S   +   QG    +  +   +    
Sbjct: 120 SIACSTHRDYRVILWLKKHELALRSAVLAVLADTSESDVQTQQGKEALQRRLTAAINKVL 179

Query: 157 ----SQGFVSSVIFRTFII 171
                 G V SV F++FII
Sbjct: 180 TDSEGFGGVDSVYFKSFII 198


>gi|126738565|ref|ZP_01754270.1| flagellar basal body-associated protein FliL [Roseobacter sp.
           SK209-2-6]
 gi|126720364|gb|EBA17070.1| flagellar basal body-associated protein FliL [Roseobacter sp.
           SK209-2-6]
          Length = 175

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/175 (14%), Positives = 59/175 (33%), Gaps = 13/175 (7%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           + +D         + KL +   VV   +G   G+      L  F   +    ++      
Sbjct: 8   AEEDAPVA----KKSKLPMIIGVVLALVGGGGGFFAAQSGLLPFG--QSASSEEMHAAEV 61

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICK---DIPDKVFL 117
               V S  T + ++        ++PI+     +     LR    L          +  L
Sbjct: 62  APEGVDSGETAEDLANLA--FIDMEPIVITLRKASGLKHLRFRAQLEVDIANQAAVEKVL 119

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
             +   + +Y+R + ++ +T        +  +  R+ +   QG V  ++   F++
Sbjct: 120 PRVVDVLNSYLRALELEDLTDPMALPKLRAQMLRRINIATGQGRVRDLLIMDFVL 174


>gi|15596639|ref|NP_250133.1| flagellar basal body-associated protein FliL [Pseudomonas
           aeruginosa PAO1]
 gi|107100876|ref|ZP_01364794.1| hypothetical protein PaerPA_01001906 [Pseudomonas aeruginosa PACS2]
 gi|116049387|ref|YP_791810.1| flagellar basal body-associated protein FliL [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|218892685|ref|YP_002441554.1| flagellar basal body-associated protein FliL [Pseudomonas
           aeruginosa LESB58]
 gi|254234541|ref|ZP_04927864.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254239792|ref|ZP_04933114.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296390191|ref|ZP_06879666.1| flagellar basal body-associated protein FliL [Pseudomonas
           aeruginosa PAb1]
 gi|313106441|ref|ZP_07792672.1| putative flagellar protein FliL [Pseudomonas aeruginosa 39016]
 gi|9947393|gb|AAG04831.1|AE004574_2 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115584608|gb|ABJ10623.1| putative flagellar protein FliL [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126166472|gb|EAZ51983.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126193170|gb|EAZ57233.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218772913|emb|CAW28725.1| putative flagellar protein FliL [Pseudomonas aeruginosa LESB58]
 gi|310879174|gb|EFQ37768.1| putative flagellar protein FliL [Pseudomonas aeruginosa 39016]
          Length = 173

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/184 (12%), Positives = 60/184 (32%), Gaps = 25/184 (13%)

Query: 1   MSYDDTTSQYIR---GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+  + T        G + KL +   +V   +      +GG     L    K EK ++  
Sbjct: 1   MAKKEATPADAGAPSGGKSKLKLILLIVVGLLLAIGLSVGGTWFF-LSKSLKAEKTEEVA 59

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IP 112
                                 L        + NF+ + +  ++++ +AL+ +D      
Sbjct: 60  SEAAKPG-----------KQPALYEILAPAFVVNFNQNGRQRYMQVGVALMGRDKAQMDA 108

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFR 167
            +  +  +   ++    + S   +    G    ++     ++  ++       +  V+F 
Sbjct: 109 LREHMPLVRNKLVMLFSSQSFDSLVTPVGKEMLRQQATAGLQELAKKETGQLAIEQVLFT 168

Query: 168 TFII 171
            F++
Sbjct: 169 NFVL 172


>gi|254785476|ref|YP_003072905.1| flagellar basal body-associated protein FliL [Teredinibacter
           turnerae T7901]
 gi|237687044|gb|ACR14308.1| flagellar basal body-associated protein FliL [Teredinibacter
           turnerae T7901]
          Length = 176

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 17/178 (9%), Positives = 57/178 (32%), Gaps = 21/178 (11%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
            D  ++   G + KL +   +     G+  G     +                       
Sbjct: 9   QDENAEDGGGGKKKLIMLVVLGLVIAGLSVGGTLAALKFLTPPP-----------PAEEG 57

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD----KVFLE 118
               +           +       +I NF+   +  +L+ ++ L+ ++       ++ + 
Sbjct: 58  AEDAAAEEPTPPPAPAIYFPIKPELIVNFNVRGRQRYLQAELTLLVREEDVIAAIELHMS 117

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
            +  +++  I     +++  A+G    ++   +      ++   +  +  V+F  F++
Sbjct: 118 KIRNNLILLIGGEVYEELLTAEGKELLRQRCLQELQNVMLQEIGKPGIEQVLFTNFVM 175


>gi|149928156|ref|ZP_01916402.1| flagellar basal body-associated protein FliL [Limnobacter sp.
           MED105]
 gi|149823141|gb|EDM82379.1| flagellar basal body-associated protein FliL [Limnobacter sp.
           MED105]
          Length = 172

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/172 (12%), Positives = 58/172 (33%), Gaps = 32/172 (18%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           +G++ KL +   +V T +         ++      G  EEK ++                
Sbjct: 20  KGSKKKLILILAIVLTVLAAGGAAAFFLLGSQGAEGGAEEKVEE---------------- 63

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPK-DWLRL----DIALICKDIPDKVFLETLHQDIMA 126
                +       +   + N        +L++    +++   +    K F   +   I+ 
Sbjct: 64  ----PVGPPTFVVMDQFVVNLAEPDTTRYLQIGITYEVSGPAQAEEIKNFTPVIRSRILL 119

Query: 127 YIRTVSIKQITGAQGFRYFKEDI--EERVKLRSQGF-----VSSVIFRTFII 171
            +   ++  +T  +G +   +++    RV ++         +  V F +F+I
Sbjct: 120 VLSGKNVSNLTSIEGKQQLMDELVDLARVTIKGDPKDPTRGIRDVHFSSFVI 171


>gi|148554214|ref|YP_001261796.1| flagellar basal body-associated protein FliL [Sphingomonas
           wittichii RW1]
 gi|148499404|gb|ABQ67658.1| flagellar basal body-associated protein FliL [Sphingomonas
           wittichii RW1]
          Length = 199

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/183 (12%), Positives = 47/183 (25%), Gaps = 24/183 (13%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVM---------------LFLFAGQKEEKYQKFI 57
           G    + V   V   F GI  G                            +   +     
Sbjct: 16  GKMKGILVMLVVALLFAGIGVGAGLYAAGAGLAGGHAKPAEDPNAPKLVPKPGAETGGHG 75

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICKD---IPD 113
                   + +  + D    K       QP  +N   S     + L ++           
Sbjct: 76  EKKTLPMGLETDASPDPTKYKATFYTFEQPFTSNLRDSDGFSQVGLGVSTYYDQKVLDNL 135

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRT 168
           K     +   I+  +       I+  +G    ++D++  +          G + +V F +
Sbjct: 136 KDNEMPIRSAILMVMAQQDSFTISTPEGKVKLQKDLKAAINDVLRQRTGFGGIDNVYFTS 195

Query: 169 FII 171
            ++
Sbjct: 196 MVV 198


>gi|261340409|ref|ZP_05968267.1| flagellar basal body-associated protein FliL [Enterobacter
           cancerogenus ATCC 35316]
 gi|288317501|gb|EFC56439.1| flagellar basal body-associated protein FliL [Enterobacter
           cancerogenus ATCC 35316]
          Length = 156

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 46/175 (26%), Gaps = 30/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   + ++  +++   V+ T             M                        
Sbjct: 2   TDSAITKKSKRSIWIPLLVLITLAACATAGYSYWRM--------------------QQEP 41

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFL----ETLH 121
             +    +         F L     N   +    L + I L  KD   +  L      + 
Sbjct: 42  TGAAAKAEAPPPPAPVFFPLDTFTVNLGDA-DRVLYIGITLRLKDEATRARLNDYLPEVR 100

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
             ++          +    G +   + I++ +         +  V+ V++  FI+
Sbjct: 101 SRLLLLFSRQDASALASDDGKQKLVDAIKQTLATPLVHGQPKQEVTDVLYTAFIL 155


>gi|77165631|ref|YP_344156.1| flagellar basal body-associated protein FliL [Nitrosococcus oceani
           ATCC 19707]
 gi|254434093|ref|ZP_05047601.1| flagellar basal body-associated protein FliL [Nitrosococcus oceani
           AFC27]
 gi|76883945|gb|ABA58626.1| Flagellar basal body-associated protein FliL [Nitrosococcus oceani
           ATCC 19707]
 gi|207090426|gb|EDZ67697.1| flagellar basal body-associated protein FliL [Nitrosococcus oceani
           AFC27]
          Length = 171

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 20/184 (10%), Positives = 51/184 (27%), Gaps = 27/184 (14%)

Query: 1   MSYDDTTSQYIR-GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+   T     R G   K  +   +    I +     G + +  +   Q           
Sbjct: 1   MAESSTLDAETRNGGGSKKSLIILICALIILLIIAVAGALYLTGVIGPQAVTGEVSADAA 60

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK---DWLRLDIALICKDIPD--- 113
                           +   +        + NF    +    +L+  +  + +D      
Sbjct: 61  RT--------------NQPAIYHSLDPAFVVNFQHQSQHRIRFLQTKMEAMARDQEVIEA 106

Query: 114 -KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFR 167
            +  +  +   ++  +     + +   +G    +E   E + L  +       V +V F 
Sbjct: 107 LQTHMPAIRNTLLLLLSQQDYETMRTVEGKERLREAAREEINLILEAQAAVSGVEAVFFT 166

Query: 168 TFII 171
            F++
Sbjct: 167 GFVM 170


>gi|120554905|ref|YP_959256.1| flagellar basal body-associated protein FliL [Marinobacter
           aquaeolei VT8]
 gi|120324754|gb|ABM19069.1| flagellar basal body-associated protein FliL [Marinobacter
           aquaeolei VT8]
          Length = 166

 Score = 71.7 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 18/179 (10%), Positives = 54/179 (30%), Gaps = 22/179 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +  T    +  + KL +   ++               +     G  + +        
Sbjct: 1   MAENTATEAPAKKGKLKLIIMLVIIIILAVGLSVVGTLWFLGGGLPGADDAETTTSAEPA 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD----KVF 116
           F  +S   +                  + T      + + ++ ++   KD        V 
Sbjct: 61  FVASSYTEIEKA--------------LVTTVQAQGRQRYAQVYVSFEAKDPAALAAADVH 106

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR----SQGFVSSVIFRTFII 171
           +  +   ++  + +    Q+   +G +   + + + V        +  +  V+FR F++
Sbjct: 107 MPLIRSQLVMVLGSSDFMQLQTPEGRQTLADSMLQTVNQVLEQEGEPAIDRVLFRNFVV 165


>gi|28211320|ref|NP_782264.1| putative flagellar protein fliL [Clostridium tetani E88]
 gi|28203760|gb|AAO36201.1| putative flagellar protein fliL [Clostridium tetani E88]
          Length = 170

 Score = 71.7 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/171 (14%), Positives = 54/171 (31%), Gaps = 10/171 (5%)

Query: 7   TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSV 66
            +   RG++ K+ +    +   +G           L     +     Q+       ++  
Sbjct: 3   ENSTERGSKLKIVIAVITLLVLVGGGTYG---GYYLSQREKKVGSNIQQPNNQQVTNSVN 59

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICK----DIPDKVFLETLH 121
            + ++G   ++     F     + N      + +++  I L  +        +     + 
Sbjct: 60  INENSGYVRNIVPSNSFEAGEFLVNLSDEEGRRFVKTRIHLGYENKRLAKELEKKKPIIL 119

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
             I + +R+         +G    K +I  RV    Q G   +V F   II
Sbjct: 120 DTINSVLRSKKSTDFNE-KGVDKIKLEILNRVNTAFQNGRCETVYFTELII 169


>gi|317492414|ref|ZP_07950843.1| flagellar basal body-associated protein FliL [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316919753|gb|EFV41083.1| flagellar basal body-associated protein FliL [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 159

 Score = 71.4 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 25/183 (13%), Positives = 46/183 (25%), Gaps = 37/183 (20%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS    T+      +   +V   ++    G   G+ G                       
Sbjct: 1   MSE---TTLPKNTKRRAKWVWILLILIIAGAGGGFYGWKYY------------------- 38

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDIPDKVFL 117
                  S+               L     N  S        L + + L   D   +  +
Sbjct: 39  ---QQQESLTESKPTPPPMPVFMPLDTFTVNLISDGEDADRVLYIGLTLRLPDEATRKRM 95

Query: 118 ----ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGF----VSSVIFRT 168
                 +   ++  +       +   QG      DI+  +    + G     VS V+F  
Sbjct: 96  NDYLPEMRSRLLMLLSRQHAATLASEQGKTQLMSDIKTVLMPPIAPGQPKQIVSDVLFTA 155

Query: 169 FII 171
           FI+
Sbjct: 156 FIL 158


>gi|299131783|ref|ZP_07024978.1| flagellar basal body-associated protein FliL [Afipia sp. 1NLS2]
 gi|298591920|gb|EFI52120.1| flagellar basal body-associated protein FliL [Afipia sp. 1NLS2]
          Length = 166

 Score = 71.4 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 25/176 (14%), Positives = 60/176 (34%), Gaps = 30/176 (17%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++  ++     + K+F+    V   + +    LG  V L      +  K +         
Sbjct: 12  EEVAAEAAPSGKRKIFMIAGAVVLTLAVSA--LGWYVFLRGGHDGQHAKEEAKAA----- 64

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVF 116
                                +  ++ N  S+P + ++       L++         K  
Sbjct: 65  ---------------PPVFLDVPDVLVNLASNPGERIQYLKVKAVLELKEAPLVEKVKPA 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +  +      Y+R +    + G+ G    KE++ +RV    +   V++V+F+  +I
Sbjct: 110 MPRVTDLFQTYLRELRANDLNGSIGLFRMKEELTKRVNAAIAPEHVNAVLFKEVVI 165


>gi|261855320|ref|YP_003262603.1| flagellar basal body-associated protein FliL [Halothiobacillus
           neapolitanus c2]
 gi|261835789|gb|ACX95556.1| flagellar basal body-associated protein FliL [Halothiobacillus
           neapolitanus c2]
          Length = 185

 Score = 71.4 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 18/170 (10%), Positives = 51/170 (30%), Gaps = 10/170 (5%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           +G    + +   V+   +    G    +++    A               + N  +    
Sbjct: 15  KGGSKLMLILMIVIIVLLLAAVGVGAMLLLKKPAAESANAAATTEQTTEGHANGDQKAGD 74

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVF----LETLHQDIMAY 127
            +               +   + +    L++++ LI  D   +         +  +IM  
Sbjct: 75  SEKHGAPITVSLGQPITVNLAEPNDAKLLQVELDLITYDPDAEAMVKTNRAEIINNIMLV 134

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF------VSSVIFRTFII 171
           +  V+  ++   QG    ++ ++E V    +        +  V F   ++
Sbjct: 135 LSDVNAAKLRTRQGKEDLQKQLKEAVNAVLEKRSGKKDEIDDVYFTKLLM 184


>gi|182680543|ref|YP_001834689.1| flagellar basal body-associated protein FliL [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182636426|gb|ACB97200.1| flagellar basal body-associated protein FliL [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 167

 Score = 71.4 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 34/177 (19%), Positives = 65/177 (36%), Gaps = 17/177 (9%)

Query: 1   MSYDDTT---SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+  D     S           +   V  T      G   G  ++     +  +      
Sbjct: 1   MASQDVPALPSNPSLSQSKLHRLGVLVGLTLFAGAVGASVGYYLVLSIKAKLADTMSTIE 60

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDK 114
             N             +     +  + L PII N    P  W+RL+  ++         +
Sbjct: 61  KEN-----------SPSKLGANVNAWPLPPIIANLADPPNSWIRLETVMLFDSKIVPKPE 109

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           V    L  D++ Y++T+S+ Q+ G  GF+  ++D+ ER  +RS G +  ++ +  +I
Sbjct: 110 VLSMQLTTDVLGYLKTLSVAQLAGPSGFQNLRDDLNERAHIRSNGAIQELVIQALVI 166


>gi|304311767|ref|YP_003811365.1| hypothetical protein HDN1F_21370 [gamma proteobacterium HdN1]
 gi|301797500|emb|CBL45720.1| Hypothetical protein HDN1F_21370 [gamma proteobacterium HdN1]
          Length = 154

 Score = 71.4 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 14/118 (11%), Positives = 37/118 (31%), Gaps = 9/118 (7%)

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLE 118
            +             K + +      +TNF      ++R +I +   D       +    
Sbjct: 36  ASGGGGEKEASGGPAKAVYVQMEPAFVTNFTDDRIRYVRTEITIKVADDATRAAIRKSNP 95

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
            +   ++  + + + + +   +G      +    V    +       V  V+F +F+I
Sbjct: 96  AIRHQLIMLLNSQTDEDMRSIEGRTQLATEATTEVIGVLEEQHEPAAVDEVLFTSFVI 153


>gi|296445180|ref|ZP_06887140.1| flagellar basal body-associated protein FliL [Methylosinus
           trichosporium OB3b]
 gi|296257354|gb|EFH04421.1| flagellar basal body-associated protein FliL [Methylosinus
           trichosporium OB3b]
          Length = 191

 Score = 71.4 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 38/171 (22%), Positives = 63/171 (36%), Gaps = 19/171 (11%)

Query: 20  VTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRS----------- 68
           V   VV T + +  G   G  ++           +                         
Sbjct: 20  VVALVVATLLAVGGGVFLGSTLVGDKPQAPAHGDEVKESAAAPAKPAAEPANKSHGGGHG 79

Query: 69  -----VHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFLETL 120
                          K ++  L PI+TN   S   W+RL  A+I          + +  +
Sbjct: 80  SAAGAKEAPAPAPTPKWKLKELAPIVTNLSESEAGWVRLQAAIIYDMAALPEPDMLVSQV 139

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             DI+AY+RT+++  I GA G R   ED+ ER  +RS+G V  +I +  ++
Sbjct: 140 TADIVAYLRTMTLASIQGADGLRRLHEDLSERAAIRSEGHVRELIIQALVV 190


>gi|271500080|ref|YP_003333105.1| flagellar basal body-associated protein FliL [Dickeya dadantii
           Ech586]
 gi|270343635|gb|ACZ76400.1| flagellar basal body-associated protein FliL [Dickeya dadantii
           Ech586]
          Length = 162

 Score = 71.4 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/183 (15%), Positives = 52/183 (28%), Gaps = 34/183 (18%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  +Q   G +  L++   +V           G   +                   
Sbjct: 1   MATSNKKAQSG-GKKRSLWLIILIVIALAATAGAGAGWWFL------------------- 40

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIPDKVFL 117
             ++      + +           L     N  S    P   L + I L   D   +  L
Sbjct: 41  --NHKKTETASSEPPPPPAPVFMPLDTFTVNLLSPDNNPDRVLYVGITLRLPDEATRARL 98

Query: 118 ----ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGF----VSSVIFRT 168
                 +   ++      S   +   QG +   EDI++ +      G     VS V+F  
Sbjct: 99  TNYLPEIRSRLIMLFSRQSSSVLATEQGKQKLVEDIKQVLSPPLVPGQPNQVVSDVLFTA 158

Query: 169 FII 171
           FI+
Sbjct: 159 FIL 161


>gi|207092675|ref|ZP_03240462.1| flagellar basal body-associated protein FliL [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 144

 Score = 71.4 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/143 (14%), Positives = 51/143 (35%), Gaps = 11/143 (7%)

Query: 40  VMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTI------SLKKLQIFSLQPIITNFD 93
           +++      KE   +          + ++    +         L  L        +    
Sbjct: 1   MLMGNKEESKENASKNTQEVQANPMANKNQEAKEGSNIQQYLVLGPLYAIDAPFAVNLVS 60

Query: 94  SSPKDWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDI 149
            + + +L+  I+L   +       KV    +   I+  + + S++++   +G    K++I
Sbjct: 61  QNGRRYLKASISLELSNEKLLNEVKVKDTAIKDTIIEILSSKSVEEVVTNKGKNKLKDEI 120

Query: 150 EERVK-LRSQGFVSSVIFRTFII 171
           +  +      GF+ +V F  FII
Sbjct: 121 KSHLNSFLIDGFIKNVFFTDFII 143


>gi|302383954|ref|YP_003819777.1| flagellar basal body-associated protein FliL [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194582|gb|ADL02154.1| flagellar basal body-associated protein FliL [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 223

 Score = 71.4 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/198 (11%), Positives = 57/198 (28%), Gaps = 29/198 (14%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            +       +  +  L      V   +    G     ++    A  + E  +    ++  
Sbjct: 25  AEVEGDGEPKKKKLPLLFIIAPVALLVLGGGGAGAFFMLQPKPAAAEGEHGEAAAGDHGE 84

Query: 63  DNSVRSVHTGDTISLKK----------------------LQIFSLQPIITNFDSSPKD-- 98
           +            +                         +  ++L  ++ N  S      
Sbjct: 85  EKKSGGHGAEKKEAGGHGGGGAEGEADPALGKISEGPDGITFYTLPDMVVNIQSPDGKPT 144

Query: 99  WLRLDIALICKDIPD----KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK 154
           +L+L + L   D       +  +  +      ++R +  + I G+ G    + +I  RV 
Sbjct: 145 FLKLTLTLEMHDAELATTLQGQMPRMQDMFQGFLRELRPEDIAGSAGTYQLRAEILRRVN 204

Query: 155 LR-SQGFVSSVIFRTFII 171
           L  +   V +V+    ++
Sbjct: 205 LIAAPSRVDAVLIEEMLV 222


>gi|32267053|ref|NP_861085.1| flagellar basal body-associated protein FliL [Helicobacter
           hepaticus ATCC 51449]
 gi|32263105|gb|AAP78151.1| flagellar basal body protein FliL [Helicobacter hepaticus ATCC
           51449]
 gi|33321862|gb|AAQ06666.1| antigen P21Hh7 [Helicobacter hepaticus]
          Length = 196

 Score = 71.4 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/196 (12%), Positives = 65/196 (33%), Gaps = 24/196 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++  ++     + K  +   +    + +    +  ++M      ++E + +   +  
Sbjct: 1   MAEEEKAAESGGDKKSKAILFVIIGIVVVLLLLVGVVVLMMTGGGHDEEEHEQKPAEVAQ 60

Query: 61  FYDNSVRSVHT----------GDTISLKKLQIFSLQ---PIITNF-DSSPKDWLRLDIAL 106
              ++                  T       I+  +   P   N    + K +L+  +  
Sbjct: 61  TQTSAPSQQAAKIIVGNTVSVRSTDKFAPGLIYPAEGPLPFTVNLMTQTGKRYLKTSVQF 120

Query: 107 ICKDIPDK---------VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LR 156
                  K           L  +   I+  + + SI+ +   +G    K++I +R+    
Sbjct: 121 ELDKDEIKANATKAELDKKLPMVQDTIIEILSSKSIEDVATVKGKNRVKDEIVKRINEFL 180

Query: 157 SQGFVSSVIFRTFIIA 172
             G VS + F  F+++
Sbjct: 181 IDGQVSDIFFVEFVVS 196


>gi|217032905|ref|ZP_03438382.1| hypothetical protein HPB128_152g22 [Helicobacter pylori B128]
 gi|216945399|gb|EEC24067.1| hypothetical protein HPB128_152g22 [Helicobacter pylori B128]
          Length = 154

 Score = 71.4 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/153 (15%), Positives = 52/153 (33%), Gaps = 6/153 (3%)

Query: 25  VYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFS 84
           +   +G+    L G          K  +  +       +   +         +       
Sbjct: 1   MLLLVGVIIMLLMGNKEESKENASKNTQEVQANPMANKNQEAKEGSNIQQYLVLGPLYAI 60

Query: 85  LQPIITNF-DSSPKDWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQITGA 139
             P   N    + + +L+  I+L   +       KV    +   I+  + + S++++   
Sbjct: 61  DAPFAVNLVSQNGRRYLKASISLELSNEKLLNEVKVKDTAIKDTIIEILSSKSVEEVVTN 120

Query: 140 QGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +G    K++I+  +      GF+ +V F  FII
Sbjct: 121 KGKNKLKDEIKSHLNSFLIDGFIKNVFFTDFII 153


>gi|239834437|ref|ZP_04682765.1| flagellar basal body-associated protein FliL [Ochrobactrum
           intermedium LMG 3301]
 gi|239822500|gb|EEQ94069.1| flagellar basal body-associated protein FliL [Ochrobactrum
           intermedium LMG 3301]
          Length = 167

 Score = 71.4 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 68/169 (40%), Gaps = 10/169 (5%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           DTT+    G       T       + +  G  G  +   +            + +     
Sbjct: 6   DTTTTETDGKAKSSLTTLLAAVAVLTVIAGGGGWYLGGMIS--------ADQLASAKVSG 57

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLETLHQ 122
                  GD  S     +  LQPI+TN       W+RL+ +L+ K           ++  
Sbjct: 58  KEDKPKKGDFESRSIGTVVPLQPIVTNLGIPQDTWVRLEASLVAKPGHEIPAALAASVGD 117

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           D ++++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 118 DFLSFLRSVNLMQLQGAAGLAYLRADLEERARLRSEGAVDRVFISALVV 166


>gi|217976230|ref|YP_002360377.1| flagellar basal body-associated protein FliL [Methylocella
           silvestris BL2]
 gi|217501606|gb|ACK49015.1| flagellar basal body-associated protein FliL [Methylocella
           silvestris BL2]
          Length = 168

 Score = 71.0 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 30/147 (20%), Positives = 57/147 (38%), Gaps = 3/147 (2%)

Query: 28  FIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQP 87
                       ++  +  G    +    +          +     +     + +  L P
Sbjct: 21  LAAFAGLMAALTIVAMISGGALGARLGAVVKTQLAGAPGSARADAQSAYSGGVNLQDLPP 80

Query: 88  IITNFDSSPKDWLRLDIALICKDIP---DKVFLETLHQDIMAYIRTVSIKQITGAQGFRY 144
           II N       W+RL   L+          V    + +DI+ ++RT ++ QI GA G ++
Sbjct: 81  IIANLAEPSDAWVRLQATLVLDRPASGKPDVLAAQIAEDILGFMRTATLSQIAGASGLQH 140

Query: 145 FKEDIEERVKLRSQGFVSSVIFRTFII 171
            +ED+ ER  +RS G V  +I +T ++
Sbjct: 141 LREDLNERAMIRSDGRVRELILQTLVV 167


>gi|325981185|ref|YP_004293587.1| flagellar basal body-associated protein FliL [Nitrosomonas sp.
           AL212]
 gi|325530704|gb|ADZ25425.1| flagellar basal body-associated protein FliL [Nitrosomonas sp.
           AL212]
          Length = 164

 Score = 71.0 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/181 (12%), Positives = 53/181 (29%), Gaps = 28/181 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS  + T     G + K  +   ++   I I  G  G    + +    + E         
Sbjct: 1   MSKSNETPPAAEGKKSKKGLVIIILIAIIAICAGAGGTWYFMQISGDGESE--------- 51

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDK----V 115
                            K      L     N        +L++ + +  ++         
Sbjct: 52  ---------TEKPKSKAKPTTFIDLDIFTVNLQPEENNQYLQVGLTVKARETEVVQEMAK 102

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +  +   I+  + +     ++   G +   + I + ++        Q  V  V+F +F+
Sbjct: 103 QMPLIRNRILMLLSSKKAADLSSIAGKQQLSQQISDEIRHSIDSEDLQEDVREVLFTSFV 162

Query: 171 I 171
           I
Sbjct: 163 I 163


>gi|295098288|emb|CBK87378.1| Flagellar basal body-associated protein [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 156

 Score = 71.0 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 47/175 (26%), Gaps = 30/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   + ++  +++   V+ T             M                        
Sbjct: 2   TDSAITKKSKRSIWIPLLVLITLAACATAGYSYWRM--------------------QQEP 41

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFL----ETLH 121
             +    +         + L     N   +    L + I L  KD   +  L      + 
Sbjct: 42  SSAAAKAEAPPPPAPVFYPLDTFTVNLGDA-DRVLYVGITLRLKDEATRARLNDYLPEVR 100

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
             ++          +    G +   + I++      V  + +  V+ V++  FI+
Sbjct: 101 SRLLLLFSRQDASALATDVGKQKLVDAIKQTLATPLVNGQPKQEVTDVLYTAFIL 155


>gi|37525865|ref|NP_929209.1| flagellar basal body-associated protein FliL [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|36785294|emb|CAE14235.1| Flagellar protein FliL [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 158

 Score = 71.0 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 19/171 (11%), Positives = 46/171 (26%), Gaps = 34/171 (19%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
             ++   +   V+   IG   G      +                               
Sbjct: 9   KRKNPFGMILLVLIAVIGTAIGGYSWWALKQAKESDSAASKA------------------ 50

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKVFL----ETLHQDIM 125
               +      +L+P   N   +   +   L + + L   D   +         +   ++
Sbjct: 51  ----IAVPVFMTLEPFTVNLIDNEDHFDRVLYIGVTLRLADEKTRQRFHEYLPEVRSRML 106

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGF----VSSVIFRTFII 171
             +       +    G     +DI++ ++     G     ++ V+F TFI+
Sbjct: 107 LLLSRQKSADLAHDSGKLRLMDDIKQTLRPTLVPGEPDQVITDVLFTTFIL 157


>gi|328545500|ref|YP_004305609.1| flagellar basal body-associated protein FliL [polymorphum gilvum
           SL003B-26A1]
 gi|326415241|gb|ADZ72304.1| Flagellar basal body-associated protein FliL [Polymorphum gilvum
           SL003B-26A1]
          Length = 169

 Score = 70.6 bits (171), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 66/164 (40%), Gaps = 13/164 (7%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVH 70
             G     FV      T +    G + G+ +                          +  
Sbjct: 15  ASGGSSAGFVGMLAFLTLLACGVGAVAGLHL----------AETVREAAAREARGASASA 64

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLE---TLHQDIMAY 127
               +     ++  L+P++TN  +    W+RL  +++  D   +        + +D++AY
Sbjct: 65  PAAPVYAVNARLRGLKPLVTNLAAPRDAWIRLQASIVLDDGDVEEAGMLAGRIEEDVVAY 124

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +RT+++ Q+ GA G ++ +ED+ ER   RS G V  +I  + +I
Sbjct: 125 LRTITLSQVEGAAGLQHLREDLNERAVARSGGRVRELILESLVI 168


>gi|317406218|gb|EFV86465.1| flagellar basal body-associated protein FliL [Achromobacter
           xylosoxidans C54]
          Length = 195

 Score = 70.6 bits (171), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 17/164 (10%), Positives = 43/164 (26%), Gaps = 19/164 (11%)

Query: 27  TFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD---------TISL 77
                   W     M     G   +       N                         ++
Sbjct: 31  AAASAGATWFIAQRMQPQGGGAPVQLGVGQTGNQPGQPGAAGPQATPTTFVAPPTTPAAV 90

Query: 78  KKLQIFSLQPIITNFDSSPKDW-----LRLDIALICKDIPDKVFLETLHQDIMAYIRTVS 132
                  ++       ++  +      L L ++     I  + ++  +   I+  + + S
Sbjct: 91  PAPIFVPIEAFTVTLQNADTERIMHVGLTLRVSDEQTRIRLEKYMPEVRSRILMVLSSQS 150

Query: 133 IKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
              +   QG       I++ V      L    +V+ V++  F++
Sbjct: 151 PTGVQTQQGKTDMANAIKQAVNRPFAPLPDGQYVTDVLYTAFVV 194


>gi|289670555|ref|ZP_06491630.1| flagellar basal body-associated protein FliL [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 175

 Score = 70.6 bits (171), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 14/164 (8%), Positives = 42/164 (25%), Gaps = 29/164 (17%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L V   VV         W                        +   +   +      +  
Sbjct: 28  LLVAIGVVVLAAAGGGAWFFFGH------------------KDDEKDGKHAAPKVAEVPK 69

Query: 78  KKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPDKVFL----ETLHQDIMAYIRTV 131
                     I+ N         +L++++ L+ +D  +   +      +   ++  +   
Sbjct: 70  PAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQT 129

Query: 132 SIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +    G +  ++      +        +  V  ++F +F+
Sbjct: 130 KATDVADLAGKQKLQKAALAEAQKVMTSETGKKCVEELLFTSFV 173


>gi|56460302|ref|YP_155583.1| flagellar basal body-associated protein FliL [Idiomarina loihiensis
           L2TR]
 gi|56179312|gb|AAV82034.1| Flagellar basal body-associated protein [Idiomarina loihiensis
           L2TR]
          Length = 180

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 19/187 (10%), Positives = 62/187 (33%), Gaps = 24/187 (12%)

Query: 1   MSYD------DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQ 54
           M+ D      + T +   G + KL +   +    I      +  + +    +  +    +
Sbjct: 1   MAEDKDNNDTEQTEEQTGGKKKKLIIFGGIGIVLI---ITVVLVLWLFGGSSEGESAAAE 57

Query: 55  KFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPD 113
             + +    +S      G+      L +   +P +       ++  +++   L+ +    
Sbjct: 58  NGMSSAAAPSSSPRPEIGN-----ALYVGMPRPFVFIVPGDSRERTVQIKAQLMVRGEES 112

Query: 114 K----VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSV 164
           +      +  +   +     + +  ++  A+G    +E     V+     +  +  V  V
Sbjct: 113 EELAKKHIPLIEGTLHEVFSSTTADRLKTAEGKGQLRELALTEVRSALEEVTGKPVVEQV 172

Query: 165 IFRTFII 171
           +F + ++
Sbjct: 173 LFTSLVM 179


>gi|167623385|ref|YP_001673679.1| flagellar basal body-associated protein FliL [Shewanella
           halifaxensis HAW-EB4]
 gi|167353407|gb|ABZ76020.1| flagellar basal body-associated protein FliL [Shewanella
           halifaxensis HAW-EB4]
          Length = 172

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 15/184 (8%), Positives = 52/184 (28%), Gaps = 26/184 (14%)

Query: 1   MSYD---DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ +   +        ++ KL +   +    I +       ++                 
Sbjct: 1   MAEEAALELEDSAEPKSKKKLILFGAIGAVLITVIAITAYLLL-------------SSDD 47

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD--- 113
                             + +       +P + N   + +   + + + L+ +   D   
Sbjct: 48  AAQVTGADDVVAAESAPRTGEAFYAAMPRPFLFNLPDNGRTRLVEIKVQLMVRGSDDDTL 107

Query: 114 -KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFR 167
            K  +  +   ++       I++++   G    +      V+     +  +  V  ++F 
Sbjct: 108 IKKHIPLIEDALLTTFSGADIQKLSSPAGKDELRLLALRNVQNTLQPVTGRTVVEKILFT 167

Query: 168 TFII 171
            F++
Sbjct: 168 GFVM 171


>gi|300822286|ref|ZP_07102427.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           119-7]
 gi|300525169|gb|EFK46238.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           119-7]
 gi|309702233|emb|CBJ01550.1| flagellar protein FliL [Escherichia coli ETEC H10407]
 gi|323937214|gb|EGB33494.1| flagellar basal body-associated protein FliL [Escherichia coli
           E1520]
          Length = 154

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 49/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A  K ++             
Sbjct: 2   TDYATSKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|300722646|ref|YP_003711936.1| flagellar biosynthesis protein [Xenorhabdus nematophila ATCC 19061]
 gi|297629153|emb|CBJ89749.1| flagellar biosynthesis [Xenorhabdus nematophila ATCC 19061]
          Length = 158

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 50/171 (29%), Gaps = 34/171 (19%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
              + +++   V+   IG   G      M                      N   +  T 
Sbjct: 9   KRTNPIWIILLVLIAVIGAAIGGYSWWAM----------------------NQSANNSTA 46

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKVFL----ETLHQDIM 125
            +  ++     +L+P   N   +   +   L + + L   +   +         +   ++
Sbjct: 47  TSKLIETPVFMNLEPFTVNLIDNEDHFDRVLYVGVTLRLSEEKTRQRFHDYLPEVRSRML 106

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGF----VSSVIFRTFII 171
             +       +    G      +I++ +      G     ++ V+F TFI+
Sbjct: 107 LLLSRQKAADLAKDDGKMNLVAEIKQTLSPTLIPGEPDQAITDVLFTTFIL 157


>gi|116694518|ref|YP_728729.1| flagellar basal body-associated protein [Ralstonia eutropha H16]
 gi|113529017|emb|CAJ95364.1| flagellar basal body-associated protein [Ralstonia eutropha H16]
          Length = 163

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 18/181 (9%), Positives = 43/181 (23%), Gaps = 29/181 (16%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+   +  +     +    +        + +  G      +L                  
Sbjct: 1   MANTASPPRTGNTGKRGRLLLIGAGVLVVALGAGGFVLGSVLSNRQ-------------- 46

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIP----DKV 115
                  +        +       L     N        +L   ++L   D         
Sbjct: 47  -----PAAPAAPAAPVVPPPIFVPLDAFTVNLRSDDGDRFLHTGLSLKVADAETQARLAQ 101

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-----RSQGFVSSVIFRTFI 170
           +L      I+  +       +   +G R   +DI + +            V  V+F +F+
Sbjct: 102 YLPEARSRILLLLSARQPADLATVEGKRKLADDIRDTISKPFASGLPAQRVLDVLFTSFV 161

Query: 171 I 171
           +
Sbjct: 162 V 162


>gi|320354328|ref|YP_004195667.1| flagellar basal body-associated protein FliL [Desulfobulbus
           propionicus DSM 2032]
 gi|320122830|gb|ADW18376.1| flagellar basal body-associated protein FliL [Desulfobulbus
           propionicus DSM 2032]
          Length = 172

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 14/127 (11%), Positives = 43/127 (33%), Gaps = 6/127 (4%)

Query: 51  EKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICK 109
              ++        +   ++        K   +  ++  I N  S     +++  ++L   
Sbjct: 45  PHQEELKRKQEEASKAEALIKPVPEEAKIGPMVEIKEFIVNIISEDTPHYVKASLSLELD 104

Query: 110 DI----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSV 164
                      +  +   I+  I   + +++   QG    K +++ ++      G V++V
Sbjct: 105 KDATLDEVNKRMPQIRDAILLLIGNKTFEELQDIQGKNQVKAELKSKINSFLKTGKVNNV 164

Query: 165 IFRTFII 171
               F++
Sbjct: 165 YLTDFVV 171


>gi|114046861|ref|YP_737411.1| flagellar basal body-associated protein FliL [Shewanella sp. MR-7]
 gi|113888303|gb|ABI42354.1| flagellar basal body-associated protein FliL [Shewanella sp. MR-7]
          Length = 175

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 16/171 (9%), Positives = 49/171 (28%), Gaps = 20/171 (11%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVH 70
              ++ KLF+          +  G L   +                        +     
Sbjct: 14  APKSKKKLFIFVGAGAFAALLIGGALWFFLGSSDE----------APEAAAEGAAPTETT 63

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK----VFLETLHQDIM 125
           T    +     +   +P + N     +   + + + L+ +   D       +  +   ++
Sbjct: 64  TPAADAAMAAYVPMPRPFLFNLPGPDRARLVEIKVQLMVRGQDDDVLTQKHIPLIEDALL 123

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
                  +++++   G    ++     V+     +  +  V  V+F  F++
Sbjct: 124 TTFSGADVQKLSTQAGKDELRQLALLSVQNTLQSVTGRKVVEKVLFTGFVM 174


>gi|91776324|ref|YP_546080.1| flagellar basal body-associated protein FliL [Methylobacillus
           flagellatus KT]
 gi|91710311|gb|ABE50239.1| flagellar basal body-associated protein FliL [Methylobacillus
           flagellatus KT]
          Length = 168

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 20/172 (11%), Positives = 53/172 (30%), Gaps = 29/172 (16%)

Query: 10  YIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSV 69
             +G++  L +          +  G     +                     +D + +  
Sbjct: 15  QQKGSKKGLILALIGGLLVAVLGAGGAYWYL-------------------KQHDGNQQDK 55

Query: 70  HTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIP----DKVFLETLHQDI 124
              + +  K+    +L     N        +L++D+ +  +D       K  + ++   I
Sbjct: 56  PREEKVVAKEPVFVTLDTFTVNLQPDPDDQYLQVDLTVQVEDQAQADIIKKHMPSVRNRI 115

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKL-----RSQGFVSSVIFRTFII 171
           +  + +    ++    G +    +I  ++            VS V F +F+I
Sbjct: 116 LILLSSKKSSELLNIDGKKALASEIIAQLSEPFSPGAKPQAVSDVFFTSFVI 167


>gi|296103633|ref|YP_003613779.1| Flagellar basal body-associated protein FliL [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295058092|gb|ADF62830.1| Flagellar basal body-associated protein FliL [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 168

 Score = 70.6 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 15/178 (8%), Positives = 49/178 (27%), Gaps = 24/178 (13%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           +   +   G   +  +  F+  T +            +                    + 
Sbjct: 3   NKNKKVASGGGSRSLLMTFMFLTAVAACGVSGYLFWEMKF-------------AKPAAEV 49

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNF---DSSPKDWLRLDIALICKDIP----DKVFL 117
           +     T    +  +    S+     +     +     L L +++   +       + +L
Sbjct: 50  AQGEAETAPAPAQVEPLYASMNTFTVSLKPTANESDRVLYLGLSIRVAEQKSLAVLEKYL 109

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYF----KEDIEERVKLRSQGFVSSVIFRTFII 171
                 +   +   + + +   +G R      K ++++ +       V+ V+   FI+
Sbjct: 110 PEYRSRLFMLLTHQTYEDLATDEGKRRLMTNIKSELDKPLAFNQSIRVTDVLINEFIL 167


>gi|325928695|ref|ZP_08189867.1| flagellar basal body-associated protein [Xanthomonas perforans
           91-118]
 gi|325540927|gb|EGD12497.1| flagellar basal body-associated protein [Xanthomonas perforans
           91-118]
          Length = 183

 Score = 70.6 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 14/164 (8%), Positives = 40/164 (24%), Gaps = 29/164 (17%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +   VV         W                                       +  
Sbjct: 36  LLIAIGVVVLAAAGGGAWFF------------------LGHKGEEKGGKHDAPKVAEVPK 77

Query: 78  KKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPDKVFL----ETLHQDIMAYIRTV 131
                     I+ N         +L++++ L+ +D  +   +      +   ++  +  V
Sbjct: 78  PAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQV 137

Query: 132 SIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +    G +  ++      +        +  V  ++F +F+
Sbjct: 138 KATDVADLAGKQKLQKSALAEAQKVMTSETGKKCVEELLFTSFV 181


>gi|323705436|ref|ZP_08117011.1| flagellar basal body-associated protein FliL [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535338|gb|EGB25114.1| flagellar basal body-associated protein FliL [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 132

 Score = 70.2 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 13/104 (12%), Positives = 35/104 (33%), Gaps = 5/104 (4%)

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI----PDKVFLETLHQDIMAYI 128
              +      +S              +++  I L   D             +   I+  +
Sbjct: 28  SKPAKIVYYNYSPGSEFITNLKGDDKFIKAGIELEVTDKNVLKELSDQNPKIRDAIIQIL 87

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           R  + + + G++G    +  I+ ++  +     +++V F  FI+
Sbjct: 88  RNETAQDLEGSEGQAKLQNQIKSQINKILGADKITNVYFDDFIV 131


>gi|294664065|ref|ZP_06729467.1| flagellar basal body-associated protein FliL [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292606168|gb|EFF49417.1| flagellar basal body-associated protein FliL [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 201

 Score = 70.2 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 10/123 (8%), Positives = 35/123 (28%), Gaps = 11/123 (8%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPDKVF 116
                           +            I+ N         +L++++ L+ +D  +   
Sbjct: 77  KGEEKGGKHDAPKVAEVPKPAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKL 136

Query: 117 L----ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFR 167
           +      +   ++  +  V    +    G +  ++      +        +  V  ++F 
Sbjct: 137 ITENAPAIRAHLLMLLSQVKATDVADLAGKQKLQKSALAEAQKVMTSETGKKCVEELLFT 196

Query: 168 TFI 170
           +F+
Sbjct: 197 SFV 199


>gi|21242692|ref|NP_642274.1| flagellar protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|21108165|gb|AAM36810.1| flagellar protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 175

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 14/164 (8%), Positives = 40/164 (24%), Gaps = 29/164 (17%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +   VV         W                                       +  
Sbjct: 28  LLIAIGVVVLAAAGGGAWFF------------------LGHKGEEKGGKHDAPKVAEVPK 69

Query: 78  KKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPDKVFL----ETLHQDIMAYIRTV 131
                     I+ N         +L++++ L+ +D  +   +      +   ++  +  V
Sbjct: 70  PAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQV 129

Query: 132 SIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +    G +  ++      +        +  V  ++F +F+
Sbjct: 130 KATDVADLAGKQKLQKSALAEAQKVMTSETGKKCVEELLFTSFV 173


>gi|153011519|ref|YP_001372733.1| flagellar basal body-associated protein FliL [Ochrobactrum anthropi
           ATCC 49188]
 gi|151563407|gb|ABS16904.1| flagellar basal body-associated protein FliL [Ochrobactrum anthropi
           ATCC 49188]
          Length = 164

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 67/169 (39%), Gaps = 10/169 (5%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           DTT     G               + +  G  G  +   + A Q          +     
Sbjct: 3   DTTVTEKDGKAKGSLTGLLAAVAVLTVIAGGGGWYLGGMISADQLASAKPSGKEDK---- 58

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLETLHQ 122
                  GD  S     +  LQPIITN       W+RL+ +L+ K           ++  
Sbjct: 59  ----PKQGDFESRSIGTVVPLQPIITNLGIPQNTWVRLEASLVAKPGHEIPAAVAASVGD 114

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           D ++++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     ++
Sbjct: 115 DFLSFLRSVNLMQLQGAAGLAYLRSDLEERARLRSEGAVERVFISALVV 163


>gi|156933436|ref|YP_001437352.1| flagellar basal body-associated protein FliL [Cronobacter sakazakii
           ATCC BAA-894]
 gi|156531690|gb|ABU76516.1| hypothetical protein ESA_01254 [Cronobacter sakazakii ATCC BAA-894]
          Length = 157

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/176 (12%), Positives = 48/176 (27%), Gaps = 31/176 (17%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           D+     +G +  +++   V+ T             M                       
Sbjct: 3   DSAITKGKGRKRSIWIPLLVIITLAACATAGYSYWRM---------------------QQ 41

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFL----ETL 120
              +              F+L     N   +    L + I L  KD   +  L      +
Sbjct: 42  HGTTAAKAAPEPPPAPVFFALDTFTVNLGDA-DRVLYVGITLRLKDEATRQRLSDYLPEV 100

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
              ++         Q+   +G +   E I++ +         +  V+ V++  FI+
Sbjct: 101 RSRLLLLFSRQDASQLATDEGKQKLVEAIKQTLSAPLVAGQPKQVVTDVLYTAFIL 156


>gi|166712026|ref|ZP_02243233.1| flagellar protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 174

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/179 (9%), Positives = 46/179 (25%), Gaps = 30/179 (16%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            DD   +   G +  L V   VV         W                           
Sbjct: 13  KDDKGEKKNGGKKPILLVAIGVVVLAAAGGGAWFFLGH-------------------KAD 53

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPDKVFL--- 117
           D   +       +            I+ N         +L++++ L+ ++  +   +   
Sbjct: 54  DKGDKHAPKVAEVPKPAQYFPMDPAIVVNLADPGDGPHYLQVEVQLVTREPEELKLITEN 113

Query: 118 -ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
              +   ++  +       +    G +  ++      +        +  V  ++F +F+
Sbjct: 114 APAIRAHLLMLLSQTKATDVADLAGKQKLQKAALAETQKVMTSETGKKCVEELLFTSFV 172


>gi|163750544|ref|ZP_02157782.1| flagellar basal body-associated protein [Shewanella benthica KT99]
 gi|161329699|gb|EDQ00688.1| flagellar basal body-associated protein [Shewanella benthica KT99]
          Length = 171

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 16/170 (9%), Positives = 52/170 (30%), Gaps = 24/170 (14%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
             ++ KL V   +    + I    L   +       +  +       +            
Sbjct: 15  PKSKQKLIVFGVIGLVLVLIIAAVLWFFLGASSANSENTDAAADTQESMHVGE------- 67

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD----KVFLETLHQDIMA 126
                     +   +P + N   + +   + + + L+ +   D    +  +  +   ++ 
Sbjct: 68  -------AFYVGMPRPFLFNLPGATRSRLVEIKVQLMVRGADDGVLIRKHIPLIEDALLT 120

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
              +  ++++T   G    ++     V+     +  +  V  V+F  F++
Sbjct: 121 TFSSADVQKLTSLAGKDEMRQLALLNVQNTLQSVTGRKIVEKVLFTGFVM 170


>gi|319790415|ref|YP_004152048.1| flagellar basal body-associated protein FliL [Thermovibrio
           ammonificans HB-1]
 gi|317114917|gb|ADU97407.1| flagellar basal body-associated protein FliL [Thermovibrio
           ammonificans HB-1]
          Length = 170

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 44/120 (36%), Gaps = 6/120 (5%)

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIPDK-- 114
                +   + +      +     +F L   + N      + +L++ I L  KD   +  
Sbjct: 48  KAQSKEKQAQKIIEEIKATENVGVMFDLGTFVVNLADPDIERYLKVSIVLELKDQKVQQE 107

Query: 115 --VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
               L  +   I   + T    +I   +G  + KE+I +RV      G V +V F  FII
Sbjct: 108 AQKRLPEIKDAITTLLLTKKSSEIRTPEGIEFLKEEIAKRVNAILPLGGVKNVYFTEFII 167


>gi|188582488|ref|YP_001925933.1| flagellar basal body-associated protein FliL [Methylobacterium
           populi BJ001]
 gi|179345986|gb|ACB81398.1| flagellar basal body-associated protein FliL [Methylobacterium
           populi BJ001]
          Length = 192

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/178 (13%), Positives = 56/178 (31%), Gaps = 27/178 (15%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
             +  S     ++ KL +    V    G   G++                         +
Sbjct: 32  EGEEGSAEAPKSKKKLIIIAAAVLLLGGGGGGFMF------------------MKSRAAH 73

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK----DWLRLDIALICKDIPDKV--- 115
            ++             +     ++ ++ N    P     + L+L +AL  KD   +    
Sbjct: 74  ADAHGEHAGEKVDPKAQAVFLDMRDMMVNLSPDPGATKANVLKLRVALELKDAKVESTVK 133

Query: 116 -FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
             +  +      Y+R +    + G+ G    +E++  RV +        +V+F+  I+
Sbjct: 134 PLMPRVEDAFQTYLREIRASDLAGSAGLYRLREELLRRVNIALHPAKAEAVLFKDVIV 191


>gi|146277686|ref|YP_001167845.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145555927|gb|ABP70540.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 192

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/155 (14%), Positives = 47/155 (30%), Gaps = 15/155 (9%)

Query: 32  FCGWLGGIVMLFLFAG-----QKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQ 86
             G+      L          ++    ++           +               +  +
Sbjct: 37  GAGFFYFANPLSPAKDVMRLIERTPADEETPAAIDPKAPQKVPRPTPNKEAFVTSYYQFK 96

Query: 87  PIITNFDSSPKDWLRLDIALICKDI-----PDKVFLETLHQDIMAYIRTVSIKQITGAQG 141
             +T    + + +L++ I L  +               L  D++A I T S +++    G
Sbjct: 97  EPLTTNLRASRRFLQVGIGLSTQYDQKVMDNVARNEVALRSDMLAIIGTFSEEELQDKAG 156

Query: 142 FRYFKEDIEERVKLRSQ-----GFVSSVIFRTFII 171
                E +   V  R Q     G + +V F +FI+
Sbjct: 157 RDRLAEALRGAVNARLQQLEGFGGIEAVFFPSFIL 191


>gi|325295418|ref|YP_004281932.1| flagellar basal body-associated protein FliL [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065866|gb|ADY73873.1| flagellar basal body-associated protein FliL [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 168

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 39/177 (22%), Positives = 70/177 (39%), Gaps = 18/177 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   Q  +G+  K F+   V+   +GI  G     ++L     + +EK  + I+  
Sbjct: 1   MAEEEKQEQEQKGSGKKKFIILIVLLLLLGIGGGVAYKFLVLDKKKVESQEKQAQRIIE- 59

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKD----IPDKV 115
                          + K   +F L   + N   +  + +L++ I L  KD       + 
Sbjct: 60  -----------EIKATEKVGVMFDLGTFVVNLADTDIERYLKVSIVLELKDQKIQAEAQK 108

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
            L  +   I   + T    +I   +G  + KE+I +RV      G V +V F  FII
Sbjct: 109 RLPEIKDAITTLLLTKKSSEIRTPEGIEFLKEEIAKRVNAILPLGGVKNVYFTEFII 165


>gi|295696123|ref|YP_003589361.1| flagellar basal body-associated protein FliL [Bacillus tusciae DSM
           2912]
 gi|295411725|gb|ADG06217.1| flagellar basal body-associated protein FliL [Bacillus tusciae DSM
           2912]
          Length = 147

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/170 (13%), Positives = 44/170 (25%), Gaps = 28/170 (16%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           DT  +        L     VV         W                             
Sbjct: 2   DTDGKGGVATSKGLTWALIVVLAAAVGVGAWYVI-------------------------G 36

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSP--KDWLRLDIALICKDIPDKVFLETLHQ 122
           S  +     T +      + L  + TN       +  + L  +        ++    +  
Sbjct: 37  SRATSSGPPTAADLAKTRYDLPQMTTNLAGGSVIQFSVSLQASSDQAKGELELRKVEIQD 96

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
            +   + +   + +   +G    K DI +RV      G V+ V F + I+
Sbjct: 97  AVNDILHSWKREDLDQPRGQEKLKGDIMKRVNELLHNGRVTQVYFPSIIV 146


>gi|331663440|ref|ZP_08364350.1| flagellar basal body-associated protein FliL [Escherichia coli
           TA143]
 gi|331059239|gb|EGI31216.1| flagellar basal body-associated protein FliL [Escherichia coli
           TA143]
          Length = 154

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 49/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A  K ++             
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKKLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|315498451|ref|YP_004087255.1| flagellar basal body-associated protein flil [Asticcacaulis
           excentricus CB 48]
 gi|315416463|gb|ADU13104.1| flagellar basal body-associated protein FliL [Asticcacaulis
           excentricus CB 48]
          Length = 218

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/201 (9%), Positives = 55/201 (27%), Gaps = 30/201 (14%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +  +      +     + +        +    G     + L      +   + +      
Sbjct: 18  AEGEDGEAPKKKGLPIMLIAIAGGAVVLLGGGGAAAYFLFLKPKPAAEAGAHGEEAKGGH 77

Query: 62  YDNS-----------------------VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD 98
            +                                       +  F+L   + N  ++   
Sbjct: 78  GEEKKKDDGHGKKKEEKGGHGGGGEKVDPKTQPVIAEGPDGITYFTLPDTLANIQTTNGK 137

Query: 99  --WLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER 152
             +L+L +     D          L  +   +  ++R +  + +TG+QG    + +I  R
Sbjct: 138 ATYLKLKLTFEVADHETVELLNQSLPRIDDVLQGFLRELRPEDVTGSQGSYQLRLEILRR 197

Query: 153 VK-LRSQGFVSSVIFRTFIIA 172
           V  + +   V++V+    +I 
Sbjct: 198 VNLVLAPHKVNAVLIEEMLIT 218


>gi|254292907|ref|YP_003058930.1| flagellar basal body-associated protein FliL [Hirschia baltica ATCC
           49814]
 gi|254041438|gb|ACT58233.1| flagellar basal body-associated protein FliL [Hirschia baltica ATCC
           49814]
          Length = 224

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/223 (9%), Positives = 66/223 (29%), Gaps = 52/223 (23%)

Query: 1   MSYDDTTSQ---------YIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEE 51
           M+ +D  S+           +    K  + + V+   + +  G   G+++         E
Sbjct: 1   MADEDKESEDTTLEEEKPAKKKLAGKTMILFIVLPALLIMGGGVAVGMMLAGGGKEAASE 60

Query: 52  KYQKFILNNFYDNSVRSVHTGDTISLK--------------------------------- 78
            + + + ++  +       +                                        
Sbjct: 61  SHAEIVDDHGEEKDDHGKKSDSHEEKADDHGAKDDGHGESSGSGDHQGPARETGTLQVGN 120

Query: 79  --KLQIFSLQPIITNFDSSPKD---WLRLDIALICKDIP----DKVFLETLHQDIMAYIR 129
                 + +  ++ N  S   D   +L+L + L  +D          L  +      ++R
Sbjct: 121 SGDPSYYIMPDLLVNLASQDGDRQLFLKLKLTLEAEDPEMFADIPKMLPRITDQYQMFLR 180

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
            + +  + G+ G    + ++  R+ +  +   V +V+    ++
Sbjct: 181 ELRVDDLNGSAGGYRLRLELLRRINIAIAPSRVDAVLIEEMLV 223


>gi|77359747|ref|YP_339322.1| flagellar basal body-associated protein FliL [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76874658|emb|CAI85879.1| putative flagellar protein [Pseudoalteromonas haloplanktis TAC125]
          Length = 176

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 16/181 (8%), Positives = 55/181 (30%), Gaps = 16/181 (8%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +        GN  K  +        + +        ++       +    +      
Sbjct: 1   MAEETNLEIEETGNSKKKIIVIIAAVLLVIVAAVVGY-FLLSGSDTPAETLNDEAATAQQ 59

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK----V 115
                  S           L +   +P + N   S +   +++ + L+ +   ++     
Sbjct: 60  AS-----SSTGSSAKIGSALYVAMPRPFVFNIPGSSRDRIVQIKVELLVRSEANEETAKK 114

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +  +   +++     +  +++ + G    +    E+V+     +     +  V+F  F+
Sbjct: 115 HIPLIESTLLSIFSMTTADELSTSVGKENLRFAALEKVQASLMDVEGSKVIERVLFTGFV 174

Query: 171 I 171
           +
Sbjct: 175 M 175


>gi|237755391|ref|ZP_04584018.1| flagellar basal body-associated protein FliL [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692432|gb|EEP61413.1| flagellar basal body-associated protein FliL [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 169

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 40/120 (33%), Gaps = 6/120 (5%)

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIPDK-- 114
                +     +      + ++     +   + N        ++++ I +  +D   K  
Sbjct: 47  AKEEKEKPPEKIANEIKKAEEQGVELEVGTFVANLADKDADRYIKVTIVMEVQDEKVKEE 106

Query: 115 --VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
               +  +   I   + T + +++   +G    KE+I  R       G V  V F  FII
Sbjct: 107 ATKRMPQIKDAINTLLFTKTSEELKSPEGIEKLKEEIIRRTNAILPLGGVKDVYFTEFII 166


>gi|300871254|ref|YP_003786127.1| endoflagellar basal body-associated protein [Brachyspira pilosicoli
           95/1000]
 gi|300688955|gb|ADK31626.1| endoflagellar basal body-associated protein [Brachyspira pilosicoli
           95/1000]
          Length = 181

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/164 (10%), Positives = 41/164 (25%), Gaps = 24/164 (14%)

Query: 17  KLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTIS 76
           K+ +    +     I       +                             V  G    
Sbjct: 34  KILMIVAAILVVALISGLIAFFVSKSVGR----------------AAGVNAGVVDGMIKQ 77

Query: 77  LKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDI------PDKVFLETLHQDIMAYIR 129
                         N        ++R+ I L                   +   I + I 
Sbjct: 78  PPPTYFAITPEFNVNTADMDVARFVRVSIVLTYTTNVKQLAVELPERGYMIRDRIYSLIS 137

Query: 130 TVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
           + +  Q+   +G    K DI+  +  +   G +  ++F +F+++
Sbjct: 138 SYTYDQLRTNEGREQLKADIKREINSMLKNGQIDDILFDSFLLS 181


>gi|260598453|ref|YP_003211024.1| flagellar basal body-associated protein FliL [Cronobacter
           turicensis z3032]
 gi|260217630|emb|CBA31925.1| Flagellar fliL protein [Cronobacter turicensis z3032]
          Length = 158

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/176 (12%), Positives = 48/176 (27%), Gaps = 31/176 (17%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           D+     +G +  +++   V+ T             M                       
Sbjct: 4   DSAITKGKGRKRSIWIPLLVIITLAACATAGYSYWRM---------------------QQ 42

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFL----ETL 120
              +              F+L     N   +    L + I L  KD   +  L      +
Sbjct: 43  HGTTAAKAAPEPPPAPVFFALDTFTVNLGDA-DRVLYVGITLRLKDEATRQRLSDYLPEV 101

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
              ++         Q+   +G +   E I++ +         +  V+ V++  FI+
Sbjct: 102 RSRLLLLFSRQDASQLATDEGKQKLVEAIKQTLSAPLVAGQPKQVVTDVLYTAFIL 157


>gi|293395597|ref|ZP_06639880.1| flagellar FliL protein [Serratia odorifera DSM 4582]
 gi|291421916|gb|EFE95162.1| flagellar FliL protein [Serratia odorifera DSM 4582]
          Length = 161

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/183 (13%), Positives = 51/183 (27%), Gaps = 35/183 (19%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS +   +   + +   +     ++ T            ++     G       +     
Sbjct: 1   MSQNTLPTAAKKRSLLVIL---LLLITVAACGAAGYSWWLLQQKNDGAPVAAKPQ----- 52

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF---DSSPKDWLRLDIALICKDIP----D 113
                                   L     N    D++P   L + + L   D       
Sbjct: 53  ---------------PPTAPVFMPLDTFTVNLLTPDNNPDRVLYIGLTLRLPDEATRRQL 97

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRT 168
             FL  +   ++  +      Q+   QG +     I++      VK + +  VS V+F  
Sbjct: 98  NDFLPEVRSRLLMLLSRQEAAQLANEQGKQQLVAQIKDVLSPPLVKGQPKQVVSDVLFTA 157

Query: 169 FII 171
           FI+
Sbjct: 158 FIL 160


>gi|86146130|ref|ZP_01064456.1| flagellar basal body-associated protein [Vibrio sp. MED222]
 gi|218708829|ref|YP_002416450.1| flagellar basal body-associated protein FliL [Vibrio splendidus
           LGP32]
 gi|85836077|gb|EAQ54209.1| flagellar basal body-associated protein [Vibrio sp. MED222]
 gi|218321848|emb|CAV17823.1| polar flagellar protein FliL [Vibrio splendidus LGP32]
          Length = 162

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 58/181 (32%), Gaps = 30/181 (16%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +  T +     + KL +    V   +    G    ++                  ++
Sbjct: 1   MAEEQETPK----GKSKLLIIAIAVVVLLLGGGGAAFFLMGS----------------DD 40

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
             + +  S       +   + +   Q  + N         +++ + L+ + + ++V    
Sbjct: 41  KAEGAGSSAEVQLMGADPVVYVNVPQAFLFNVTGDKKDRLVQIKVQLMVRGMKNEVLARY 100

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
               +   ++A   + ++ Q+    G    +    E +     +   Q  +  V+F  F+
Sbjct: 101 HSPLVESALLATFASATVDQLRSPAGRVELRNKATEDIKASLTQAVGQPVIEKVLFTDFV 160

Query: 171 I 171
           I
Sbjct: 161 I 161


>gi|90422615|ref|YP_530985.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisB18]
 gi|90104629|gb|ABD86666.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisB18]
          Length = 147

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 37/156 (23%), Positives = 74/156 (47%), Gaps = 15/156 (9%)

Query: 19  FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLK 78
           ++  F+V T +    G L  + +L         ++              S  +       
Sbjct: 3   WLVVFLVLTAVSAAAGVLSSLHVLS------AVQHTADTQQKVEPPPAASAFSPSA---- 52

Query: 79  KLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKV---FLETLHQDIMAYIRTVSIKQ 135
             ++  + P++TN  S P  W+R++ ++I   + D+     +  + +D+++Y+RT+S  Q
Sbjct: 53  --RLRKMAPVVTNMASPPGAWIRVEASVITDQVDDEQANVLIARVGEDVVSYLRTISPTQ 110

Query: 136 ITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I GA+G +Y +ED+ ER  +RS G V  +I  T ++
Sbjct: 111 IEGARGLQYLREDLNERAAIRSSGKVRELIIETLVV 146


>gi|193066402|ref|ZP_03047450.1| flagellar basal body-associated protein FliL [Escherichia coli E22]
 gi|194429938|ref|ZP_03062448.1| flagellar basal body-associated protein FliL [Escherichia coli
           B171]
 gi|209919366|ref|YP_002293450.1| flagellar basal body-associated protein FliL [Escherichia coli
           SE11]
 gi|256017863|ref|ZP_05431728.1| flagellar basal body-associated protein FliL [Shigella sp. D9]
 gi|260844343|ref|YP_003222121.1| flagellar biosynthesis protein FliL [Escherichia coli O103:H2 str.
           12009]
 gi|301327731|ref|ZP_07220936.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           78-1]
 gi|332278889|ref|ZP_08391302.1| flagellar protein FliL [Shigella sp. D9]
 gi|192925987|gb|EDV80633.1| flagellar basal body-associated protein FliL [Escherichia coli E22]
 gi|194412027|gb|EDX28339.1| flagellar basal body-associated protein FliL [Escherichia coli
           B171]
 gi|209912625|dbj|BAG77699.1| flagellar protein FliL [Escherichia coli SE11]
 gi|257759490|dbj|BAI30987.1| flagellar biosynthesis protein FliL [Escherichia coli O103:H2 str.
           12009]
 gi|300845731|gb|EFK73491.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           78-1]
 gi|320198634|gb|EFW73234.1| Flagellar biosynthesis protein FliL [Escherichia coli EC4100B]
 gi|323158577|gb|EFZ44591.1| flagellar fliL protein [Escherichia coli E128010]
 gi|332101241|gb|EGJ04587.1| flagellar protein FliL [Shigella sp. D9]
          Length = 154

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 49/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A  K ++             
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + + L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALDTFTVNLGDA-DRVLYIGVTLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|71281246|ref|YP_268250.1| flagellar basal body-associated protein FliL [Colwellia
           psychrerythraea 34H]
 gi|71146986|gb|AAZ27459.1| flagellar protein FliL [Colwellia psychrerythraea 34H]
          Length = 184

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 16/158 (10%), Positives = 44/158 (27%), Gaps = 15/158 (9%)

Query: 24  VVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIF 83
           VV    G    +   +               +       D+   +           L + 
Sbjct: 31  VVVLLGGGAGAYFFFM-----GGVDNSASQAELDTALDSDSGEVTKVESGAQLGSALYVP 85

Query: 84  SLQPIITNFDS-SPKDWLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSIKQITG 138
             +P   N    +   ++ + + L+ +        K+ +  +   ++      +   +  
Sbjct: 86  MPRPFRFNVPGAARDRFVEIRVQLLVRGGDNEENAKMHIPLIESTLLDIFSQANADDLAT 145

Query: 139 AQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
           + G    K+     V+     +     V  V+F  F++
Sbjct: 146 SAGKVSLKQKSLAAVQKIMTDIEGDKTVEKVLFTGFVM 183


>gi|83312596|ref|YP_422860.1| flagellar basal body-associated protein [Magnetospirillum
           magneticum AMB-1]
 gi|82947437|dbj|BAE52301.1| Flagellar basal body-associated protein [Magnetospirillum
           magneticum AMB-1]
          Length = 181

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 40/97 (41%), Gaps = 7/97 (7%)

Query: 82  IFSLQPIITNFDSSPKD------WLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQ 135
              L  ++ N  ++ +        + L++  +      +  L  +  +   Y+R + ++ 
Sbjct: 84  FMDLPEMLVNLQTTGRKQAFLKLRVALELEAVTDQPRVEQMLPRIIDNFQIYLRELRVED 143

Query: 136 ITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           + GA G    +E++  RV        V+ V+F+  ++
Sbjct: 144 LQGASGMHLLREELLTRVNAAVKPVKVNDVLFKEMLV 180


>gi|319405406|emb|CBI79025.1| Flagellar basal body-associated protein FliL [Bartonella sp. AR
           15-3]
          Length = 166

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 72/175 (41%), Gaps = 15/175 (8%)

Query: 1   MSYDDTTSQY--IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +    +    + +  K+F+    V T + +  GW  G  +    A       +    
Sbjct: 1   MAEEPKKEKNIVQQESSLKIFLVVVFVLTLVAVASGWFLGAWVSREMAPTSSNFKE---- 56

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD--KVF 116
                  +    T + +      I  L PI+TN       W+R++++L+ K   +     
Sbjct: 57  -------LPVTKTSENLIAADSHIVILPPIVTNIAVPENAWIRMEVSLVIKPDENIAATL 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
              +  D +A++R  +I QI G  G    + D+ +R ++RS   VS+++  + ++
Sbjct: 110 TADISNDFLAFLRQATIDQIKGPSGLMNLRADLLDRARIRSGNKVSNILISSLVV 164


>gi|114797942|ref|YP_758972.1| flagellar basal body-associated protein FliL [Hyphomonas neptunium
           ATCC 15444]
 gi|114738116|gb|ABI76241.1| flagellar basal body-associated protein FliL [Hyphomonas neptunium
           ATCC 15444]
          Length = 171

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 54/177 (30%), Gaps = 13/177 (7%)

Query: 1   MSY--DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+   D   S      +        ++           G    L   A            
Sbjct: 1   MAKKPDTNESGQTESGKKSGGGIAGLLIVAAASLASSFGLFYFLTPPAQTPAAACPPAGS 60

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALIC---KDIPDKV 115
                           ++  ++ I   + +IT   +    +L+L+I+++         K 
Sbjct: 61  ETAAPA-------VAPLAQDQVYIEMKEILITIGSAPADRYLKLNISIVTGKDNAAKVKQ 113

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSS-VIFRTFII 171
               L      Y+R++ +K +     + + +E +  R +L      S+ V+   F++
Sbjct: 114 AEPMLIDAFNNYLRSIELKDLEEPGFYPHLREQLARRSELVVGSAASNGVLITEFLL 170


>gi|331677826|ref|ZP_08378501.1| flagellar basal body-associated protein FliL [Escherichia coli
           H591]
 gi|331074286|gb|EGI45606.1| flagellar basal body-associated protein FliL [Escherichia coli
           H591]
          Length = 154

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 49/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A  K ++             
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPTPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|333004049|gb|EGK23583.1| flagellar fliL protein [Shigella flexneri K-272]
 gi|333017822|gb|EGK37129.1| flagellar fliL protein [Shigella flexneri K-227]
          Length = 154

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/175 (12%), Positives = 49/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A  K ++             
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    DI+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLIADIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|73539705|ref|YP_300072.1| flagellar basal body-associated protein FliL [Ralstonia eutropha
           JMP134]
 gi|72123042|gb|AAZ65228.1| Flagellar basal body-associated protein FliL [Ralstonia eutropha
           JMP134]
          Length = 145

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/164 (10%), Positives = 39/164 (23%), Gaps = 30/164 (18%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           + +    V        G++ G ++                                   +
Sbjct: 1   MLLIGGGVLILALGAGGFVLGSILSNRQ--------------------PAVPAAPAAPVI 40

Query: 78  KKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDIPDKVFL----ETLHQDIMAYIRTVS 132
                  L     N        +L   ++L   D   +  +          I+  +    
Sbjct: 41  PPPIFVPLDAFTVNLKGEDGDRFLHTGLSLKVADADTQARMTQYLPEARSRILLLLSARQ 100

Query: 133 IKQITGAQGFRYFKEDIEERVKL-----RSQGFVSSVIFRTFII 171
              +   +G R   +DI   +            V  V+F +F++
Sbjct: 101 PADLATVEGKRKLADDIRNAINQPFATGLPPQRVLDVLFTSFVV 144


>gi|15802379|ref|NP_288405.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 EDL933]
 gi|15831937|ref|NP_310710.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. Sakai]
 gi|16129891|ref|NP_416454.1| flagellar biosynthesis protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|24113319|ref|NP_707829.1| flagellar basal body-associated protein FliL [Shigella flexneri 2a
           str. 301]
 gi|26248213|ref|NP_754253.1| flagellar basal body-associated protein FliL [Escherichia coli
           CFT073]
 gi|30063383|ref|NP_837554.1| flagellar basal body-associated protein FliL [Shigella flexneri 2a
           str. 2457T]
 gi|89108776|ref|AP_002556.1| flagellar biosynthesis protein [Escherichia coli str. K-12 substr.
           W3110]
 gi|91211162|ref|YP_541148.1| flagellar basal body-associated protein FliL [Escherichia coli
           UTI89]
 gi|110805913|ref|YP_689433.1| flagellar basal body-associated protein FliL [Shigella flexneri 5
           str. 8401]
 gi|117624084|ref|YP_852997.1| flagellar basal body-associated protein FliL [Escherichia coli APEC
           O1]
 gi|168751873|ref|ZP_02776895.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4113]
 gi|168758258|ref|ZP_02783265.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4401]
 gi|168764430|ref|ZP_02789437.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4501]
 gi|168771551|ref|ZP_02796558.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4486]
 gi|168777371|ref|ZP_02802378.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4196]
 gi|168783341|ref|ZP_02808348.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4076]
 gi|168790296|ref|ZP_02815303.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC869]
 gi|168802291|ref|ZP_02827298.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC508]
 gi|170019723|ref|YP_001724677.1| flagellar basal body-associated protein FliL [Escherichia coli ATCC
           8739]
 gi|170081588|ref|YP_001730908.1| flagellar biosynthesis protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170682191|ref|YP_001743301.1| flagellar basal body-associated protein FliL [Escherichia coli
           SMS-3-5]
 gi|188494726|ref|ZP_03001996.1| flagellar basal body-associated protein FliL [Escherichia coli
           53638]
 gi|193071133|ref|ZP_03052057.1| flagellar basal body-associated protein FliL [Escherichia coli
           E110019]
 gi|194439583|ref|ZP_03071656.1| flagellar basal body-associated protein FliL [Escherichia coli
           101-1]
 gi|195939250|ref|ZP_03084632.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4024]
 gi|208810459|ref|ZP_03252335.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4206]
 gi|208816536|ref|ZP_03257656.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4045]
 gi|208818361|ref|ZP_03258681.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4042]
 gi|209399307|ref|YP_002271060.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4115]
 gi|215487144|ref|YP_002329575.1| flagellar basal body-associated protein FliL [Escherichia coli
           O127:H6 str. E2348/69]
 gi|217328709|ref|ZP_03444790.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. TW14588]
 gi|218554524|ref|YP_002387437.1| flagellar basal body-associated protein FliL [Escherichia coli
           IAI1]
 gi|218558801|ref|YP_002391714.1| flagellar basal body-associated protein FliL [Escherichia coli S88]
 gi|218695549|ref|YP_002403216.1| flagellar basal body-associated protein FliL [Escherichia coli
           55989]
 gi|218699495|ref|YP_002407124.1| flagellar basal body-associated protein FliL [Escherichia coli
           IAI39]
 gi|227885627|ref|ZP_04003432.1| flagellar basal body-associated protein FliL [Escherichia coli
           83972]
 gi|237705903|ref|ZP_04536384.1| flagellar protein FliL [Escherichia sp. 3_2_53FAA]
 gi|238901149|ref|YP_002926945.1| flagellar biosynthesis protein [Escherichia coli BW2952]
 gi|253773107|ref|YP_003035938.1| flagellar basal body-associated protein FliL [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254793594|ref|YP_003078431.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. TW14359]
 gi|256022398|ref|ZP_05436263.1| flagellar basal body-associated protein FliL [Escherichia sp.
           4_1_40B]
 gi|260855919|ref|YP_003229810.1| flagellar biosynthesis protein FliL [Escherichia coli O26:H11 str.
           11368]
 gi|261227561|ref|ZP_05941842.1| flagellar biosynthesis protein [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254615|ref|ZP_05947148.1| flagellar biosynthesis protein FliL [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283121|ref|YP_003499939.1| Flagellar fliL protein [Escherichia coli O55:H7 str. CB9615]
 gi|293415254|ref|ZP_06657897.1| flagellar basal body-associated protein FliL [Escherichia coli
           B185]
 gi|293446324|ref|ZP_06662746.1| flagellar basal body-associated protein FliL [Escherichia coli
           B088]
 gi|300818636|ref|ZP_07098844.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           107-1]
 gi|300904834|ref|ZP_07122660.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           84-1]
 gi|300923893|ref|ZP_07139908.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           182-1]
 gi|300931157|ref|ZP_07146504.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           187-1]
 gi|300940399|ref|ZP_07154984.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           21-1]
 gi|300951569|ref|ZP_07165402.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           116-1]
 gi|300956540|ref|ZP_07168822.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           175-1]
 gi|300975542|ref|ZP_07173053.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           45-1]
 gi|301050696|ref|ZP_07197557.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           185-1]
 gi|301305287|ref|ZP_07211384.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           124-1]
 gi|301644597|ref|ZP_07244586.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           146-1]
 gi|306814233|ref|ZP_07448399.1| flagellar basal body-associated protein FliL [Escherichia coli
           NC101]
 gi|307138611|ref|ZP_07497967.1| flagellar basal body-associated protein FliL [Escherichia coli
           H736]
 gi|309795949|ref|ZP_07690362.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           145-7]
 gi|312967141|ref|ZP_07781359.1| flagellar fliL protein [Escherichia coli 2362-75]
 gi|312973839|ref|ZP_07788011.1| flagellar fliL protein [Escherichia coli 1827-70]
 gi|331642565|ref|ZP_08343700.1| flagellar basal body-associated protein FliL [Escherichia coli
           H736]
 gi|331647538|ref|ZP_08348630.1| flagellar basal body-associated protein FliL [Escherichia coli
           M605]
 gi|331653356|ref|ZP_08354361.1| flagellar basal body-associated protein FliL [Escherichia coli
           M718]
 gi|331657990|ref|ZP_08358952.1| flagellar basal body-associated protein FliL [Escherichia coli
           TA206]
 gi|331683496|ref|ZP_08384097.1| flagellar basal body-associated protein FliL [Escherichia coli
           H299]
 gi|78100024|sp|P0ABY0|FLIL_ECO57 RecName: Full=Flagellar protein FliL
 gi|78100025|sp|P0ABX9|FLIL_ECOL6 RecName: Full=Flagellar protein FliL
 gi|78100026|sp|P0ABX8|FLIL_ECOLI RecName: Full=Flagellar protein FliL
 gi|78100027|sp|P0ABY1|FLIL_SHIFL RecName: Full=Flagellar protein FliL
 gi|12516051|gb|AAG56959.1|AE005417_1 flagellar biosynthesis [Escherichia coli O157:H7 str. EDL933]
 gi|26108617|gb|AAN80820.1|AE016762_73 Flagellar fliL protein [Escherichia coli CFT073]
 gi|145980|gb|AAA23785.1| FlaAI protein [Escherichia coli]
 gi|1736610|dbj|BAA15769.1| flagellar biosynthesis protein [Escherichia coli str. K12 substr.
           W3110]
 gi|1788254|gb|AAC75011.1| flagellar biosynthesis protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13362151|dbj|BAB36106.1| flagellar protein FliL [Escherichia coli O157:H7 str. Sakai]
 gi|24052330|gb|AAN43536.1| flagellar protein FliL [Shigella flexneri 2a str. 301]
 gi|30041635|gb|AAP17363.1| flagellar protein FliL [Shigella flexneri 2a str. 2457T]
 gi|91072736|gb|ABE07617.1| flagellar assembly protein FliL [Escherichia coli UTI89]
 gi|110615461|gb|ABF04128.1| flagellar protein FliL [Shigella flexneri 5 str. 8401]
 gi|115513208|gb|ABJ01283.1| flagellar protein FliL [Escherichia coli APEC O1]
 gi|169754651|gb|ACA77350.1| flagellar basal body-associated protein FliL [Escherichia coli ATCC
           8739]
 gi|169889423|gb|ACB03130.1| flagellar biosynthesis protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170519909|gb|ACB18087.1| flagellar basal body-associated protein FliL [Escherichia coli
           SMS-3-5]
 gi|187767402|gb|EDU31246.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4196]
 gi|188014159|gb|EDU52281.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4113]
 gi|188489925|gb|EDU65028.1| flagellar basal body-associated protein FliL [Escherichia coli
           53638]
 gi|188999251|gb|EDU68237.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4076]
 gi|189354921|gb|EDU73340.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4401]
 gi|189359727|gb|EDU78146.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4486]
 gi|189365540|gb|EDU83956.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4501]
 gi|189370197|gb|EDU88613.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC869]
 gi|189375721|gb|EDU94137.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC508]
 gi|192955528|gb|EDV86007.1| flagellar basal body-associated protein FliL [Escherichia coli
           E110019]
 gi|194421492|gb|EDX37506.1| flagellar basal body-associated protein FliL [Escherichia coli
           101-1]
 gi|208724975|gb|EDZ74682.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4206]
 gi|208730879|gb|EDZ79568.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4045]
 gi|208738484|gb|EDZ86166.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4042]
 gi|209160707|gb|ACI38140.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. EC4115]
 gi|209766828|gb|ACI81726.1| flagellar protein FliL [Escherichia coli]
 gi|209766830|gb|ACI81727.1| flagellar protein FliL [Escherichia coli]
 gi|209766832|gb|ACI81728.1| flagellar protein FliL [Escherichia coli]
 gi|209766834|gb|ACI81729.1| flagellar protein FliL [Escherichia coli]
 gi|209766836|gb|ACI81730.1| flagellar protein FliL [Escherichia coli]
 gi|215265216|emb|CAS09606.1| flagellar biosynthesis protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217318056|gb|EEC26483.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. TW14588]
 gi|218352281|emb|CAU98038.1| flagellar biosynthesis protein [Escherichia coli 55989]
 gi|218361292|emb|CAQ98876.1| flagellar biosynthesis protein [Escherichia coli IAI1]
 gi|218365570|emb|CAR03297.1| flagellar biosynthesis protein [Escherichia coli S88]
 gi|218369481|emb|CAR17246.1| flagellar biosynthesis protein [Escherichia coli IAI39]
 gi|222033683|emb|CAP76424.1| flagellar fliL protein [Escherichia coli LF82]
 gi|226900660|gb|EEH86919.1| flagellar protein FliL [Escherichia sp. 3_2_53FAA]
 gi|227837200|gb|EEJ47666.1| flagellar basal body-associated protein FliL [Escherichia coli
           83972]
 gi|238861096|gb|ACR63094.1| flagellar biosynthesis protein [Escherichia coli BW2952]
 gi|253324151|gb|ACT28753.1| flagellar basal body-associated protein FliL [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254592994|gb|ACT72355.1| flagellar biosynthesis protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|257754568|dbj|BAI26070.1| flagellar biosynthesis protein FliL [Escherichia coli O26:H11 str.
           11368]
 gi|260448943|gb|ACX39365.1| flagellar basal body-associated protein FliL [Escherichia coli DH1]
 gi|281179006|dbj|BAI55336.1| flagellar protein FliL [Escherichia coli SE15]
 gi|281601384|gb|ADA74368.1| putative Flagellar basal body-associated protein [Shigella flexneri
           2002017]
 gi|290762994|gb|ADD56955.1| Flagellar fliL protein [Escherichia coli O55:H7 str. CB9615]
 gi|291323154|gb|EFE62582.1| flagellar basal body-associated protein FliL [Escherichia coli
           B088]
 gi|291432902|gb|EFF05881.1| flagellar basal body-associated protein FliL [Escherichia coli
           B185]
 gi|294492224|gb|ADE90980.1| flagellar basal body-associated protein FliL [Escherichia coli
           IHE3034]
 gi|300297619|gb|EFJ54004.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           185-1]
 gi|300316640|gb|EFJ66424.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           175-1]
 gi|300403261|gb|EFJ86799.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           84-1]
 gi|300410311|gb|EFJ93849.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           45-1]
 gi|300419856|gb|EFK03167.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           182-1]
 gi|300449196|gb|EFK12816.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           116-1]
 gi|300454793|gb|EFK18286.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           21-1]
 gi|300461014|gb|EFK24507.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           187-1]
 gi|300528808|gb|EFK49870.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           107-1]
 gi|300839493|gb|EFK67253.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           124-1]
 gi|301077072|gb|EFK91878.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           146-1]
 gi|305852392|gb|EFM52843.1| flagellar basal body-associated protein FliL [Escherichia coli
           NC101]
 gi|307553957|gb|ADN46732.1| flagellar basal body-associated protein FliL [Escherichia coli ABU
           83972]
 gi|307626580|gb|ADN70884.1| flagellar basal body-associated protein FliL [Escherichia coli
           UM146]
 gi|308120399|gb|EFO57661.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           145-7]
 gi|310332434|gb|EFP99669.1| flagellar fliL protein [Escherichia coli 1827-70]
 gi|312288605|gb|EFR16507.1| flagellar fliL protein [Escherichia coli 2362-75]
 gi|312946537|gb|ADR27364.1| flagellar basal body-associated protein FliL [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|313650166|gb|EFS14579.1| flagellar fliL protein [Shigella flexneri 2a str. 2457T]
 gi|315136581|dbj|BAJ43740.1| flagellar fliL protein [Escherichia coli DH1]
 gi|315257224|gb|EFU37192.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           85-1]
 gi|315286660|gb|EFU46093.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           110-3]
 gi|315290261|gb|EFU49639.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           153-1]
 gi|315296478|gb|EFU55775.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           16-3]
 gi|320175466|gb|EFW50565.1| Flagellar biosynthesis protein FliL [Shigella dysenteriae CDC
           74-1112]
 gi|320191918|gb|EFW66565.1| Flagellar biosynthesis protein FliL [Escherichia coli O157:H7 str.
           EC1212]
 gi|320194343|gb|EFW68974.1| Flagellar biosynthesis protein FliL [Escherichia coli WV_060327]
 gi|320641792|gb|EFX11180.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. G5101]
 gi|320647151|gb|EFX15984.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H- str. 493-89]
 gi|320652435|gb|EFX20733.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H- str. H 2687]
 gi|320658037|gb|EFX25799.1| flagellar basal body-associated protein FliL [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320658609|gb|EFX26303.1| flagellar basal body-associated protein FliL [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320668507|gb|EFX35334.1| flagellar basal body-associated protein FliL [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323152725|gb|EFZ38997.1| flagellar fliL protein [Escherichia coli EPECa14]
 gi|323174677|gb|EFZ60297.1| flagellar fliL protein [Escherichia coli LT-68]
 gi|323183928|gb|EFZ69315.1| flagellar fliL protein [Escherichia coli 1357]
 gi|323186820|gb|EFZ72140.1| flagellar fliL protein [Escherichia coli RN587/1]
 gi|323940397|gb|EGB36588.1| flagellar basal body protein FliL [Escherichia coli E482]
 gi|323948352|gb|EGB44339.1| flagellar basal body-associated protein FliL [Escherichia coli
           H120]
 gi|323952437|gb|EGB48310.1| flagellar basal body protein FliL [Escherichia coli H252]
 gi|323956340|gb|EGB52083.1| flagellar basal body protein FliL [Escherichia coli H263]
 gi|323961988|gb|EGB57587.1| flagellar basal body protein FliL [Escherichia coli H489]
 gi|323972756|gb|EGB67956.1| flagellar basal body protein FliL [Escherichia coli TA007]
 gi|324005857|gb|EGB75076.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           57-2]
 gi|324018853|gb|EGB88072.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           117-3]
 gi|326342354|gb|EGD66135.1| Flagellar biosynthesis protein FliL [Escherichia coli O157:H7 str.
           1044]
 gi|326344859|gb|EGD68606.1| Flagellar biosynthesis protein FliL [Escherichia coli O157:H7 str.
           1125]
 gi|330911750|gb|EGH40260.1| flagellar biosynthesis protein FliL [Escherichia coli AA86]
 gi|331039363|gb|EGI11583.1| flagellar basal body-associated protein FliL [Escherichia coli
           H736]
 gi|331043262|gb|EGI15400.1| flagellar basal body-associated protein FliL [Escherichia coli
           M605]
 gi|331049454|gb|EGI21526.1| flagellar basal body-associated protein FliL [Escherichia coli
           M718]
 gi|331056238|gb|EGI28247.1| flagellar basal body-associated protein FliL [Escherichia coli
           TA206]
 gi|331079711|gb|EGI50908.1| flagellar basal body-associated protein FliL [Escherichia coli
           H299]
 gi|332093099|gb|EGI98163.1| flagellar fliL protein [Shigella boydii 5216-82]
 gi|332343670|gb|AEE57004.1| flagellar protein FliL [Escherichia coli UMNK88]
 gi|332756100|gb|EGJ86453.1| flagellar fliL protein [Shigella flexneri 4343-70]
 gi|332757263|gb|EGJ87600.1| flagellar fliL protein [Shigella flexneri 2747-71]
 gi|332757510|gb|EGJ87845.1| flagellar fliL protein [Shigella flexneri K-671]
 gi|332766682|gb|EGJ96886.1| flagellar basal body-associated FliL family protein [Shigella
           flexneri 2930-71]
 gi|333003040|gb|EGK22594.1| flagellar fliL protein [Shigella flexneri VA-6]
 gi|333003274|gb|EGK22820.1| flagellar fliL protein [Shigella flexneri K-218]
 gi|333017678|gb|EGK36990.1| flagellar fliL protein [Shigella flexneri K-304]
          Length = 154

 Score = 69.4 bits (168), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 49/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A  K ++             
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|325920568|ref|ZP_08182490.1| flagellar basal body-associated protein [Xanthomonas gardneri ATCC
           19865]
 gi|325548961|gb|EGD19893.1| flagellar basal body-associated protein [Xanthomonas gardneri ATCC
           19865]
          Length = 183

 Score = 69.4 bits (168), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 13/164 (7%), Positives = 40/164 (24%), Gaps = 29/164 (17%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +   VV         W                                +      +  
Sbjct: 36  LLIAIGVVVLAAAGGGAWFFFGH------------------KGDEKGGKHAAPKVAEVPK 77

Query: 78  KKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPDKVFL----ETLHQDIMAYIRTV 131
                     I+ N         +L++++ L+ +D  +   +      +   ++  +   
Sbjct: 78  PAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQT 137

Query: 132 SIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +    G +  ++      +        +  V  ++F +F+
Sbjct: 138 KATDVADLVGKQKLQKAALVEAQKVMTSETGKKCVEELLFTSFV 181


>gi|307131595|ref|YP_003883611.1| flagellar biosynthesis protein fliL [Dickeya dadantii 3937]
 gi|306529124|gb|ADM99054.1| Flagellar biosynthesis protein fliL [Dickeya dadantii 3937]
          Length = 162

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/183 (15%), Positives = 55/183 (30%), Gaps = 34/183 (18%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  +Q   GN+  L++   +V           G  ++                   
Sbjct: 1   MATSNKKAQSG-GNKRSLWLILLIVIALAATAAAGAGWWLLS------------------ 41

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF---DSSPKDWLRLDIALICKDIPDKVFL 117
              +    +   +           L     N    D++P   L + I L   D   +  L
Sbjct: 42  ---HKKTEMAASEPPPPPAPVFMPLDTFTVNLLSADNNPDRVLYVGITLRLPDEATRARL 98

Query: 118 ----ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGF----VSSVIFRT 168
                 +   ++      S   +   QG +   EDI++ +      G     VS V+F  
Sbjct: 99  TNYLPEIRSRLIMLFSRQSSSVLATEQGKQKLVEDIKQVLSPPLVPGQPNQVVSDVLFTA 158

Query: 169 FII 171
           FI+
Sbjct: 159 FIL 161


>gi|311279114|ref|YP_003941345.1| flagellar basal body-associated protein FliL [Enterobacter cloacae
           SCF1]
 gi|308748309|gb|ADO48061.1| flagellar basal body-associated protein FliL [Enterobacter cloacae
           SCF1]
          Length = 155

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 47/175 (26%), Gaps = 31/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   + ++  +++   V+ T             M                        
Sbjct: 2   TDSAITKKSKRSIWIPLLVLVTLAACATAGYSYWRM---------------------QQQ 40

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
             +    +         ++L     N   +    L + I L  KD         +L  + 
Sbjct: 41  PSASAPKEAPPPPAPVFWALDTFTVNLGDA-DRVLYVGITLRLKDEATRTRLNEYLPEVR 99

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
             ++         Q+    G +   + I+       V  +    V+ V++  FI+
Sbjct: 100 SRLLLLFSRQDAAQLATDAGKQKLVDAIKATLAPPLVTGQPGQQVTDVLYTAFIL 154


>gi|293410300|ref|ZP_06653876.1| flagellar basal body-associated protein FliL [Escherichia coli
           B354]
 gi|291470768|gb|EFF13252.1| flagellar basal body-associated protein FliL [Escherichia coli
           B354]
          Length = 154

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 48/175 (27%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                                  + + 
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYW----------------------HSHQ 39

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
           V +        +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 40  VAAEDKAQQRVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKKLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|300920163|ref|ZP_07136613.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           115-1]
 gi|300412820|gb|EFJ96130.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           115-1]
          Length = 154

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 49/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A  K ++             
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDATVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|90406813|ref|ZP_01215005.1| flagellar basal body-associated protein [Psychromonas sp. CNPT3]
 gi|90312050|gb|EAS40143.1| flagellar basal body-associated protein [Psychromonas sp. CNPT3]
          Length = 173

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/184 (11%), Positives = 62/184 (33%), Gaps = 25/184 (13%)

Query: 1   MSYDDTT---SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ D+         +G   K  +   V    +    G      +       + E   + +
Sbjct: 1   MADDNNDISVDGESQGGGKKKLIIMIVALLLLLGGGGAGAYFFLFSDNESVETEAITEEV 60

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITN-FDSSPKDWLRLDIALICKDIPD--- 113
                        T    +L+ + +   +P + N  +      +++ + L+ +   +   
Sbjct: 61  ------------STEIDETLQAIYVAMPRPFVFNVMEGKRDRLVQIKVQLMVRGDENQTL 108

Query: 114 -KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFR 167
            K  +  L   ++      ++ Q+   +G    ++   E +   +     +G +++V+F 
Sbjct: 109 AKKHIPLLEGTLVRIFGAATVGQLRSPEGKEELRKFALEALNKETMKVEDKGLINAVLFT 168

Query: 168 TFII 171
            F++
Sbjct: 169 GFVL 172


>gi|301029401|ref|ZP_07192495.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           196-1]
 gi|299877705|gb|EFI85916.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           196-1]
          Length = 154

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 50/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A +K ++             
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADEKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|209695734|ref|YP_002263664.1| flagellar basal body-associated protein FliL [Aliivibrio
           salmonicida LFI1238]
 gi|208009687|emb|CAQ79986.1| polar flagellar protein FliL [Aliivibrio salmonicida LFI1238]
          Length = 161

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/181 (8%), Positives = 53/181 (29%), Gaps = 31/181 (17%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+                 +    +   + +  G      M      +  E     +   
Sbjct: 1   MAEQGDAP-----KSKNKMMFVIALLVLLLVVGGVGAWFFMSGESKPEPTEHDIAALEAK 55

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKV---- 115
                           +  L +   QP I N     +   ++L + ++ +   ++     
Sbjct: 56  ----------------MPALYLNLPQPFIFNVAGDKRDRLVQLKVQVMMRGSDNEAIAKQ 99

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
               +   +++     +++Q+   +G    +E     ++     + ++  +  V+F  F+
Sbjct: 100 HTPLVESTLLSTFAAATVEQLREPRGRIELREQATRDIQDAFTKITAKPVIEKVLFTDFV 159

Query: 171 I 171
           +
Sbjct: 160 M 160


>gi|78047548|ref|YP_363723.1| flagellar basal body-associated protein FliL [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|78035978|emb|CAJ23669.1| flagellar basal body-associated protein FliL [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
          Length = 183

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/164 (8%), Positives = 41/164 (25%), Gaps = 29/164 (17%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +   VV         W                                       +  
Sbjct: 36  LLIAIGVVVLAAAGGGAWFF------------------LGHKGEEKGGKHDAPKVAEVPK 77

Query: 78  KKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPDKVFL----ETLHQDIMAYIRTV 131
                     I+ N         +L++++ L+ +D  +   +      +   ++  +  V
Sbjct: 78  PAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQV 137

Query: 132 SIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
              ++    G +  ++      +        +  V  ++F +F+
Sbjct: 138 KAAEVADLAGKQKLQKSALAEAQKVMTSETGKKCVEELLFTSFV 181


>gi|157161415|ref|YP_001458733.1| flagellar basal body-associated protein FliL [Escherichia coli HS]
 gi|157067095|gb|ABV06350.1| flagellar basal body-associated protein FliL [Escherichia coli HS]
          Length = 154

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 49/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A  K ++             
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLITEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|74317624|ref|YP_315364.1| flagellar basal body-associated protein FliL [Thiobacillus
           denitrificans ATCC 25259]
 gi|74057119|gb|AAZ97559.1| probable flagellar transmembrane protein FliL [Thiobacillus
           denitrificans ATCC 25259]
          Length = 158

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 55/182 (30%), Gaps = 36/182 (19%)

Query: 1   MSY--DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+   +   +   + ++ KLFV    +   +G                  +         
Sbjct: 1   MAEPAESAETPAPKKSKKKLFVLVGALVILLGAGGAGAWYFTRDTGAGKPEAAAP----- 55

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----IPDK 114
                              K     +L     N     + +L+LDI L   D       K
Sbjct: 56  -------------------KVPVFLALDTFTVNLQD-GEQYLQLDITLQVADQAQIDAIK 95

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTF 169
           + +  +   +++ + +    ++   +  +    +I  +VK   +       +  V+F +F
Sbjct: 96  LHMPRVRSRLLSLLSSKHPDELMSPEDKKKLTAEILAQVKQPFEPKGKPQQIEDVLFTSF 155

Query: 170 II 171
           +I
Sbjct: 156 VI 157


>gi|21231368|ref|NP_637285.1| flagellar biosynthesis protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768579|ref|YP_243341.1| flagellar biosynthesis protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188991611|ref|YP_001903621.1| Flagellar fliL protein. [Xanthomonas campestris pv. campestris str.
           B100]
 gi|21113031|gb|AAM41209.1| flagellar biosynthesis protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573911|gb|AAY49321.1| flagellar biosynthesis protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167733371|emb|CAP51572.1| Flagellar fliL protein [Xanthomonas campestris pv. campestris]
          Length = 172

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/164 (8%), Positives = 42/164 (25%), Gaps = 29/164 (17%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +   VV         W                            +   +      +  
Sbjct: 25  LLIAIGVVVLAAAGGGAWFF------------------LGHKGEEKDGKHAAPKVAEVPK 66

Query: 78  KKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPDKVFL----ETLHQDIMAYIRTV 131
                     I+ N         +L++++ L+ +D  +   +      +   ++  +  V
Sbjct: 67  PAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQV 126

Query: 132 SIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +    G +  ++      +        +  V  ++F +F+
Sbjct: 127 KAADVADLPGKQKLQKSALAEAQKVMTSETGKKCVEELLFTSFV 170


>gi|218689939|ref|YP_002398151.1| flagellar basal body-associated protein FliL [Escherichia coli
           ED1a]
 gi|218427503|emb|CAR08398.2| flagellar biosynthesis protein [Escherichia coli ED1a]
          Length = 154

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/175 (12%), Positives = 49/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A  K ++             
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    VS V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVSDVLYTAFIL 153


>gi|82543594|ref|YP_407541.1| flagellar basal body-associated protein FliL [Shigella boydii
           Sb227]
 gi|81245005|gb|ABB65713.1| flagellar biosynthesis [Shigella boydii Sb227]
 gi|320184482|gb|EFW59286.1| Flagellar biosynthesis protein FliL [Shigella flexneri CDC 796-83]
 gi|332096885|gb|EGJ01874.1| flagellar fliL protein [Shigella boydii 3594-74]
          Length = 154

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 49/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A  K ++             
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALNTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|218705437|ref|YP_002412956.1| flagellar basal body-associated protein FliL [Escherichia coli
           UMN026]
 gi|293405427|ref|ZP_06649419.1| fliL [Escherichia coli FVEC1412]
 gi|298381071|ref|ZP_06990670.1| flagellar fliL protein [Escherichia coli FVEC1302]
 gi|300899201|ref|ZP_07117477.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           198-1]
 gi|301018206|ref|ZP_07182721.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           69-1]
 gi|218432534|emb|CAR13427.1| flagellar biosynthesis protein [Escherichia coli UMN026]
 gi|284921852|emb|CBG34927.1| flagellar protein FliL [Escherichia coli 042]
 gi|291427635|gb|EFF00662.1| fliL [Escherichia coli FVEC1412]
 gi|298278513|gb|EFI20027.1| flagellar fliL protein [Escherichia coli FVEC1302]
 gi|300357182|gb|EFJ73052.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           198-1]
 gi|300399793|gb|EFJ83331.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           69-1]
 gi|320182739|gb|EFW57623.1| Flagellar biosynthesis protein FliL [Shigella boydii ATCC 9905]
          Length = 154

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 48/175 (27%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                                  + + 
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYW----------------------HSHQ 39

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
           V +        +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 40  VAAEDKAQQRVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|154253005|ref|YP_001413829.1| flagellar basal body-associated protein FliL [Parvibaculum
           lavamentivorans DS-1]
 gi|154156955|gb|ABS64172.1| flagellar basal body-associated protein FliL [Parvibaculum
           lavamentivorans DS-1]
          Length = 167

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/175 (16%), Positives = 61/175 (34%), Gaps = 25/175 (14%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            ++  S      +    V    V   + +  G   G+ M  +  G  EE++         
Sbjct: 11  DEEDASAPPAKRRLAGKVLVLYVVLPVLLLVGAGVGVYMSGILGGTSEEEHAVVAA---- 66

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIP----DKVFL 117
                               + L   + N    P + +L+L +AL           +  +
Sbjct: 67  ---------------PAPVFYDLPDFLVNLSGPPPQHYLKLRVALEVPSKETVARLEAEM 111

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
             +      ++R +  + + G+QG    KE++  R+ L + +  V+ V+F+  I+
Sbjct: 112 PRVLDGFQTFLRELRPEDLEGSQGMLNLKEELMRRLALATQEPLVTDVLFKEIIV 166


>gi|170769447|ref|ZP_02903900.1| flagellar basal body-associated protein FliL [Escherichia albertii
           TW07627]
 gi|170121771|gb|EDS90702.1| flagellar basal body-associated protein FliL [Escherichia albertii
           TW07627]
          Length = 154

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 45/175 (25%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                  A  K ++             
Sbjct: 2   TDYAISKKSKRSLWLPILVFITLAACASAGYSYWHSHQAVADDKAQQRAA---------- 51

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                            ++L     N   +    L + I L  KD         +L  + 
Sbjct: 52  ------------PSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +    G +     I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEPGKQQLIATIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|238025646|ref|YP_002909878.1| Flagellar protein FliL [Burkholderia glumae BGR1]
 gi|237880311|gb|ACR32642.1| Flagellar protein FliL [Burkholderia glumae BGR1]
          Length = 166

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 15/118 (12%), Positives = 36/118 (30%), Gaps = 10/118 (8%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLE 118
             +          L     F + P+  N  S  +  ++R+ I L   D          + 
Sbjct: 48  EGMVEAAKVGPPPLSTPVYFPMDPMTVNLQSDDEMHYVRIGITLKLTDPSAQDYLTQHMP 107

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
            +   I+  +     + +  +   R     +   ++  +Q       V  V+   F++
Sbjct: 108 EIRSRILMALSNKHPQDLATSDDKRQLVAQLRALIERPTQPGNRSARVDQVLITDFVL 165


>gi|157158713|ref|YP_001463246.1| flagellar basal body-associated protein FliL [Escherichia coli
           E24377A]
 gi|157080743|gb|ABV20451.1| flagellar basal body-associated protein FliL [Escherichia coli
           E24377A]
          Length = 154

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 49/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A  K ++             
Sbjct: 2   TDYAISKKSKRSLWIQILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|126665009|ref|ZP_01735992.1| Flagellar basal body-associated protein [Marinobacter sp. ELB17]
 gi|126630379|gb|EBA00994.1| Flagellar basal body-associated protein [Marinobacter sp. ELB17]
          Length = 169

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/180 (9%), Positives = 55/180 (30%), Gaps = 21/180 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ + +  + +                 + I     G +  +                  
Sbjct: 1   MAENTSADEPVAKKSKLKLFVLLGFLILLAIGLAVAGALWFMNGSLPGM----------- 49

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD----KV 115
              +        +   L  + +   +P++T   +  +  + ++ ++L  +        KV
Sbjct: 50  -GGDETADEQVQEPEFLPSVYLDLEKPLLTTVQAEGRQRYAQVHVSLEAESQAVLDAAKV 108

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF----VSSVIFRTFII 171
            L  L   ++  + + S   +   +G +   + + ++V           +  V+F  F++
Sbjct: 109 HLPLLRSQLIQLMGSRSFNSLRALEGRQELAQAMTDKVNELLANENAAAIRQVLFSNFVV 168


>gi|114570495|ref|YP_757175.1| flagellar basal body-associated protein FliL [Maricaulis maris
           MCS10]
 gi|114340957|gb|ABI66237.1| flagellar basal body-associated protein FliL [Maricaulis maris
           MCS10]
          Length = 196

 Score = 68.7 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/176 (11%), Positives = 53/176 (30%), Gaps = 7/176 (3%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            D    +  + N  KL +   +    + +       +        ++          + +
Sbjct: 19  DDAEGEEAPKKNPLKLVLFIGLPVLILLLAGVGGFMMFAGGGDDEEQHADAGHGEDADGH 78

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICK----DIPDKVF 116
             +             +    + + I TN  S       ++L I+            +  
Sbjct: 79  GAADSHATDEVYYYDLREGDGTEETITTNIRSVTGRPVIVQLKISFESSRSDLGPILEEH 138

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
            + +    + ++R +    + G+ G    K ++  RV L      + +V  + F+I
Sbjct: 139 YDPVMDQFIMFLRELREDDLYGSAGMHRVKLELLRRVNLAIEPDQIDAVWIQEFMI 194


>gi|225620316|ref|YP_002721573.1| putative flagellar basal body-associated protein [Brachyspira
           hyodysenteriae WA1]
 gi|225215135|gb|ACN83869.1| putative flagellar basal body-associated protein [Brachyspira
           hyodysenteriae WA1]
          Length = 181

 Score = 68.7 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/172 (10%), Positives = 46/172 (26%), Gaps = 20/172 (11%)

Query: 9   QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRS 68
              +     + V   +    I +     G I      +  K    Q  ++++        
Sbjct: 22  PKKKFGLSPMIVKILMGIAAILVVALISGLIAFFVSKSVGKAAGVQGGVVDDMVKQP--- 78

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDI------PDKVFLETLH 121
                                 N        ++++ I L                   + 
Sbjct: 79  ---------PPSIYRIDPEFNVNTADMDVARYVKVSIILTYTTNTKQLAVELPERFYMIR 129

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
             I   + + +  Q+   +G    K DI+  +  +   G +  ++F  F+++
Sbjct: 130 DRITTILSSYTYDQLRTNEGREQLKADIKREINSMLRNGQIDGILFDNFLLS 181


>gi|310764882|gb|ADP09832.1| Flagellar basal body-associated protein FliL [Erwinia sp. Ejp617]
          Length = 167

 Score = 68.7 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/178 (12%), Positives = 51/178 (28%), Gaps = 25/178 (14%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           +   +   G   +  V  F+    +         +  +   AGQ  ++            
Sbjct: 3   NKIKKTSGGGSLRTLVFTFMFLVMMATCGIAGYAVWEMSKSAGQSAQQNAGSQAEATVHA 62

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFD---SSPKDWLRLDIALICKDIP----DKVFL 117
                              SL     +     +     L + ++L   D       + +L
Sbjct: 63  E--------------PLYQSLNTFTVSLKPTENENDRVLFIGLSLRMADKQSLLTMEKYL 108

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV----KLRSQGFVSSVIFRTFII 171
                 ++  +   S ++++  +G +   E I+  V           V+ V+F  FI+
Sbjct: 109 PEYRSRLLILLAKSSYEELSTHEGKQLLVEKIKHEVTKPLATNQSVKVADVLFNEFIL 166


>gi|254517013|ref|ZP_05129071.1| flagellar basal body-associated protein FliL [gamma proteobacterium
           NOR5-3]
 gi|219674518|gb|EED30886.1| flagellar basal body-associated protein FliL [gamma proteobacterium
           NOR5-3]
          Length = 171

 Score = 68.7 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 17/177 (9%), Positives = 49/177 (27%), Gaps = 27/177 (15%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           D   ++   G + KL +    V   +G   G    +                        
Sbjct: 12  DAPQAEEKSGGKGKLIIIIVAVVVLLGGGAGAFFFLSG------------------GDEA 53

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD----KVFLE 118
               +V      + K      ++ ++ N +   +  +++ ++ L+             + 
Sbjct: 54  EGEDAVEEVVEEAPKVPLYLDIEKLLVNLEHGGRTRYVQAEMQLMSYKQEAIDQAARDMP 113

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK----LRSQGFVSSVIFRTFII 171
            +   ++          +   +G    + D  + V     L     +  + F  F++
Sbjct: 114 AIRDGLITLFSQQDFAALKTIEGKDALRADALKAVNRALGLTPPDAIEKIYFENFVL 170


>gi|188997538|ref|YP_001931789.1| flagellar basal body-associated protein FliL [Sulfurihydrogenibium
           sp. YO3AOP1]
 gi|188932605|gb|ACD67235.1| flagellar basal body-associated protein FliL [Sulfurihydrogenibium
           sp. YO3AOP1]
          Length = 169

 Score = 68.7 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 39/120 (32%), Gaps = 6/120 (5%)

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIPDK-- 114
                +     +      + ++     +   + N        ++++ I +  +D   K  
Sbjct: 47  AKEEKEKPPEKIANEIKKAEEQGVELEVGTFVANLADKDADRYIKVTIIMEVQDEKVKEE 106

Query: 115 --VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
               +  +   I   + T +  ++   +G    KE+I  R       G V  V F  FII
Sbjct: 107 ATKRMPQIKDAINTLLFTKTSGELKSPEGIEKLKEEIIRRTNAILPLGGVKDVYFTEFII 166


>gi|323968360|gb|EGB63767.1| flagellar basal body protein FliL [Escherichia coli M863]
 gi|327253076|gb|EGE64730.1| flagellar fliL protein [Escherichia coli STEC_7v]
          Length = 154

 Score = 68.7 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 49/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A  K ++             
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKSLIAEIKATLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|191168298|ref|ZP_03030091.1| flagellar basal body-associated protein FliL [Escherichia coli B7A]
 gi|260868537|ref|YP_003234939.1| flagellar biosynthesis protein FliL [Escherichia coli O111:H- str.
           11128]
 gi|307312470|ref|ZP_07592104.1| flagellar basal body-associated protein FliL [Escherichia coli W]
 gi|331668635|ref|ZP_08369483.1| flagellar basal body-associated protein FliL [Escherichia coli
           TA271]
 gi|190901670|gb|EDV61426.1| flagellar basal body-associated protein FliL [Escherichia coli B7A]
 gi|257764893|dbj|BAI36388.1| flagellar biosynthesis protein FliL [Escherichia coli O111:H- str.
           11128]
 gi|306907641|gb|EFN38144.1| flagellar basal body-associated protein FliL [Escherichia coli W]
 gi|315061244|gb|ADT75571.1| flagellar biosynthesis protein [Escherichia coli W]
 gi|323180803|gb|EFZ66343.1| flagellar fliL protein [Escherichia coli 1180]
 gi|323378179|gb|ADX50447.1| flagellar basal body-associated protein FliL [Escherichia coli
           KO11]
 gi|324118993|gb|EGC12882.1| flagellar basal body protein FliL [Escherichia coli E1167]
 gi|331063829|gb|EGI35740.1| flagellar basal body-associated protein FliL [Escherichia coli
           TA271]
          Length = 154

 Score = 68.7 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 48/175 (27%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                                  + + 
Sbjct: 2   TDYAISKKSKRSLWIQILVFITLAACASAGYSYW----------------------HSHQ 39

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
           V +        +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 40  VAAEDKAQQRVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|119469991|ref|ZP_01612796.1| flagellar basal body-associated protein FliL [Alteromonadales
           bacterium TW-7]
 gi|119446701|gb|EAW27974.1| flagellar basal body-associated protein FliL [Alteromonadales
           bacterium TW-7]
          Length = 175

 Score = 68.7 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 17/155 (10%), Positives = 47/155 (30%), Gaps = 14/155 (9%)

Query: 27  TFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQ 86
             + +  G   G  ++        E  +                         L +   +
Sbjct: 24  AAVLLVVGGAAGFFLMSGSD----EPVETLDEETTLSEEAPEASGSSAEIGSALYVAMPR 79

Query: 87  PIITNFDSSPKDW-----LRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQG 141
           P + N   S +D      ++L +     +   K  +  +   +++   T +  +++ + G
Sbjct: 80  PFVFNVPGSSRDRIVQIKVQLLVRGEVNEETAKKHIPLIEGKLLSVFSTTTADELSTSAG 139

Query: 142 FRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
               +    E V+     +     +  V+F  F++
Sbjct: 140 KETLRFSALETVQTALNDVEGSKVIERVLFTGFVM 174


>gi|296531736|ref|ZP_06894562.1| flagellar basal body-associated protein FliL [Roseomonas cervicalis
           ATCC 49957]
 gi|296267935|gb|EFH13736.1| flagellar basal body-associated protein FliL [Roseomonas cervicalis
           ATCC 49957]
          Length = 177

 Score = 68.7 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 39/99 (39%), Gaps = 6/99 (6%)

Query: 80  LQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIK 134
                   +     +  +   LRL IA+     P     ++    ++  ++ Y+RT+   
Sbjct: 79  PSFVEFPEMTLTLPNGGRPRQLRLRIAVEINGDPALLQPELLSPRIYDSLLLYLRTLREG 138

Query: 135 QITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
           ++ GA      + D+  R + L   G V  V+   F++A
Sbjct: 139 EMEGALAMDRLRGDLHRRFELLLGPGKVRDVLITGFVVA 177


>gi|296126962|ref|YP_003634214.1| flagellar basal body-associated protein FliL [Brachyspira murdochii
           DSM 12563]
 gi|296018778|gb|ADG72015.1| flagellar basal body-associated protein FliL [Brachyspira murdochii
           DSM 12563]
          Length = 182

 Score = 68.7 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/172 (10%), Positives = 46/172 (26%), Gaps = 20/172 (11%)

Query: 9   QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRS 68
              +     + V   +    I +     G I      +  K    Q  ++++        
Sbjct: 23  PKKKFGLSPMIVKILMGVAAILVVALISGLIAFFVSKSVGKAAGVQGGVVDDMVKQP--- 79

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDI------PDKVFLETLH 121
                                 N        ++++ I L                   + 
Sbjct: 80  ---------PPSIYRIDPEFNVNTADMDVARYVKVSIILTYTTNVKQLAVELPERFYMIR 130

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
             I   + + +  Q+   +G    K DI+  +  +   G +  ++F  F+++
Sbjct: 131 DRITTILSSYTYDQLRTNEGREQLKADIKREINSMLRNGQIDGILFDNFLLS 182


>gi|167560936|ref|ZP_02353852.1| flagellar basal body-associated protein FliL [Burkholderia
           oklahomensis EO147]
 gi|167568196|ref|ZP_02361070.1| flagellar basal body-associated protein FliL [Burkholderia
           oklahomensis C6786]
          Length = 166

 Score = 68.7 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 46/121 (38%), Gaps = 11/121 (9%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPDKV---- 115
               VR         L     F+L+P+  N  S      +LR+ ++L   D   +     
Sbjct: 45  AKEGVRGAAPSAPAPLAVPVFFALEPLTVNLQSDDGIQHYLRVGLSLKLTDAKAQEYLTQ 104

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFI 170
            +  L   I+  +     +Q+   +G R   ++++  ++  +Q       +  V+F  F+
Sbjct: 105 HMPELRSRILLALSNKHPEQLATLEGKRALADELKTLIEQPTQPGNRSARIDDVLFTEFV 164

Query: 171 I 171
           +
Sbjct: 165 V 165


>gi|259907612|ref|YP_002647968.1| Flagellar basal body-associated protein FliL [Erwinia pyrifoliae
           Ep1/96]
 gi|224963234|emb|CAX54718.1| Flagellar basal body-associated protein FliL [Erwinia pyrifoliae
           Ep1/96]
 gi|283477454|emb|CAY73370.1| Flagellar FliL protein [Erwinia pyrifoliae DSM 12163]
          Length = 167

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 23/178 (12%), Positives = 50/178 (28%), Gaps = 25/178 (14%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           +   +   G   +  V  F+    +         +  +   AGQ  ++            
Sbjct: 3   NKIKKTSGGGSLRTLVFTFMFLVMMATCGIAGYAVWEMSKSAGQSAQQNAGLQAEATVHA 62

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFD---SSPKDWLRLDIALICKDIP----DKVFL 117
                              SL     +     +     L + ++L   D       + FL
Sbjct: 63  D--------------PLYQSLNTFTVSLKPTENENDRVLFVGLSLRMADKQSLLTIEKFL 108

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV----KLRSQGFVSSVIFRTFII 171
                 ++  +   S +++   +G +   E I+  V           V+ V+F  FI+
Sbjct: 109 PEYRSRLLILLAKSSYEELATHEGKQLLVEKIKHEVTKPLAANQSVKVADVLFNEFIL 166


>gi|212634373|ref|YP_002310898.1| flagellar basal body-associated protein FliL [Shewanella
           piezotolerans WP3]
 gi|212555857|gb|ACJ28311.1| Flagellar basal body-associated protein FliL [Shewanella
           piezotolerans WP3]
          Length = 172

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 12/168 (7%), Positives = 47/168 (27%), Gaps = 22/168 (13%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
              K  + +  +   + +       +++                                
Sbjct: 16  KSKKKLILFGSIAAVLIVIIAATLWLLLSGD------------ETAAENSGGEAVAEVKA 63

Query: 74  TISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD----KVFLETLHQDIMAYI 128
           +   +       +P + N   + +   + + + L+ +   D    K  +  +   ++   
Sbjct: 64  SDKREAFYAAMPRPFLFNLPGNGRTRLVEIKVQLMVRGKDDDVLIKKHIPLIEDALLTTF 123

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
               +++++   G    +      V+     +  +  V  V+F  F++
Sbjct: 124 SGADVQKLSTLAGKDELRLLALLNVQNTLQPIIGRKVVEKVLFTGFVM 171


>gi|323527698|ref|YP_004229851.1| flagellar basal body-associated protein FliL [Burkholderia sp.
           CCGE1001]
 gi|323384700|gb|ADX56791.1| flagellar basal body-associated protein FliL [Burkholderia sp.
           CCGE1001]
          Length = 164

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 14/101 (13%), Positives = 33/101 (32%), Gaps = 11/101 (10%)

Query: 82  IFSLQPIITNFDSSPK--DWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQ 135
            F L  +  N  S      +LR+ + L   D          +  +   I+  +      +
Sbjct: 63  FFPLDSMTVNLQSDDGQQHFLRIGLTLKLTDPKTPQELTEHMPEIRSRILLALSNHHPDE 122

Query: 136 ITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
           +   +G      ++   ++  +        V  V+F  F++
Sbjct: 123 LAPLEGKHALATELRTLIEQPTDKGAAPIHVQDVLFTEFVV 163


>gi|300693353|ref|YP_003749326.1| flagellar basal body-associated protein flil [Ralstonia
           solanacearum PSI07]
 gi|299075390|emb|CBJ34685.1| Flagellar basal body-associated protein FliL [Ralstonia
           solanacearum PSI07]
          Length = 163

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 53/181 (29%), Gaps = 34/181 (18%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +   +     +G   KL +   +V   +G+        +     A               
Sbjct: 5   AAATSVPAPAKGGSTKLLLIILIVLVLVGMGGAAAWFFLGGGSHAAASA----------- 53

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFD--SSPKDWLRLDIALICKD----IPDKV 115
                           K+     ++ +  N         +L++ I     D       K 
Sbjct: 54  ------------PPKPKEPFFVPMETLTVNLQPEEGNDRYLQIAITFKSYDKHAEEAIKS 101

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
           +   L   ++  + + +  ++   +G     ++I E+ +        +  V+ V+F  F+
Sbjct: 102 YTPELRSRVLMLLSSKAPAELYSNEGKAKLAKEIVEQCEQAYKAVGKESPVADVLFTNFV 161

Query: 171 I 171
           I
Sbjct: 162 I 162


>gi|224418944|ref|ZP_03656950.1| flagellar basal body-associated protein FliL [Helicobacter
           canadensis MIT 98-5491]
 gi|313142456|ref|ZP_07804649.1| flagellar basal body-protein FliL [Helicobacter canadensis MIT
           98-5491]
 gi|313131487|gb|EFR49104.1| flagellar basal body-protein FliL [Helicobacter canadensis MIT
           98-5491]
          Length = 157

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 60/160 (37%), Gaps = 10/160 (6%)

Query: 1   MSYDDT-TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ ++   S+     Q+K+ +   +    + +    + GI++       +    Q     
Sbjct: 1   MADEEQKESKLASLKQNKMILFIIIGVVALLLIILIVVGILIFSGGDETQS---QDANQP 57

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF--DSSPKDWLR----LDIALICKDIPD 113
                S  SV   ++  L    ++ L   I N       K +L+    L++++       
Sbjct: 58  TQSSASKSSVANPNSSLLNVGPMYPLDQFIVNLVSTGGGKRYLKTAIALEMSIAEMQPEL 117

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV 153
              +  L   I+  + + + ++I   +G +  KE+I  R+
Sbjct: 118 DTKVNILRDTIITILASKTFEEIQTTRGKQKLKEEIIARL 157


>gi|83858804|ref|ZP_00952326.1| hypothetical protein OA2633_04856 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853627|gb|EAP91479.1| hypothetical protein OA2633_04856 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 198

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/168 (11%), Positives = 47/168 (27%), Gaps = 12/168 (7%)

Query: 16  HKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEE---KYQKFILNNFYDNSVRSVHTG 72
            K+ +   +    + +         +         E          +            G
Sbjct: 29  KKMILFIGLPVILVILAGVAGALFFLGGGDEEAAAEGEHGEAHGEASADGHGDGHGGGDG 88

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDI--ALICKDIPD------KVFLETLHQDI 124
                        +P+I +        + L++  AL   D         +     L  + 
Sbjct: 89  HEAPHLAELFQFEEPLIVDMSGPDNRSVLLEVRIALAFSDPEVGEMLHREDVQMLLRDEY 148

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-VSSVIFRTFII 171
           + + R + ++ I G+ G    + ++  R  L      V  V+  +F++
Sbjct: 149 VEFFRALRVEDIDGSTGSHRIRMELIRRTNLVLAPKTVDGVLLPSFVM 196


>gi|103488407|ref|YP_617968.1| flagellar basal body-associated protein FliL [Sphingopyxis
           alaskensis RB2256]
 gi|98978484|gb|ABF54635.1| flagellar basal body-associated protein FliL [Sphingopyxis
           alaskensis RB2256]
          Length = 201

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 13/137 (9%), Positives = 39/137 (28%), Gaps = 15/137 (10%)

Query: 50  EEKYQKFILNNFYDNSVRSVHTGDTISLKKL-----QIFSLQPIITNFDSSPKDWLRLDI 104
             +      +      V +V   +              + +    T   +    +L++ I
Sbjct: 64  APEPAAEGEDKEAPLKVGTVSVPNDRFKVDPRKYEITYYPISDSFTTNLADGSGFLQVGI 123

Query: 105 ALICKDI-----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR--- 156
           +L            K     +   ++  +       ++ +QG +  +  +   +      
Sbjct: 124 SLSTFYDGKVINNIKRQAVPIRSVVLMVLAEQDPASLSTSQGKQRLQRQLTAAINDVLRE 183

Query: 157 --SQGFVSSVIFRTFII 171
               G + +V F + +I
Sbjct: 184 KEGFGGIDNVYFTSLVI 200


>gi|83589635|ref|YP_429644.1| flagellar basal body-associated protein FliL [Moorella
           thermoacetica ATCC 39073]
 gi|83572549|gb|ABC19101.1| Flagellar basal body-associated protein FliL [Moorella
           thermoacetica ATCC 39073]
          Length = 159

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 41/113 (36%), Gaps = 9/113 (7%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDI----PDKVFLET 119
            + +  TG+      LQ  SL  I+ N        +LR  I +   D          L  
Sbjct: 49  GMAAAPTGNNPEPAALQKLSLDSIVVNLADPGLHRYLRAKITMEYSDPKLATELNDKLYR 108

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +   I++ +R+     +   +     K ++   +    + G V ++ F  FII
Sbjct: 109 VRDTIISVLRSKKTDDLQNEEA---LKRELLTAINSQLTAGQVRALYFEEFII 158


>gi|58582230|ref|YP_201246.1| flagellar protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84624123|ref|YP_451495.1| flagellar protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188576790|ref|YP_001913719.1| flagellar basal body-associated protein FliL [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188576982|ref|YP_001913911.1| flagellar basal body-associated protein FliL [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|58426824|gb|AAW75861.1| flagellar protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368063|dbj|BAE69221.1| flagellar protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188521242|gb|ACD59187.1| flagellar basal body-associated protein FliL [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188521434|gb|ACD59379.1| flagellar basal body-associated protein FliL [Xanthomonas oryzae
           pv. oryzae PXO99A]
          Length = 174

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 15/164 (9%), Positives = 41/164 (25%), Gaps = 30/164 (18%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L V   VV         W                           D   +       +  
Sbjct: 28  LLVAIGVVVLAAAGGGAWFFLGH-------------------KADDKGDKHAPKVAEVPK 68

Query: 78  KKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPDKVFL----ETLHQDIMAYIRTV 131
                     I+ N         +L++++ L+ +D  +   +      +   ++  +   
Sbjct: 69  PAQYFPMDPAIVVNLADPGDGPQYLQVEVQLVTRDPEELKLITENAPAIRAHLLMLLSQT 128

Query: 132 SIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +    G +  ++      +        +  V  ++F +F+
Sbjct: 129 KATDVADLAGKQKLQKAALAETQKVMTSETGKKCVEELLFTSFV 172


>gi|91200229|emb|CAJ73273.1| hypothetical protein kuste2526 [Candidatus Kuenenia
           stuttgartiensis]
          Length = 191

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 48/123 (39%), Gaps = 7/123 (5%)

Query: 56  FILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIP-- 112
            I     +  ++S         +   I ++  I+ N   S  + +L+  + L  ++    
Sbjct: 68  EITKYSDEIPLKSDKDPKEPLPQGPIIVTIDTIVVNLSGSNLRRYLKAKVILEVRNEEAR 127

Query: 113 --DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS--QGFVSSVIFRT 168
              +     +   +++ + + +I  I   +G  Y K +I++ V +    +  V  V F  
Sbjct: 128 GKLETRTIQVKDRLISILSSKTIDDIDSVEGREYIKREIKDSVDVILNMEKAVLQVYFED 187

Query: 169 FII 171
           F++
Sbjct: 188 FVV 190


>gi|296135697|ref|YP_003642939.1| flagellar basal body-associated protein FliL [Thiomonas intermedia
           K12]
 gi|295795819|gb|ADG30609.1| flagellar basal body-associated protein FliL [Thiomonas intermedia
           K12]
          Length = 189

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 63/204 (30%), Gaps = 49/204 (24%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  ++   G + KL +   VV   +    G     +M                   
Sbjct: 1   MAEQEAKAKEKGGGKTKLIIIILVVVIVLMAGGGAAAFFLMKP----------------K 44

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDI----PDK 114
               +            K ++  S++P +TN  S+     +L++ I L   D       K
Sbjct: 45  AAPTAAELAAEAAAEKAKNMRFISMEPFVTNLQSTDGTVHYLQVKIDLKTYDPSVEGKVK 104

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-------------- 160
           +    L  +I+  +   SI ++   +G  + +EDI   V    +G               
Sbjct: 105 LMTPELRNNILRILAAQSIDKVDSVEGRDHLREDILHSVNKVLEGAPAVAAAGGEHGGGG 164

Query: 161 -------------VSSVIFRTFII 171
                        +  V F  F++
Sbjct: 165 GAAAAAHGHDGAPIDGVFFTAFVV 188


>gi|163856452|ref|YP_001630750.1| flagellar basal body-associated protein FliL [Bordetella petrii DSM
           12804]
 gi|163260180|emb|CAP42482.1| flagellar basal body-associated protein FliL [Bordetella petrii]
          Length = 191

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 21/190 (11%), Positives = 46/190 (24%), Gaps = 19/190 (10%)

Query: 1   MSYDDTTSQYIRG------NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQ 54
           M+     S   R           +    F +     + C  +     +      +     
Sbjct: 1   MATSKNPSMPSRSLPLRTSGGSPILRGLFWLLALAIVACASVAATWFIMHRQYTEAAAPV 60

Query: 55  KFILNNFYDNSVRS---VHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKD 110
           +  +         +           +       L+       S   +  L + I L   D
Sbjct: 61  RLGVGKADAGPAPAIFVEPPATPTPVPAPIFIPLEAFTVTLQSAESERILHVGITLRAGD 120

Query: 111 IP----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FV 161
                  + ++  +   I+  +   S       QG       I   V           +V
Sbjct: 121 EQTRMRIEKYMPEVRSRILMVLSAQSPTVAQSPQGKADMARAIVAAVNQPFSPLPDGQYV 180

Query: 162 SSVIFRTFII 171
           S+ +F  F++
Sbjct: 181 SAALFTAFVV 190


>gi|253682344|ref|ZP_04863141.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           D str. 1873]
 gi|253562056|gb|EES91508.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           D str. 1873]
          Length = 163

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 55/182 (30%), Gaps = 31/182 (17%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  S   +GN  K+ +   +    +    G   G ++      Q        I N 
Sbjct: 1   MAEIENRSSS-KGNILKIMIIVLLAAILL--GGGIFTGYLVASKTKPQSVVTNLSLIQNT 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD--SSPKDWLRLDIALICKD-------- 110
                             K + F+L   + N     +   +++  ++L   D        
Sbjct: 58  -----------------LKQRTFALDEFLVNLKSDDASNRYIKTKVSLGYADIKENKTLE 100

Query: 111 IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
                        I + +RT   +           KE+I+ ++  L   G + +V F   
Sbjct: 101 DELNTKKTIARDAINSILRTKKKEDFATNAQVEKIKEEIKNKINPLLQDGQIINVYFSEI 160

Query: 170 II 171
           II
Sbjct: 161 II 162


>gi|294339868|emb|CAZ88231.1| putative Flagellar basal body-associated protein FliL [Thiomonas
           sp. 3As]
          Length = 189

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 62/204 (30%), Gaps = 49/204 (24%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  ++   G + KL +   V    +    G     +M                   
Sbjct: 1   MAEQEAKAKEKGGGKTKLIIIILVAVIVLMAGGGAAAFFLMKP----------------K 44

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDI----PDK 114
               +            K ++  S++P +TN  S+     +L++ I L   D       K
Sbjct: 45  AAPTAAELAAEAAAEKAKNMRFISMEPFVTNLQSTDGTVHYLQVKIDLKTYDPLVEGKVK 104

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-------------- 160
           +    L  +I+  +   SI ++   +G  + +EDI   V    +G               
Sbjct: 105 LMTPELRNNILRILAAQSIDKVDSVEGRDHLREDILHSVNKVLEGAPAVAAAGGEHGGGG 164

Query: 161 -------------VSSVIFRTFII 171
                        +  V F  F++
Sbjct: 165 GAAAAAHGHDGAPIDGVFFTAFVV 188


>gi|251789182|ref|YP_003003903.1| flagellar basal body-associated protein FliL [Dickeya zeae Ech1591]
 gi|247537803|gb|ACT06424.1| flagellar basal body-associated protein FliL [Dickeya zeae Ech1591]
          Length = 162

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 52/183 (28%), Gaps = 34/183 (18%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  +Q     +  L++   +V           G   +                   
Sbjct: 1   MATSNKKAQSGD-KKRSLWLILLIVIALAATAAAGAGWWFL------------------- 40

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIPDKVFL 117
             ++    + + +           L     N  S    P   L + I L   D   +  L
Sbjct: 41  --NHKKTEMVSSEPPPPPAPVFMPLDTFTVNLLSPDNNPDRVLYVGITLRLPDEATRARL 98

Query: 118 ----ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGF----VSSVIFRT 168
                 +   ++      S   +   QG +   EDI++ +      G     VS V+F  
Sbjct: 99  TNYLPEIRSRLIMLFSRQSSSFLATEQGKQKLVEDIKQVLSPPLVPGQPNQVVSDVLFTA 158

Query: 169 FII 171
           FI+
Sbjct: 159 FIL 161


>gi|34498586|ref|NP_902801.1| flagellar fliL transmembrane protein [Chromobacterium violaceum
           ATCC 12472]
 gi|34104440|gb|AAQ60798.1| flagellar fliL transmembrane protein [Chromobacterium violaceum
           ATCC 12472]
          Length = 151

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 15/121 (12%), Positives = 41/121 (33%), Gaps = 8/121 (6%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKV--- 115
                 + +                 +   + N   +    L++D+     D   K    
Sbjct: 28  KPAGAQAEQVQEKPKKKHEGPPIFEKMDTFVVNLAGNDGSLLQIDMQAELGDEEAKKKFA 87

Query: 116 -FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR----SQGFVSSVIFRTFI 170
            +   +   ++  + + +  +++ A+G    K  +++ +        +  V SV+F +FI
Sbjct: 88  DYAPKVRSAVILLLSSKTAAEVSTAEGKVKLKAQVKQIINEAMDAGEEPVVESVLFTSFI 147

Query: 171 I 171
           I
Sbjct: 148 I 148


>gi|94314216|ref|YP_587425.1| flagellar biosynthesis protein; flagellar basal body-associated
           protein [Cupriavidus metallidurans CH34]
 gi|93358068|gb|ABF12156.1| flagellar biosynthesis protein; flagellar basal body-associated
           protein [Cupriavidus metallidurans CH34]
          Length = 171

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 21/183 (11%), Positives = 47/183 (25%), Gaps = 34/183 (18%)

Query: 1   MSYDDTTSQ--YIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+   + SQ       + +L +    V        G++ G ++                 
Sbjct: 10  MANTLSPSQTGGTPSKRGRLLLIGGGVLVVALGVGGFVLGNIIGGSRQ------------ 57

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDIPDKVFL 117
                             +       L     N  S     +L   ++L   D   +  L
Sbjct: 58  ----------PAAPAAPVVPPPIFVPLDAFTVNLKSEDGDRFLHTGLSLKVADSDTQARL 107

Query: 118 ----ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-----RSQGFVSSVIFRT 168
                     I+  +       +   +G +    DI+  +            +  V+F +
Sbjct: 108 SQYLPEARSRILLLLSARQPADLATVEGKQKLARDIQATISQPFAAGLPPQKILDVLFTS 167

Query: 169 FII 171
           F++
Sbjct: 168 FVV 170


>gi|225850266|ref|YP_002730500.1| flagellar basal body-associated protein FliL [Persephonella marina
           EX-H1]
 gi|225646148|gb|ACO04334.1| flagellar basal body-associated protein FliL [Persephonella marina
           EX-H1]
          Length = 170

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 51/147 (34%), Gaps = 18/147 (12%)

Query: 31  IFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIIT 90
              G     ++L     +K+E   + I                        +F +   I 
Sbjct: 33  GGGGAAYKFLVLDKQKEEKQENKAEKIQE------------EIKDIENLGIMFEVGTFIV 80

Query: 91  NFDSSP-KDWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYF 145
           N        +L++ + L  ++       +  L  +   I   + T + +++  A+G    
Sbjct: 81  NLADKDADRFLKVTVILEIENEQVKMEVEKRLPQIKDAITTLLFTKNSRELKTAEGIELL 140

Query: 146 KEDIEERVKLRSQ-GFVSSVIFRTFII 171
           KE+I +RV      G V +V F  F+I
Sbjct: 141 KEEIIKRVNAILPLGGVKNVYFTDFVI 167


>gi|114332021|ref|YP_748243.1| flagellar basal body-associated protein FliL [Nitrosomonas eutropha
           C91]
 gi|114309035|gb|ABI60278.1| flagellar basal body-associated protein FliL [Nitrosomonas eutropha
           C91]
          Length = 160

 Score = 67.5 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 25/178 (14%), Positives = 59/178 (33%), Gaps = 32/178 (17%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           + T+    GN+ KL +   +   F G   G     +       Q EE   + ++      
Sbjct: 3   EATAAAGTGNKSKLILFILIGLLFTGAGIGGTWYFM-----KKQHEEAGSEAVVEKKKPA 57

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPD----KVFLE 118
           +                   ++    N     +   +L+++++L   +       +    
Sbjct: 58  A----------------FVKIESFTVNLQPEERESHYLQVELSLKVNETAVITVIENSKP 101

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
            +   I+  + +    +I    G +   +DI + ++        Q  +  V+F +FII
Sbjct: 102 EIRNQILLLLSSKKPSEINTLDGKQKLSQDIIQAIRSKIGSEALQNDILDVLFTSFII 159


>gi|28869172|ref|NP_791791.1| flagellar protein FliL [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213967551|ref|ZP_03395699.1| flagellar protein FliL [Pseudomonas syringae pv. tomato T1]
 gi|301382888|ref|ZP_07231306.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. tomato Max13]
 gi|302061098|ref|ZP_07252639.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. tomato K40]
 gi|302131286|ref|ZP_07257276.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|28852412|gb|AAO55486.1| flagellar protein FliL, putative [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213927852|gb|EEB61399.1| flagellar protein FliL [Pseudomonas syringae pv. tomato T1]
          Length = 167

 Score = 67.5 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 12/181 (6%), Positives = 52/181 (28%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +   +          +   VV   + +         ++                 +
Sbjct: 1   MAKSEEVVKDPAAKGKLKLIIIAVVALLLAVGLSVGATWFLM---------------HKS 45

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDKV 115
                  +      +    +        + NF+++ +  ++++ I +           KV
Sbjct: 46  ESAPDPAAAAAAANVKPVAVFEPMTPAFVVNFNANGRQRYMQVSITMLGRNAADMEALKV 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +  +  +++     +  + +    G    ++     ++  +Q       +  ++F  F+
Sbjct: 106 HMPLIRNNLVMLFAAIPFESLASPIGQEMLRQKATASIQEVAQKELGKTVIEQLLFTNFV 165

Query: 171 I 171
           +
Sbjct: 166 L 166


>gi|169831902|ref|YP_001717884.1| flagellar basal body-associated protein FliL [Candidatus
           Desulforudis audaxviator MP104C]
 gi|169638746|gb|ACA60252.1| flagellar basal body-associated protein FliL [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 161

 Score = 67.5 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 17/114 (14%), Positives = 35/114 (30%), Gaps = 7/114 (6%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD-----IPDKVFLE 118
                           +  S   ++ N    P   + R+ + L   D        K    
Sbjct: 47  PGGEKSDRKAEKPAVTKTMSFGSLVVNLADPPGSRYFRVALTLEYVDSGTLETELKEKEH 106

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
            +   ++  +R  S   + G +     +E+I   +     +G +  V F  F+I
Sbjct: 107 RIRDGLVFLLRQKSSFDLKGPEVPETIREEILREINRHLEKGEIEEVYFTEFLI 160


>gi|291617854|ref|YP_003520596.1| FliL [Pantoea ananatis LMG 20103]
 gi|291152884|gb|ADD77468.1| FliL [Pantoea ananatis LMG 20103]
 gi|327394271|dbj|BAK11693.1| flagellar FliL protein [Pantoea ananatis AJ13355]
          Length = 161

 Score = 67.1 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 24/178 (13%), Positives = 50/178 (28%), Gaps = 31/178 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           + +   +G + KL +   ++               M+    G K E              
Sbjct: 2   SDNAKAKGRKRKLLIPVLLIVALAACSVAGYAVWRMMNKHEGDKPEVA------------ 49

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIPDKVFL----E 118
                            F+L     N  +    P   L +   L   D   +  +     
Sbjct: 50  -------KVEPPPAPVFFALDTFTVNLVNPDNDPDRVLYVGFTLRLPDEETRRRMSDYLP 102

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
            +   ++  +   +   +   QG +   + I++      VK +    V  V+F  FI+
Sbjct: 103 EVRSRLLLLLSRQNAAALATEQGKQALVDQIKQALAPPLVKGQPPQVVDDVLFTAFIL 160


>gi|188592200|ref|YP_001796798.1| flil: flagellar basal body-associated protein flil [Cupriavidus
           taiwanensis LMG 19424]
 gi|170938574|emb|CAP63561.1| FliL: flagellar basal body-associated protein FliL [Cupriavidus
           taiwanensis LMG 19424]
          Length = 163

 Score = 67.1 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 46/181 (25%), Gaps = 29/181 (16%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+   + S+     +    +        + +  G      +L                  
Sbjct: 1   MANTASPSRTGNTGKRGRLLLIGAGVLVVALGAGGFVLGSVLSNRQ-------------- 46

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDIP----DKV 115
                  +  T     +       L     N  S     +L   ++L   D         
Sbjct: 47  -----PAAPATPAAPVVPPPIFVPLDAFTVNLRSEDGDRFLHTGLSLKVADAATQARLAQ 101

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-----RSQGFVSSVIFRTFI 170
           +L      I+  +      ++    G R   +DI + +            V  V+F +F+
Sbjct: 102 YLPEARSRILLLLSARQPAELATVDGKRKLADDIRDTISKPFASGLPAQQVLDVLFTSFV 161

Query: 171 I 171
           +
Sbjct: 162 V 162


>gi|292489156|ref|YP_003532043.1| flagellar FliL protein [Erwinia amylovora CFBP1430]
 gi|292900274|ref|YP_003539643.1| flagellar protein [Erwinia amylovora ATCC 49946]
 gi|291200122|emb|CBJ47248.1| flagellar protein [Erwinia amylovora ATCC 49946]
 gi|291554590|emb|CBA22225.1| Flagellar FliL protein [Erwinia amylovora CFBP1430]
 gi|312173314|emb|CBX81569.1| Flagellar FliL protein [Erwinia amylovora ATCC BAA-2158]
          Length = 165

 Score = 67.1 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/178 (11%), Positives = 48/178 (26%), Gaps = 27/178 (15%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           +   +   G   +  V   +    +         +  +    GQ              D 
Sbjct: 3   NKIKKTSGGGSLRTVVFTIMFLVMMATCGIAGYAVWEMSKSTGQSANHNAVAGATVDAD- 61

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFD---SSPKDWLRLDIALICKDIP----DKVFL 117
                              SL     +     +     L + ++L   D       + +L
Sbjct: 62  ---------------PLYQSLSTFTVSLKPTENENDRVLYIGLSLRMADKQSLLTIEKYL 106

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG----FVSSVIFRTFII 171
                 ++  +   S ++++  +G +   + I+  V           V+ V+F  FI+
Sbjct: 107 PEYRSRLLILLAKSSYEELSTNEGKQLLVDKIKHEVSKPLAANQSVKVADVLFNEFIL 164


>gi|289578423|ref|YP_003477050.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           italicus Ab9]
 gi|297544699|ref|YP_003677001.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|289528136|gb|ADD02488.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           italicus Ab9]
 gi|296842474|gb|ADH60990.1| flagellar basal body-associated protein FliL [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 131

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 14/96 (14%), Positives = 37/96 (38%), Gaps = 5/96 (5%)

Query: 81  QIFSLQPIITNFDSSPKDWLRLDIALICKDIPD----KVFLETLHQDIMAYIRTVSIKQI 136
             +S            + +++  + L   D       +     +   I+  +R+ + +++
Sbjct: 35  YNYSPGGEFITNLKGEEKFVKATVQLQVADKNILKTLEERNSEIRDLIIQILRSKTAQEV 94

Query: 137 TGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            G +G    K DI+  +  +  +  + +V F  FI+
Sbjct: 95  EGPEGQEKLKNDIKNGINKIIGEEKIINVYFDEFIV 130


>gi|307731348|ref|YP_003908572.1| flagellar basal body-associated protein FliL [Burkholderia sp.
           CCGE1003]
 gi|307585883|gb|ADN59281.1| flagellar basal body-associated protein FliL [Burkholderia sp.
           CCGE1003]
          Length = 165

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 33/101 (32%), Gaps = 11/101 (10%)

Query: 82  IFSLQPIITNFDSSPK--DWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQ 135
            F L  +  N  S      +LR+ + L   D          +  +   I+  +      +
Sbjct: 64  FFPLDSMTVNLQSDDGQQHFLRIGLTLKLTDPKTQQELTEHMPEIRSRILLALSNHHPDE 123

Query: 136 ITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
           +    G R    ++   ++  +        V  V+F  F++
Sbjct: 124 LAPLDGKRALATELRTLIEQPTDKGAAPIHVQDVLFTEFVV 164


>gi|167645398|ref|YP_001683061.1| flagellar basal body-associated protein FliL [Caulobacter sp. K31]
 gi|167347828|gb|ABZ70563.1| flagellar basal body-associated protein FliL [Caulobacter sp. K31]
          Length = 203

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 18/105 (17%), Positives = 41/105 (39%), Gaps = 7/105 (6%)

Query: 74  TISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPDKVFL----ETLHQDIMAY 127
                 +  ++L  I+ N  ++     +L+L +     D      L      L      +
Sbjct: 98  KEGPDGVVFYTLPDIVVNMQAADGRSTFLKLKLTFELPDEETAENLTPNLPRLQDMFQTF 157

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           +R +  + + G+QG    + ++  RV L  +   V++V+    +I
Sbjct: 158 LRELRPEDLNGSQGSYQLRAELLRRVNLVAAPSKVNAVLIEEMLI 202


>gi|39936959|ref|NP_949235.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris CGA009]
 gi|192292787|ref|YP_001993392.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris TIE-1]
 gi|39650816|emb|CAE29339.1| Flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris CGA009]
 gi|192286536|gb|ACF02917.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris TIE-1]
          Length = 166

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 43/118 (36%), Gaps = 8/118 (6%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDK 114
             +   +        +K      +  I+ N   +P + ++       L++         K
Sbjct: 48  AGHGEDAHQAEAAKEVKPPNFVEVPEIMVNLAGTPGERVQYLKAKVVLEVKDEKLAEQIK 107

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
             +  +      Y+R +    + G+ G    KE++  RV    +   VS+V+F+  ++
Sbjct: 108 PNMPRITDLFQTYLRELRSGDLNGSVGMFRMKEELTRRVNMAIAPAQVSAVLFKEVLV 165


>gi|253998474|ref|YP_003050537.1| flagellar basal body-associated protein FliL [Methylovorus sp.
           SIP3-4]
 gi|313200549|ref|YP_004039207.1| flagellar basal body-associated protein flil [Methylovorus sp.
           MP688]
 gi|253985153|gb|ACT50010.1| flagellar basal body-associated protein FliL [Methylovorus sp.
           SIP3-4]
 gi|312439865|gb|ADQ83971.1| flagellar basal body-associated protein FliL [Methylovorus sp.
           MP688]
          Length = 169

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 55/169 (32%), Gaps = 28/169 (16%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
           G++ KL +   +    +G   G      +                  +        V   
Sbjct: 18  GSKKKLIMIIVIALLVLGGGGGAAAWFFL------------------HKPAKEEHKVEEK 59

Query: 73  DTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIP----DKVFLETLHQDIMAY 127
              + K     SL+    N        +L++D+ L   D       K+ +  +   ++  
Sbjct: 60  HEEAPKPPVFVSLETFTVNLQPDPESQFLQVDLTLKVADAEQAEIVKLHMPEIRNRLLML 119

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
           + +    ++T  +G +   ++I  +VK           VS V F +F++
Sbjct: 120 LSSKKPSEVTSIEGKKALSDEIVAQVKQPFSAGEKPLEVSGVFFTSFVV 168


>gi|152990378|ref|YP_001356100.1| flagellar basal body-associated protein FliL [Nitratiruptor sp.
           SB155-2]
 gi|151422239|dbj|BAF69743.1| flagellar basal body-associated protein FliL [Nitratiruptor sp.
           SB155-2]
          Length = 171

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 38/95 (40%), Gaps = 6/95 (6%)

Query: 83  FSLQPIITNFDSSP-KDWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQIT 137
           + +   I N        +L++ I L  +D       +  L  +   I   + T S  ++ 
Sbjct: 74  YDVGTFIVNLQDKDADRYLKVTIVLDVQDEKVKQELEKRLPQVKDAITTLLFTKSSYELR 133

Query: 138 GAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
            A+G    KE I +RV      G V +V F  F+I
Sbjct: 134 TAEGIEELKEQILKRVNAILPIGGVKNVYFTDFVI 168


>gi|186477684|ref|YP_001859154.1| flagellar basal body-associated protein FliL [Burkholderia phymatum
           STM815]
 gi|184194143|gb|ACC72108.1| flagellar basal body-associated protein FliL [Burkholderia phymatum
           STM815]
          Length = 167

 Score = 67.1 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 39/101 (38%), Gaps = 11/101 (10%)

Query: 82  IFSLQPIITNFDSSPK--DWLRLDIALICKDIPDKVF----LETLHQDIMAYIRTVSIKQ 135
            F L+ +  N  S      +LR+ + L   D   +      +  +   ++  +     + 
Sbjct: 66  FFPLESMTVNLQSDDGQQHYLRIGLTLKLTDQKVQEHLTEHMPEIRSRVLLALSNKHPED 125

Query: 136 ITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
           +    G +    ++E+ ++  ++       VS V+F  F++
Sbjct: 126 LATLDGKKALAAELEKLIEEPTEANGQPVHVSDVLFTEFVV 166


>gi|110642050|ref|YP_669780.1| flagellar basal body-associated protein FliL [Escherichia coli 536]
 gi|191173299|ref|ZP_03034829.1| flagellar basal body-associated protein FliL [Escherichia coli F11]
 gi|300994271|ref|ZP_07180823.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           200-1]
 gi|110343642|gb|ABG69879.1| flagellar FliL protein [Escherichia coli 536]
 gi|190906416|gb|EDV66025.1| flagellar basal body-associated protein FliL [Escherichia coli F11]
 gi|300304936|gb|EFJ59456.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           200-1]
 gi|324013499|gb|EGB82718.1| flagellar basal body-associated protein FliL [Escherichia coli MS
           60-1]
          Length = 154

 Score = 67.1 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 48/175 (27%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L+    V  T                + A  K ++             
Sbjct: 2   TDYAISKKSKRSLWSPILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|74312484|ref|YP_310903.1| flagellar basal body-associated protein FliL [Shigella sonnei
           Ss046]
 gi|73855961|gb|AAZ88668.1| flagellar biosynthesis [Shigella sonnei Ss046]
 gi|323168935|gb|EFZ54615.1| flagellar fliL protein [Shigella sonnei 53G]
          Length = 154

 Score = 67.1 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 48/175 (27%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                                  + + 
Sbjct: 2   TDYAISKKSKRSLWLPILVFITLAACASAGYSYW----------------------HSHQ 39

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
           V +        +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 40  VAAEDKAQHRVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVMYTAFIL 153


>gi|254523656|ref|ZP_05135711.1| flagellar basal body-associated protein FliL [Stenotrophomonas sp.
           SKA14]
 gi|219721247|gb|EED39772.1| flagellar basal body-associated protein FliL [Stenotrophomonas sp.
           SKA14]
          Length = 171

 Score = 67.1 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 14/124 (11%), Positives = 35/124 (28%), Gaps = 11/124 (8%)

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS--PKDWLRLDIALICKDIP--- 112
             + ++                         + N +       +L+L++ L+ +D     
Sbjct: 46  TQSKHEEKAAQAPKKSATPAPAQYFALDPAFVVNLNGPVDGPRYLQLEVQLMTRDPAALE 105

Query: 113 -DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIF 166
             K     +   ++     VS  QI    G +  +      V+              ++F
Sbjct: 106 AIKTHAPAIRARLLMLFSQVSPDQIADIAGKQKLQAASLAEVQKVLKAETGSNGADDLLF 165

Query: 167 RTFI 170
            +F+
Sbjct: 166 TSFV 169


>gi|182412237|ref|YP_001817303.1| flagellar basal body-associated protein FliL [Opitutus terrae
           PB90-1]
 gi|177839451|gb|ACB73703.1| flagellar basal body-associated protein FliL [Opitutus terrae
           PB90-1]
          Length = 200

 Score = 67.1 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 14/161 (8%), Positives = 41/161 (25%), Gaps = 8/161 (4%)

Query: 17  KLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTIS 76
           K ++          +    +   V++     +         +     +     H  +   
Sbjct: 41  KAWLPAIATVVLAPVCTWAVCQFVLIPQLEKKLGAAPVAEQVATEEGHGEGGAHGKNGKD 100

Query: 77  LKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDIPD----KVFLETLHQDIMAYIRTV 131
                    Q ++ N   +    +L+    +   D       +     L    +  + ++
Sbjct: 101 SAPNY--EFQNMVVNLSGTMGTRYLKTSFLVTGSDPEIKSVFETNKARLTDVTLNVLSSL 158

Query: 132 SIKQITGAQGFRYFKEDIEERVKLRSQGFV-SSVIFRTFII 171
           S+  +         +E +           V   V F  F++
Sbjct: 159 SLADLEEPGAKNVLREKLVSAYNQALGRKVAEQVYFSDFVV 199


>gi|326319065|ref|YP_004236737.1| flagellar basal body-associated protein FliL [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323375901|gb|ADX48170.1| flagellar basal body-associated protein FliL [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 195

 Score = 66.7 bits (161), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 14/140 (10%), Positives = 39/140 (27%), Gaps = 14/140 (10%)

Query: 19  FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLK 78
            V    +   + +  G     ++       ++E                     +     
Sbjct: 18  LVLIIAIVAVLVLAGGGAAWFLLSKRSHADEDE---------EGGGGHAKAAQAEHKEKV 68

Query: 79  KLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSI 133
                 ++ ++ N   +    + ++ I L   D       K +L ++   I+  +   + 
Sbjct: 69  APTFLPIENMVVNLADTGGERFAQIGITLELADAKTSDQVKQYLPSIRSAILMLVSQRTS 128

Query: 134 KQITGAQGFRYFKEDIEERV 153
           +++    G      DI   V
Sbjct: 129 QELLSRDGKEKLAVDIRREV 148


>gi|205352331|ref|YP_002226132.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|62128183|gb|AAX65886.1| flagellar biosynthesis [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|205272112|emb|CAR36965.1| FliL protein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|326627381|gb|EGE33724.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 175

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 49/175 (28%), Gaps = 31/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   + ++  +++   V+ T             M                        
Sbjct: 22  TDSAINKKSKRSIWIPLLVLITLAACATAGYSYWRM---------------------QQQ 60

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
             +    +         F+L     N   +    L + + L  KD         +L  + 
Sbjct: 61  PTTNAKAEPAPPPAPVFFALDTFTVNLGDA-DRVLYIGVTLRLKDEATRARLNEYLPEVR 119

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
             ++      +  +++   G +     I+E +         +  V+ V++  FI+
Sbjct: 120 SRLLLLFSRQNAAELSTEAGKQKLIAAIKETLAAPLVAGQPKQVVTDVLYTAFIL 174


>gi|190574233|ref|YP_001972078.1| putative flagellar basal body-associated protein FliL
           [Stenotrophomonas maltophilia K279a]
 gi|190012155|emb|CAQ45778.1| putative flagellar basal body-associated protein FliL
           [Stenotrophomonas maltophilia K279a]
          Length = 171

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/124 (12%), Positives = 37/124 (29%), Gaps = 11/124 (8%)

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS--PKDWLRLDIALICKDIP--- 112
             + +++         T              + N +       +L+L++ L+ +D     
Sbjct: 46  TQSKHEDKAAQAPKKTTTPAPAQYFALDPAFVVNLNGPVDGPRYLQLEVQLMTRDPAALE 105

Query: 113 -DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIF 166
             K     +   ++     VS  QI    G +  +      V+              ++F
Sbjct: 106 AIKTHAPAIRARLLMLFSQVSPDQIADVAGKQKLQAASLAEVQKVLKAETGSNGADDLLF 165

Query: 167 RTFI 170
            +F+
Sbjct: 166 TSFV 169


>gi|283832661|ref|ZP_06352402.1| flagellar basal body-associated protein FliL [Citrobacter youngae
           ATCC 29220]
 gi|291072335|gb|EFE10444.1| flagellar basal body-associated protein FliL [Citrobacter youngae
           ATCC 29220]
          Length = 155

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/175 (13%), Positives = 50/175 (28%), Gaps = 31/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   + ++  +++   V+ T             M                        
Sbjct: 2   TDSAINKKSKRAIWIPLLVLITLAACATAGYSYWRM---------------------QQQ 40

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
             +    +         F+L     N   +    L + I L  KD         +L  + 
Sbjct: 41  PSASVKAEPAPPPAPVFFALDTFTVNLGDA-DRVLYIGITLRMKDEATRARLNEYLPEVR 99

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++      +   +   +G +    DI+E +    +  Q    V+ V++  FI+
Sbjct: 100 SRLLLLFSRQNAATLATEEGKQQLIADIKETLATPLVVGQPKQVVTDVLYTAFIL 154


>gi|16760919|ref|NP_456536.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29141389|ref|NP_804731.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|213053038|ref|ZP_03345916.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213419858|ref|ZP_03352924.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
 gi|213584775|ref|ZP_03366601.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213615590|ref|ZP_03371416.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
 gi|213646781|ref|ZP_03376834.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213855272|ref|ZP_03383512.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|289829467|ref|ZP_06547079.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|25298894|pir||AH0752 FliL protein [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16503216|emb|CAD05723.1| FliL protein [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29137016|gb|AAO68580.1| FliL protein [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
          Length = 155

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 48/175 (27%), Gaps = 31/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   + ++  +++   V+ T             M                        
Sbjct: 2   TDSAINKKSKRSIWIPLLVLITLAACATAGYSYWRM---------------------QQQ 40

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
             +    +         F L     N   +    L + + L  KD         +L  + 
Sbjct: 41  PTTNAKAEPAPPPAPVFFVLDTFTVNLGDA-DRVLYIGVTLRLKDEATRARLNEYLPEVR 99

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
             ++      +  +++   G +     I+E +         +  V+ V++  FI+
Sbjct: 100 SRLLLLFSRQNAAELSTEAGKQKLIAAIKETLAAPLVAGQPKQVVTDVLYTAFIL 154


>gi|182418444|ref|ZP_02949738.1| flagellar basal body-associated protein FliL [Clostridium butyricum
           5521]
 gi|237666619|ref|ZP_04526604.1| flagellar basal body-associated protein FliL [Clostridium butyricum
           E4 str. BoNT E BL5262]
 gi|182377826|gb|EDT75370.1| flagellar basal body-associated protein FliL [Clostridium butyricum
           5521]
 gi|237657818|gb|EEP55373.1| flagellar basal body-associated protein FliL [Clostridium butyricum
           E4 str. BoNT E BL5262]
          Length = 162

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/183 (8%), Positives = 47/183 (25%), Gaps = 34/183 (18%)

Query: 1   MSYDDTTSQYI----RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKF 56
           M+  +          +    K  +    +   I +     GG+ +          +    
Sbjct: 1   MAKKENDKGKENIEGKTKSGKGLMVILFILGLIVLGGATFGGVYLFMKTNKTVSAQ---- 56

Query: 57  ILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICK------ 109
                               + +     L+    N      K + + ++++         
Sbjct: 57  ------------------EVVVENAYVDLEEFTVNLADEGGKRYFKGELSVGYDKSNKKM 98

Query: 110 DIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRT 168
                     +   ++ Y +      I      +  K+D+   +     +G ++ + F+ 
Sbjct: 99  AEEITANTVVVRDTVIFYFKGQKADFINNINNEQKIKDDLISAINKQLQKGKITDIRFKN 158

Query: 169 FII 171
            I+
Sbjct: 159 MIV 161


>gi|332531129|ref|ZP_08407043.1| flagellar basal body-associated protein FliL [Hylemonella gracilis
           ATCC 19624]
 gi|332039414|gb|EGI75826.1| flagellar basal body-associated protein FliL [Hylemonella gracilis
           ATCC 19624]
          Length = 180

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/109 (18%), Positives = 37/109 (33%), Gaps = 15/109 (13%)

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSI 133
                  L  ++ N         ++ I L   D       K +L  L  DI+  +   + 
Sbjct: 71  AAPIYLPLDTMVVNLSPDGDRVAQIGITLEVSDAHSLEKVKSYLPALRSDILLLLSQRTA 130

Query: 134 KQITGAQGFRYFKEDIE-----------ERVKLRSQGFVSSVIFRTFII 171
           +++   +G    K DI            ++ + R    V  V F +FI+
Sbjct: 131 EELLTNEGKEKLKADILASAAAQMKAARKKGEKRGPQPVRKVHFSSFIV 179


>gi|94500286|ref|ZP_01306819.1| Flagellar basal body-associated protein FliL [Oceanobacter sp.
           RED65]
 gi|94427585|gb|EAT12562.1| Flagellar basal body-associated protein FliL [Oceanobacter sp.
           RED65]
          Length = 177

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 16/185 (8%), Positives = 55/185 (29%), Gaps = 23/185 (12%)

Query: 1   MSYDDT---TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ +          +  + K  +   +V   + I  G    + +L              +
Sbjct: 1   MANEKELQIEGGDEQPAKSKKMLIIIIVAAILVIGGGVGVTLFLLGGDD---------EV 51

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD-SSPKDWLRLDIALICKDIPD--- 113
                     +           + +      I N+     + +L++ +  + +D      
Sbjct: 52  AEEAAVEGEEAEAAEAAPPAPAIYVKFKPEFIVNYQVGPRQRYLQIYMEAMTRDPAIADA 111

Query: 114 -KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS------QGFVSSVIF 166
            +     +   I+  +       +  A+G    ++ +++ V+         +  +  ++F
Sbjct: 112 LEQHSPMIRSSIINLLSQQDYAYLRTAEGRANLRDILKQEVQRLLAQETGIEDGLKEILF 171

Query: 167 RTFII 171
             F++
Sbjct: 172 TNFVM 176


>gi|323977875|gb|EGB72961.1| flagellar basal body protein FliL [Escherichia coli TW10509]
          Length = 154

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 49/175 (28%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                + A  K ++             
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQ------------- 48

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                      +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 49  ---------RVVPSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAVVLATEEGKKSLIAEIKATLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|73532538|dbj|BAE19827.1| flagellar biosynthesis protein [Edwardsiella tarda]
          Length = 159

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 45/174 (25%), Gaps = 34/174 (19%)

Query: 10  YIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSV 69
                + + +V   +V        G   G                               
Sbjct: 7   PKSSAKRRKWVLILLVLFAAPRPGGGYFGWHYY----------------------QQTQQ 44

Query: 70  HTGDTISLKKLQIFSLQPIITNF---DSSPKDWLRLDIALICKDIPDKVFL----ETLHQ 122
           HT     +      +L P   N           L + I L   D   +  L      +  
Sbjct: 45  HTVKQAPIPLPVFMALDPFTVNLLSNGDDSDRVLYVGITLRLPDEGTRKRLNDYLPEVRS 104

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGF----VSSVIFRTFII 171
            ++  +       +   QG +   ++I+  ++     G     V+ V+F  FI+
Sbjct: 105 RLLMLLSRQQAATLASEQGKKALMDEIKSTLRAPVVSGQPAQMVNDVMFTAFIL 158


>gi|114566395|ref|YP_753549.1| flagellar protein (FliL)-like protein [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114337330|gb|ABI68178.1| flagellar protein (FliL)-like protein [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 159

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/181 (9%), Positives = 54/181 (29%), Gaps = 33/181 (18%)

Query: 1   MSYDDTTSQYIRG--NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +  +    R   N     +   ++   + +   +     ++     ++E        
Sbjct: 1   MADEKDSEVKPRLDINIDMKLIIIGLLVFVVAVGGSYFLMKSLMAPLMPKQEGA------ 54

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKD------I 111
                             L    +  +    TN +  + + +L++ + +           
Sbjct: 55  ----------------GKLMTGNLVEVGEFTTNINDVNGQRFLKVKVTVEVSTDDKKAQE 98

Query: 112 PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFI 170
               ++  +   I+  I + ++  +   +     K +I+  +        V +V F  FI
Sbjct: 99  KITQYMPVIKDSILTIISSKTVADL-DVRNRNNLKAEIKNDLNAKIGANTVLNVYFTDFI 157

Query: 171 I 171
           +
Sbjct: 158 M 158


>gi|291613062|ref|YP_003523219.1| flagellar basal body-associated protein FliL [Sideroxydans
           lithotrophicus ES-1]
 gi|291583174|gb|ADE10832.1| flagellar basal body-associated protein FliL [Sideroxydans
           lithotrophicus ES-1]
          Length = 209

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 12/159 (7%), Positives = 38/159 (23%), Gaps = 25/159 (15%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++T       ++  L +   ++   +G    W             +  K +  +   F  
Sbjct: 16  EETPVAAPPKSKKMLIIGIVLLLAAVGGGAAWYFTRGSSPADGHAEAAKAETPVEAKFIP 75

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDK----VFLE 118
                                      N        +L+  I L       +      + 
Sbjct: 76  LGE--------------------NFTVNLQREEGDQYLQAGITLKVLKPELEEKIKALMP 115

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS 157
            +   ++  + +    ++  ++G +    +I        
Sbjct: 116 EIRSKLLFLLSSKKPSELQTSEGKKKLVAEIIAETNGVL 154


>gi|332524240|ref|ZP_08400466.1| flagellar basal body-associated protein FliL [Rubrivivax
           benzoatilyticus JA2]
 gi|332107575|gb|EGJ08799.1| flagellar basal body-associated protein FliL [Rubrivivax
           benzoatilyticus JA2]
          Length = 197

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 14/151 (9%), Positives = 40/151 (26%), Gaps = 16/151 (10%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +    +   + I  G    ++       ++  +  +            +         
Sbjct: 24  LLIIVGALVAVLAIGGGAAVFLLKKPHADTEEGAEDAE-----------PAKAEVKHDPK 72

Query: 78  KKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVS 132
                  L P   N      + + ++ I L  +D       K ++  +  +I+  +   +
Sbjct: 73  SAPTFVPLDPFTVNLADRDAERYAQVGITLEVRDAKMGDTIKAYMPAIRNNILMALADKT 132

Query: 133 IKQITGAQGFRYFKEDIEERVKLRSQGFVSS 163
              ++  +G     E +           V  
Sbjct: 133 AADLSDREGKAKLAEQVRRETARAMGYEVEE 163


>gi|311105954|ref|YP_003978807.1| flagellar FliL protein [Achromobacter xylosoxidans A8]
 gi|310760643|gb|ADP16092.1| flagellar FliL protein [Achromobacter xylosoxidans A8]
          Length = 187

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 14/145 (9%), Positives = 44/145 (30%), Gaps = 10/145 (6%)

Query: 37  GGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP 96
            G+  +      +  +  +         +         I++       ++P      +  
Sbjct: 42  LGVGQVPAGEPGQPGQPGQPAQGPQGTPTTFVAPPASPIAVPAPIFVPIEPFTVTLQNPD 101

Query: 97  KDW-----LRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEE 151
            +      L L ++        + ++  +   I+  + + S   +   QG       I++
Sbjct: 102 TERIMHVGLTLRVSDEQTRTRLEKYMPEVRSRILMVLSSQSPTGVQTQQGKTDMANAIKQ 161

Query: 152 RVKLRSQG-----FVSSVIFRTFII 171
            V           +V+ V++  F++
Sbjct: 162 AVNRPFSPLPDGQYVTDVLYTAFVV 186


>gi|254501481|ref|ZP_05113632.1| flagellar basal body-associated protein FliL [Labrenzia alexandrii
           DFL-11]
 gi|222437552|gb|EEE44231.1| flagellar basal body-associated protein FliL [Labrenzia alexandrii
           DFL-11]
          Length = 160

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query: 75  ISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK---VFLETLHQDIMAYIRTV 131
                 ++  L+P++TN  + P  W+R+   L+ +D PD    V  + +  D ++++RT+
Sbjct: 60  PFSPSTRLQRLEPLVTNLATPPSTWIRVQATLLLEDEPDTDVSVLRKRIEDDFLSFLRTL 119

Query: 132 SIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           ++  + G  G ++ +ED+ ER K+RS+G V  VI  + +I
Sbjct: 120 TLAHLEGGVGLQHLREDLNERAKVRSKGMVREVILESVVI 159


>gi|146312181|ref|YP_001177255.1| flagellar basal body-associated protein FliL [Enterobacter sp. 638]
 gi|145319057|gb|ABP61204.1| flagellar basal body-associated protein FliL [Enterobacter sp. 638]
          Length = 155

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 47/175 (26%), Gaps = 31/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   +  +  +++   V+ T                                     +
Sbjct: 2   TDSAITKKGKRSIWIPLLVLITLAACATAGYSYW---------------------RSQQA 40

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFL----ETLH 121
             +    +         F +     N   +    L + I L  KD   +  L      + 
Sbjct: 41  PSATAKAEPPPPPAPVFFPMDTFTVNLGDA-DRVLYIGITLRLKDEATRTRLSDYLPEVR 99

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
             ++          ++   G +   E I++      V  + +  V+ V++  FI+
Sbjct: 100 SRLLLLFSRQDATGLSTDDGKQKLVEAIKQTLAPPLVTGQPKQEVTDVLYTAFIL 154


>gi|285018174|ref|YP_003375885.1| flagellar basal body-associated protein flil [Xanthomonas
           albilineans GPE PC73]
 gi|283473392|emb|CBA15897.1| probable flagellar basal body-associated protein flil [Xanthomonas
           albilineans]
          Length = 175

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 51/181 (28%), Gaps = 26/181 (14%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           S  D       G   K  +   +                +L L  G     +        
Sbjct: 7   SNKDAKDAPEGGKSKKKLLIVVI--------------AAVLLLGGGGAGAFFFLKKKPEA 52

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK---DWLRLDIALICKDIPDKVFL- 117
                ++      +             + N +  P+    +L+L++ L+ +D  +   + 
Sbjct: 53  GAGHEKAEAKAAEVPKPAQYFAMEPAFVVNLNGGPQDGPHYLQLEVQLMTRDPEELKLIT 112

Query: 118 ---ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTF 169
                +   ++     V  + IT   G +  +E      +        +  V  ++F +F
Sbjct: 113 ENAPAIRAHLLMLFSQVKAQDITDIAGRKKLQESALADAQKLMTSETGKKCVEELLFTSF 172

Query: 170 I 170
           +
Sbjct: 173 V 173


>gi|218549269|ref|YP_002383060.1| flagellar basal body-associated protein FliL [Escherichia
           fergusonii ATCC 35469]
 gi|218356810|emb|CAQ89438.1| Flagellar fliL protein [Escherichia fergusonii ATCC 35469]
 gi|324114213|gb|EGC08186.1| flagellar basal body protein FliL [Escherichia fergusonii B253]
 gi|325497686|gb|EGC95545.1| flagellar basal body-associated protein FliL [Escherichia
           fergusonii ECD227]
          Length = 152

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 48/175 (27%), Gaps = 34/175 (19%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T +     ++  L+V   V  T I           +                        
Sbjct: 2   TDTASGIKSKRSLWVPLLVFITVIACISAGYSYWRL------------------------ 37

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
                +           ++L     N   +    L + I L  KD         +L  + 
Sbjct: 38  QHPPTSKKVTPPTSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 96

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
             ++          ++  +G +   + I+E + +       +  V+ V++  FI+
Sbjct: 97  SRLLLLFSRQDASVLSTEEGKQQLIKAIKETLAVPLVAGQPKQDVTDVLYTAFIL 151


>gi|188588882|ref|YP_001920215.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           E3 str. Alaska E43]
 gi|188499163|gb|ACD52299.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           E3 str. Alaska E43]
          Length = 159

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/179 (11%), Positives = 51/179 (28%), Gaps = 31/179 (17%)

Query: 1   MSYDDTTS-QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  D    +  +G    +      V   + +  G   G  +                  
Sbjct: 1   MADKDKGKDKESKGKSGNMKTIIIFVVALLLVGGGVFAGTYIFM---------------- 44

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICK------DIP 112
                  ++  T        +    +  +  N      K + +  I++         +  
Sbjct: 45  ------QKNATTVVKEQSIDITYVDMGEMTANLADEGGKRYFKGQISIGYDKTDKDAETE 98

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
            K     +   I+ Y++++ I  I      +  K  + +R+    ++  +  V F + I
Sbjct: 99  LKEKKVVVRDSIIFYLKSLKIDYINDTNNEKEIKAQLMDRINKQLTKSKIVDVRFDSII 157


>gi|325273546|ref|ZP_08139777.1| flagellar basal body-associated protein FliL [Pseudomonas sp.
           TJI-51]
 gi|324101324|gb|EGB98939.1| flagellar basal body-associated protein FliL [Pseudomonas sp.
           TJI-51]
          Length = 165

 Score = 66.3 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 14/182 (7%), Positives = 52/182 (28%), Gaps = 29/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +         + KL +   V               +M                  +
Sbjct: 1   MAKSEAVKDPATKGKLKLIIMAVVGLLLAIGLSVGATWFIM------------------H 42

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKV 115
             + +  +      +    +        + NF+ + +  ++++ I +  ++       KV
Sbjct: 43  KSEPAPAAEAAASNVKPAAIYQALTPAFVVNFNQNGRQRYMQVSITMQARNQADLDALKV 102

Query: 116 FLETLHQDIMAYIRTVSIKQI-TGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTF 169
            +  +  +++          + +   G    ++     V+        +  +  ++F  F
Sbjct: 103 HMPVIRNNLVMMFSGQGFDALASSPVGQEMLRQKATAVVQEVAQKELGKPVIDQLLFTNF 162

Query: 170 II 171
           ++
Sbjct: 163 VL 164


>gi|220932513|ref|YP_002509421.1| flagellar basal body-associated protein FliL [Halothermothrix
           orenii H 168]
 gi|219993823|gb|ACL70426.1| flagellar basal body-associated protein FliL [Halothermothrix
           orenii H 168]
          Length = 145

 Score = 66.3 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/166 (11%), Positives = 44/166 (26%), Gaps = 31/166 (18%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           +G   K F+   ++   I     +                               R+   
Sbjct: 4   KGGGVKSFIGIVIMMVLIAAGTSYGFMTYF------------------------DRTNSQ 39

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDI----PDKVFLETLHQDIMA 126
               S      +SL   I N   +    +++  I +                 +   I++
Sbjct: 40  HVLESKDIGPTYSLGDFIVNLSGTGGYQYIKASIVVEVSQDSVIRELDKRSPQIRDIIIS 99

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            +R   +  I         K  +   +  + + G ++SV F   ++
Sbjct: 100 ILRDQKMADIEEPGART-IKNRVRAELNQVLTTGKITSVWFTQLVV 144


>gi|17989426|ref|NP_542059.1| flagellar protein FliL [Brucella melitensis bv. 1 str. 16M]
 gi|17985303|gb|AAL54323.1| flagellar protein flil [Brucella melitensis bv. 1 str. 16M]
          Length = 124

 Score = 66.3 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 52/121 (42%), Gaps = 2/121 (1%)

Query: 53  YQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--D 110
                 +            G   S     +  LQPIITN       W+RL+ +L+ K   
Sbjct: 3   SAGQQASAKPSGKEDKPKPGSFESRSIGAVVPLQPIITNLGIPQTTWVRLEASLVAKPGH 62

Query: 111 IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFI 170
                    +  D M ++R+V++ Q+ GA G  Y + D+EER +LRS+G V  V     +
Sbjct: 63  EIPPAMAANVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISALV 122

Query: 171 I 171
           +
Sbjct: 123 V 123


>gi|161502903|ref|YP_001570015.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160864250|gb|ABX20873.1| hypothetical protein SARI_00962 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 155

 Score = 66.0 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/175 (10%), Positives = 48/175 (27%), Gaps = 31/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   + ++  +++   V+ T             M                        
Sbjct: 2   TDSAINKKSKRSIWIPLLVLITLAACATAGYSYWRM---------------------QQQ 40

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
             +    +         F++     N   +    L + + L  KD         +L  + 
Sbjct: 41  PTTNAKAEPAPPPAPVFFAMDTFTVNLGDA-DRVLYIGVTLRLKDEATRARLNEYLPEVR 99

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
             ++      +  +++   G +     I+E +            V+ V++  FI+
Sbjct: 100 SRLLLLFSRQNAAELSTQAGKQKLIAAIKETLSAPLVAGQPGQVVTDVLYTAFIL 154


>gi|23009501|ref|ZP_00050525.1| COG1580: Flagellar basal body-associated protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 171

 Score = 66.0 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/123 (12%), Positives = 38/123 (30%), Gaps = 9/123 (7%)

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--------WLRLDIALICK 109
            N                   +     ++ ++ N    P           + L++     
Sbjct: 48  KNKAAHADAGEHGAEKAEPKAQAVFLDMRDMLVNLSPDPGTPKANILKLRVSLELKDAKA 107

Query: 110 DIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRT 168
           +   K  +  +      Y+R +    + G+ G    +E++  RV +        +V+F+ 
Sbjct: 108 EAAVKPLMPRVEDTFQTYLRELRASDLAGSAGMYRLREELLRRVNIAIHPAKAEAVLFKD 167

Query: 169 FII 171
            I+
Sbjct: 168 VIV 170


>gi|114706621|ref|ZP_01439522.1| flagellar protein [Fulvimarina pelagi HTCC2506]
 gi|114538013|gb|EAU41136.1| flagellar protein [Fulvimarina pelagi HTCC2506]
          Length = 193

 Score = 66.0 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 81/193 (41%), Gaps = 23/193 (11%)

Query: 1   MSYDDT----TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKF 56
           M+  +          +G      +   V+ T IG   G   G+++    +G++     + 
Sbjct: 1   MAETNELQIEDGTKKKGGGMMPLIAALVLVTLIGGGGGAAMGVMLGGGLSGEEATDKAET 60

Query: 57  ILNNFYDNSVRSVHTGDTISLK---------------KLQIFSLQPIITNFDSSPKDWLR 101
             ++    +     T +    +                L++ +L+P++TN  +    W+R
Sbjct: 61  ASDDTKAETGGEHDTAEAGLGEGGEDSIAEIAEEEEKPLRVVALKPVLTNLSNPSTSWIR 120

Query: 102 LDIALICKDIPD---KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ 158
           ++ ++I KD  +    +    +  D +A+ R++ I QI G +G  + ++D+ ER KLRS 
Sbjct: 121 IEASVIVKDDAETDPDILAAEIEADTLAFARSLQIAQIEGTRGLLHLRDDLRERAKLRSP 180

Query: 159 GFVSSVIFRTFII 171
             V   + +  ++
Sbjct: 181 AVV-DYLIQAMVV 192


>gi|149184184|ref|ZP_01862502.1| flagellar basal body-associated protein FliL [Erythrobacter sp.
           SD-21]
 gi|148831504|gb|EDL49937.1| flagellar basal body-associated protein FliL [Erythrobacter sp.
           SD-21]
          Length = 192

 Score = 66.0 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/192 (10%), Positives = 54/192 (28%), Gaps = 22/192 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS ++T+ +  + +     + + +V    G    +      +        E     ++  
Sbjct: 1   MSNENTSPEPKKKSGKLKLILFSLVLLGAGGGGTYAAFASGIVGEHSADPEDNNPNLVLK 60

Query: 61  FYDNSVRSVHTGDTISLKKL-----------QIFSLQPIITNFDSSPKDWLRLDIALICK 109
             ++      T        +                +   +N        +++ +A    
Sbjct: 61  GEEDPFPYGETDAKDKTAVVHGAGGGEYRTAYYNFTEEFTSNLVD-GAALIQVSLAASTH 119

Query: 110 DIP-----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-----G 159
                          L   I+A +   S  ++   +G    +  +   +    +     G
Sbjct: 120 YDGRVLMWLAEHETALRSRILAELAATSEMEVVSIRGKEELQTRLTHAINETLEEREGFG 179

Query: 160 FVSSVIFRTFII 171
            V  V FR+FI+
Sbjct: 180 GVDRVYFRSFIV 191


>gi|153840565|ref|ZP_01993232.1| flagellar basal body-associated protein [Vibrio parahaemolyticus
           AQ3810]
 gi|149745773|gb|EDM56903.1| flagellar basal body-associated protein [Vibrio parahaemolyticus
           AQ3810]
          Length = 275

 Score = 66.0 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 12/121 (9%), Positives = 32/121 (26%), Gaps = 16/121 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +          + KL +    V   +G          ++      +  + +      
Sbjct: 1   MAEEQLQGADAPKGKSKLLIIIIAVVVLLGGGG--AAAFFLMGSDDSAQAAEAESQQTQA 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKVFLET 119
              N +               +   QP I N     +   +++   L+ +   ++     
Sbjct: 59  AAANPIA-------------YVNLPQPFIFNVTGDRRDRLVQIKAQLMVRGSENEQLARD 105

Query: 120 L 120
           L
Sbjct: 106 L 106


>gi|309779463|ref|ZP_07674224.1| flagellar basal body-associated protein FliL [Ralstonia sp.
           5_7_47FAA]
 gi|308921704|gb|EFP67340.1| flagellar basal body-associated protein FliL [Ralstonia sp.
           5_7_47FAA]
          Length = 165

 Score = 66.0 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/171 (13%), Positives = 50/171 (29%), Gaps = 32/171 (18%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           +G   KL +   +V    G+  G     +     A                         
Sbjct: 15  KGGSTKLLLIILIVLLLFGMGGGAAWFFLGGGNHAASGPAA------------------- 55

Query: 72  GDTISLKKLQIFSLQPIITNFD--SSPKDWLRLDIALICKD----IPDKVFLETLHQDIM 125
                 K+     ++ +  N         +L++ I     D       K +   L   ++
Sbjct: 56  --PSKPKEPVFVPMETLTVNLQPEEGNDRYLQIGITFKSFDKHAEEQIKTYTPELRSKVL 113

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
             + + +  ++  A G     ++I E  +        +  V+ V+F  F+I
Sbjct: 114 MLLASKTPTELYPADGKVKLAKEIVELCEHVFKAVGKESPVADVLFTNFVI 164


>gi|254506852|ref|ZP_05118991.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus 16]
 gi|219550137|gb|EED27123.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus 16]
          Length = 165

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 56/181 (30%), Gaps = 27/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++  ++  +G    + +   VV   +G          ++                  
Sbjct: 1   MAVEEVETEAPKGKGKLIIIIVAVVVLLLGGGGAAFF---LMGSDD-------------- 43

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                          +     +   QP I N         +++ + L+ +   ++     
Sbjct: 44  EAAAEESVEQEVVVSTEPVAYVNIAQPFIFNVTGDKRDRLVQIKVQLMVRGSENENLARY 103

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
               +   +++   + +++Q+  A G    +E   E +K        Q  +  V+F  F+
Sbjct: 104 HSPLVESSLLSTFASATVEQLRSANGRVELREKATEDIKASLTRAVGQPVIERVLFTDFV 163

Query: 171 I 171
           I
Sbjct: 164 I 164


>gi|308187296|ref|YP_003931427.1| Flagellar fliL protein [Pantoea vagans C9-1]
 gi|308057806|gb|ADO09978.1| Flagellar fliL protein [Pantoea vagans C9-1]
          Length = 161

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/178 (14%), Positives = 53/178 (29%), Gaps = 31/178 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           + +   +G++ K+ +   ++ T             M+    G K E              
Sbjct: 2   SDNAKAKGSKRKILIPVLIILTLAACSVAGYAVWRMMNKHEGDKPEVA------------ 49

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIPDKVFL----E 118
                            F+L     N  +    P   L +   L   D   +  +     
Sbjct: 50  -------KVEPPPAPVFFALDTFTVNLVNPDNDPDRVLYVGFTLRLADEESRSRMNDYLP 102

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
            +   ++  +   S   +   QG +   E I++      VK +    V+ V+F  FI+
Sbjct: 103 EVRSRLLLLLSRQSAAALATEQGKQALVEQIKQALTPPLVKGQPPQAVNDVLFTAFIL 160


>gi|91976163|ref|YP_568822.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisB5]
 gi|91682619|gb|ABE38921.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris BisB5]
          Length = 167

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/118 (16%), Positives = 44/118 (37%), Gaps = 8/118 (6%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDK 114
             +     H      +K      +  I+ N   SP + ++       L++         K
Sbjct: 49  AGHKDDKHHAEAAEKVKPPSFIEVPEIMVNLAGSPGERVQYLKAKIVLEVKDEKLVEQIK 108

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
             +  +      Y+R +    + G+ G    KE++  RV +  +   VS+++F+  ++
Sbjct: 109 PTMPRITDLFQTYLRELRSGDLNGSVGMFRMKEELTRRVNVAIAPAQVSALLFKEVLV 166


>gi|326404074|ref|YP_004284156.1| flagellar FliL protein [Acidiphilium multivorum AIU301]
 gi|325050936|dbj|BAJ81274.1| flagellar FliL protein [Acidiphilium multivorum AIU301]
          Length = 170

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 54/176 (30%), Gaps = 31/176 (17%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
                    + ++ KLFV    V   + +  G     ++                     
Sbjct: 18  EAGAEEAPAKSSRRKLFVIGGAVAAIMLLVVGLWITGIL--------------------- 56

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNF--DSSPKDWLRLDIALICKDIPDKVF---- 116
                 +   +   L       +  I+ N    S    +++L+  +   D          
Sbjct: 57  ---PHLLGQRNHHKLAGPVYVKVPEIVANLNVPSGQDSYVKLEATIELADPKSAKIAMTD 113

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
           +  +      Y+R +   ++ GA G    +E +  RVK+ +    V  ++F+  I+
Sbjct: 114 MPRVVDVFETYLRAMRPDELRGASGTYRLREALINRVKIATAPAIVKDILFQELIV 169


>gi|284007161|emb|CBA72443.1| flagellar basal body-associated protein FliL [Arsenophonus
           nasoniae]
          Length = 183

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 58/182 (31%), Gaps = 38/182 (20%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS      + I G    + +T   ++T +  F       ++                   
Sbjct: 28  MSKSQHQGKRISG----ILLTIMALFTLLSCFIAGYSWWLL------------------- 64

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS--PKDWLRLDIALICKDIPDKVF-- 116
                 +  H  +  SL      SL+P   N          L +DI L       +    
Sbjct: 65  --QAKEQDEHQPEKRSLVIPVFMSLEPFTVNLIDDEKRDRVLYIDITLRLTSEETRKRLH 122

Query: 117 --LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTF 169
             +  +   I+  +   +  ++    G  +   +I++ +K       S+  ++ V+F TF
Sbjct: 123 DFMPEVRSRIL--LSRQNATELATDTGKVHLMSEIKQVLKPTFELEESEQIITDVLFTTF 180

Query: 170 II 171
           I+
Sbjct: 181 IL 182


>gi|237731992|ref|ZP_04562473.1| flagellar biosynthesis protein [Citrobacter sp. 30_2]
 gi|226907531|gb|EEH93449.1| flagellar biosynthesis protein [Citrobacter sp. 30_2]
          Length = 155

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/175 (12%), Positives = 49/175 (28%), Gaps = 31/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   + ++  +++   V+ T             M                        
Sbjct: 2   TDSAINKKSKRAIWIPLLVLITLAACATAGYSYWRM---------------------QQQ 40

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
             +    +         F+L     N   +    L + I L  KD         +L  + 
Sbjct: 41  PSASVKAEPPPPPAPVFFALDTFTVNLGDA-DRVLYIGITLRMKDEATRSRLNEYLPEVR 99

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++      +   +   +G +     I+E +    +  Q    V+ V++  FI+
Sbjct: 100 SRLLLLFSRQNAATLATEEGKQQLITAIKETLATPLVVGQPKQVVTDVLYTAFIL 154


>gi|332305665|ref|YP_004433516.1| flagellar basal body-associated protein FliL [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332172994|gb|AEE22248.1| flagellar basal body-associated protein FliL [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 175

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/181 (8%), Positives = 58/181 (32%), Gaps = 17/181 (9%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   +   G +    +   ++   + +        ++       +++   +     
Sbjct: 1   MAEEELQMEE--GGKKSKLMMIIIIVVVLLLGGSAAAYFLLGG-----EDDAAMEAGAEQ 53

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKD----IPDKV 115
              +S  +  +    +   L +    PI  N    +    + + + L+ +        K+
Sbjct: 54  TQGSSDGASMSAPVKTGTALYVAIPNPITFNVPGTTRDRLVEIKVQLMVRGSDAEEQVKM 113

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            + ++   +       +   +    G    +++  + V+   +       V  V+F  F+
Sbjct: 114 HIPSIQGALNRAFSQANADDLITEAGKATIRDNALKEVQKTLKDVSGNELVEQVLFTGFV 173

Query: 171 I 171
           +
Sbjct: 174 M 174


>gi|170741216|ref|YP_001769871.1| flagellar basal body-associated protein FliL [Methylobacterium sp.
           4-46]
 gi|168195490|gb|ACA17437.1| flagellar basal body-associated protein FliL [Methylobacterium sp.
           4-46]
          Length = 163

 Score = 65.6 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 42/175 (24%), Positives = 76/175 (43%), Gaps = 17/175 (9%)

Query: 1   MSYD-DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+   D+T+   +G    L +    +             +  +     +K+ + Q     
Sbjct: 1   MADSPDSTTAPKKGKGWLLALAVLTLGAGGTGGGLGYYLLTTVEKAVDKKKTEEQARAEK 60

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD---KVF 116
                   S  +             + P++TN   S + W+RL+ ++I +        V 
Sbjct: 61  VLTYTGDLSTRS-------------VGPLVTNLVDSGEMWVRLEGSIIYRTGAVANPDVA 107

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           +  + QDI+AY+RTVS+ Q+ GA G  + +ED+ ERV LR++G V  ++  T II
Sbjct: 108 VAEIRQDILAYLRTVSLAQLQGASGLMHLREDLNERVMLRTKGAVRELVVETLII 162


>gi|304398861|ref|ZP_07380731.1| flagellar basal body-associated protein FliL [Pantoea sp. aB]
 gi|304353565|gb|EFM17942.1| flagellar basal body-associated protein FliL [Pantoea sp. aB]
          Length = 161

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 52/178 (29%), Gaps = 31/178 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           + +   +G + KL +   ++ T             M+    G K E              
Sbjct: 2   SDNAKAKGRKRKLLIPVLLIVTLAACSAAGYAVWRMMNKHEGDKPEVA------------ 49

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIP----DKVFLE 118
                            F+L     N  +    P   L +   L   D         +L 
Sbjct: 50  -------KVEPPPAPVFFALDTFTVNLVNPDNDPDRVLYVGFTLRLADEDTRRRLNDYLP 102

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
            +   ++  +   S   +   QG +   E I++      VK +    VS V+F  FI+
Sbjct: 103 EVRSRLLLLLSRQSAAALATEQGKQALVEQIKQALTPPLVKGQPPQAVSDVLFTAFIL 160


>gi|307824485|ref|ZP_07654710.1| flagellar basal body-associated protein FliL [Methylobacter
           tundripaludum SV96]
 gi|307734469|gb|EFO05321.1| flagellar basal body-associated protein FliL [Methylobacter
           tundripaludum SV96]
          Length = 167

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/176 (9%), Positives = 50/176 (28%), Gaps = 15/176 (8%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +      + +  KL +        + +  G    ++      G+K E   +     
Sbjct: 1   MAELEQEGGEGKKSPKKLIIIIVAAVILLAVGGGVTFFLMKGDSSKGEKVEHVDEDEAAA 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
             +     +     +   K                 +  + + +         K     +
Sbjct: 61  HAEKLYFDMSKPIVVDFPKG----------ATVKHGRITVSILVEGAETIEVLKKNEPMM 110

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
             +++  I       +   +G     + + +      +K+  +G V  + F +F++
Sbjct: 111 RNNLLMLIGAQDPANLNTREGKEMLAKAMLDDVTAVLIKMAGKGQVKEIFFTSFVM 166


>gi|257095344|ref|YP_003168985.1| flagellar basal body-associated protein FliL [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257047868|gb|ACV37056.1| flagellar basal body-associated protein FliL [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 182

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/134 (14%), Positives = 46/134 (34%), Gaps = 14/134 (10%)

Query: 52  KYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKD 110
              +   +               +  +     +L     N    +   +L+L ++L  +D
Sbjct: 48  HAPEQDDDGEVAVEKAKPVKKKKVDREVPIYVALDAFTVNLVPDNGDQFLQLVMSLEVED 107

Query: 111 IPD----KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-------- 158
                  K++   L  D+   + +    Q+   +G     ++I+E++    +        
Sbjct: 108 AQVADHLKMYTPKLRNDLTLLLSSKKASQLISKEGKELLAQEIKEQINGIIEPASKGKKR 167

Query: 159 -GFVSSVIFRTFII 171
            G +  V+F +FII
Sbjct: 168 DGPIKEVLFTSFII 181


>gi|187926919|ref|YP_001893264.1| flagellar basal body-associated protein FliL [Ralstonia pickettii
           12J]
 gi|241665248|ref|YP_002983607.1| flagellar basal body-associated protein FliL [Ralstonia pickettii
           12D]
 gi|187728673|gb|ACD29837.1| flagellar basal body-associated protein FliL [Ralstonia pickettii
           12J]
 gi|240867275|gb|ACS64935.1| flagellar basal body-associated protein FliL [Ralstonia pickettii
           12D]
          Length = 164

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/171 (12%), Positives = 53/171 (30%), Gaps = 33/171 (19%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           +G   KL +   +V   +G+        +                        +  +   
Sbjct: 15  KGGSTKLLLIILIVLVLVGMGGAAAWFFL----------------------GGANHTASA 52

Query: 72  GDTISLKKLQIFSLQPIITNFD--SSPKDWLRLDIAL----ICKDIPDKVFLETLHQDIM 125
                 K+    +++ +  N         +L++ I         +   K +   L   I+
Sbjct: 53  SAPAKPKEPIFVAMETLTVNLQPEEGNDRYLQVGITFKSFNKHAEDEIKTYTPELRSRIL 112

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
             + + +  ++  A G     ++I E+ +        +  V+ V+F  F+I
Sbjct: 113 TLLASKTPTELYPAVGKAKLAKEIVEQCEQVYKAVGKESPVADVLFTNFVI 163


>gi|682649|gb|AAA62448.1| FliL [Caulobacter crescentus CB15]
          Length = 204

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 46/118 (38%), Gaps = 7/118 (5%)

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIP----DK 114
               + R   +GD      +  ++L  I+ N  ++     +L+L +     D        
Sbjct: 86  AEKGAERRWDSGDQGGPDGVVFYTLPDIVVNMQTADGKSTFLKLKLTFELPDEETADELT 145

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
             L  L      ++R +  + + G+QG    + ++  RV L  +   V++V+    +I
Sbjct: 146 PNLPRLQDMFQTFLRELRPEDLNGSQGTYQLRVELLRRVNLVAAPAKVNAVLIEEMLI 203


>gi|16765313|ref|NP_460928.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|56413112|ref|YP_150187.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|161613456|ref|YP_001587421.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|162139573|ref|YP_216967.2| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|167552792|ref|ZP_02346543.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|167993550|ref|ZP_02574644.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168234148|ref|ZP_02659206.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168239215|ref|ZP_02664273.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168244826|ref|ZP_02669758.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168259738|ref|ZP_02681711.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168462483|ref|ZP_02696414.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168823018|ref|ZP_02835018.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194442590|ref|YP_002041240.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194450316|ref|YP_002046026.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194470139|ref|ZP_03076123.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194736445|ref|YP_002115009.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197248979|ref|YP_002146048.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197264611|ref|ZP_03164685.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197362038|ref|YP_002141675.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|198243515|ref|YP_002215111.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200390261|ref|ZP_03216872.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204930992|ref|ZP_03221818.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|207856512|ref|YP_002243163.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|224583526|ref|YP_002637324.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|120343|sp|P26417|FLIL_SALTY RecName: Full=Flagellar protein FliL
 gi|154034|gb|AAA27103.1| fliL flagellar protein [Salmonella enterica subsp. enterica serovar
           Typhimurium]
 gi|16420510|gb|AAL20887.1| flagellar biosynthesis [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56127369|gb|AAV76875.1| FliL protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. ATCC 9150]
 gi|161362820|gb|ABX66588.1| hypothetical protein SPAB_01173 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401253|gb|ACF61475.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194408620|gb|ACF68839.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194456503|gb|EDX45342.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194711947|gb|ACF91168.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195634549|gb|EDX52901.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197093515|emb|CAR58976.1| FliL protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. AKU_12601]
 gi|197212682|gb|ACH50079.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197242866|gb|EDY25486.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197288065|gb|EDY27452.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197938031|gb|ACH75364.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199602706|gb|EDZ01252.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204320036|gb|EDZ05241.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205322650|gb|EDZ10489.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205328402|gb|EDZ15166.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331870|gb|EDZ18634.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205336369|gb|EDZ23133.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205340687|gb|EDZ27451.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205350735|gb|EDZ37366.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206708315|emb|CAR32618.1| FliL protein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|224468053|gb|ACN45883.1| flagellar biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261247141|emb|CBG24964.1| FliL protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267993964|gb|ACY88849.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301158489|emb|CBW17999.1| flagella biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912965|dbj|BAJ36939.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320085406|emb|CBY95187.1| Flagellar fliL protein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321224620|gb|EFX49683.1| Flagellar biosynthesis protein FliL [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322715026|gb|EFZ06597.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323130254|gb|ADX17684.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|326622859|gb|EGE29204.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|332988864|gb|AEF07847.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 155

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 49/175 (28%), Gaps = 31/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   + ++  +++   V+ T             M                        
Sbjct: 2   TDSAINKKSKRSIWIPLLVLITLAACATAGYSYWRM---------------------QQQ 40

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
             +    +         F+L     N   +    L + + L  KD         +L  + 
Sbjct: 41  PTTNAKAEPAPPPAPVFFALDTFTVNLGDA-DRVLYIGVTLRLKDEATRARLNEYLPEVR 99

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
             ++      +  +++   G +     I+E +         +  V+ V++  FI+
Sbjct: 100 SRLLLLFSRQNAAELSTEAGKQKLIAAIKETLAAPLVAGQPKQVVTDVLYTAFIL 154


>gi|322616968|gb|EFY13876.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322618207|gb|EFY15099.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322625878|gb|EFY22697.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322626330|gb|EFY23140.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322632745|gb|EFY29490.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322639087|gb|EFY35780.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322640403|gb|EFY37059.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322647236|gb|EFY43735.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322649916|gb|EFY46337.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322655524|gb|EFY51832.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660302|gb|EFY56540.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322662983|gb|EFY59190.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322668168|gb|EFY64327.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674073|gb|EFY70167.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322675575|gb|EFY71649.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322683014|gb|EFY79030.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686708|gb|EFY82686.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323195404|gb|EFZ80584.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323198068|gb|EFZ83185.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323204460|gb|EFZ89466.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323207550|gb|EFZ92498.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323211011|gb|EFZ95871.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323217535|gb|EGA02254.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323220732|gb|EGA05176.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323226681|gb|EGA10878.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323231557|gb|EGA15670.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323236000|gb|EGA20079.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323240570|gb|EGA24613.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323245462|gb|EGA29462.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323247580|gb|EGA31531.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323253957|gb|EGA37781.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323255515|gb|EGA39276.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323262113|gb|EGA45676.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323266236|gb|EGA49726.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323270655|gb|EGA54096.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
          Length = 155

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 49/175 (28%), Gaps = 31/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   + ++  +++   V+ T             M                        
Sbjct: 2   TDSAINKKSKRSIWIPLLVLITLTACATAGYSYWRM---------------------QQQ 40

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
             +    +         F+L     N   +    L + + L  KD         +L  + 
Sbjct: 41  PTTNAKAEPAPPPAPVFFALDTFTVNLGDA-DRVLYIGVTLRLKDEATRARLNEYLPEVR 99

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
             ++      +  +++   G +     I+E +         +  V+ V++  FI+
Sbjct: 100 SRLLLLFSRQNAAELSTEAGKQKLIAAIKETLAAPLVAGQPKQVVTDVLYTAFIL 154


>gi|188534126|ref|YP_001907923.1| flagellar basal body-associated protein FliL [Erwinia tasmaniensis
           Et1/99]
 gi|188029168|emb|CAO97040.1| Flagellar fliL protein [Erwinia tasmaniensis Et1/99]
          Length = 160

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/178 (13%), Positives = 46/178 (25%), Gaps = 32/178 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   R  + KL +   V+   IG           +                       
Sbjct: 2   TDSAKSRSGKRKLLILMVVIVALIGCGVAGYTVWKRM--------------------KAP 41

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIPDKVFL----E 118
                            F+L     N  +    P   L +   L   D   +  +     
Sbjct: 42  ADPTAVAKHQPPAIPVFFALDTFTVNLINPDNDPDRVLYVGFTLRLPDEETRRRMSDYLP 101

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
            +   ++  +   +   +    G       I++      V+ + Q  V+ V+F  FI+
Sbjct: 102 EIRSRLLLLLSRQTAASLASEHGKEQLVTQIKQTLAPQLVQGQPQQAVTDVLFTAFIL 159


>gi|323496549|ref|ZP_08101603.1| flagellar basal body-associated protein FliL [Vibrio sinaloensis
           DSM 21326]
 gi|323318393|gb|EGA71350.1| flagellar basal body-associated protein FliL [Vibrio sinaloensis
           DSM 21326]
          Length = 165

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 58/181 (32%), Gaps = 27/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++  ++  +G    + +   VV   +G          ++                + 
Sbjct: 1   MAVEEVETEAPKGKGKLIIIIVAVVVLLLGGGGAAFF---LMGS--------------DE 43

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKV---- 115
                  +       +     +   QP I N         +++ + L+ +   ++     
Sbjct: 44  PAAEEAAAQEEVVVSTEPVAYVNIAQPFIFNVTGDKRDRLVQIKVQLMVRGTENENLARY 103

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
               +   +++   + +++Q+  A G    ++   E +K        Q  +  V+F  F+
Sbjct: 104 HSPLVESSLLSTFASATVEQLRTANGRIELRDKATEDIKASLSRAVGQPVIERVLFTDFV 163

Query: 171 I 171
           I
Sbjct: 164 I 164


>gi|118589976|ref|ZP_01547380.1| flagellar basal body-associated protein FliL [Stappia aggregata IAM
           12614]
 gi|118437473|gb|EAV44110.1| flagellar basal body-associated protein FliL [Stappia aggregata IAM
           12614]
          Length = 166

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 35/146 (23%), Positives = 71/146 (48%), Gaps = 8/146 (5%)

Query: 34  GWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVR-----SVHTGDTISLKKLQIFSLQPI 88
           G++  +V+L L  G       K++ +   +            T         ++  L+P+
Sbjct: 20  GFVAAMVLLTLIGGGAGAGLAKYVADYTEEEVHGRLRQQQSFTDTLPFSPSTRLQRLEPL 79

Query: 89  ITNFDSSPKDWLRLDIALICKDIPDK---VFLETLHQDIMAYIRTVSIKQITGAQGFRYF 145
           +TN  S    W+R+  +++ +D PD    V  + +  D + Y+RT+++  + G  G ++ 
Sbjct: 80  VTNLASPQDAWIRVQASILLEDDPDGDAGVLKKKVEDDFLGYMRTLTLSHLEGGIGLQHL 139

Query: 146 KEDIEERVKLRSQGFVSSVIFRTFII 171
           +ED+ ER + R++G VS VI  + +I
Sbjct: 140 REDLTERAQTRTRGQVSEVILESVVI 165


>gi|114320134|ref|YP_741817.1| flagellar basal body-associated protein FliL [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114226528|gb|ABI56327.1| flagellar basal body-associated protein FliL [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 161

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 11/114 (9%), Positives = 36/114 (31%), Gaps = 10/114 (8%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKVFLETLHQ 122
                +    + + I     +  NF+   +  +L+  + L  +           +  +  
Sbjct: 47  DEPQVEQALDEPIYIELDPALTVNFERGGRISYLQARVQLETRYASVEEAIDRHMPVIRN 106

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
           +++        +++    G    ++   E V         +  + +V F  F++
Sbjct: 107 NLLDLFADQDYQEVNTRAGREALRQAALEEVNQVLAERGVEQRLEAVYFTRFVM 160


>gi|226941272|ref|YP_002796346.1| FliL [Laribacter hongkongensis HLHK9]
 gi|226716199|gb|ACO75337.1| FliL [Laribacter hongkongensis HLHK9]
          Length = 162

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 12/101 (11%), Positives = 38/101 (37%), Gaps = 8/101 (7%)

Query: 79  KLQIFSLQPIITNFDSSP---KDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQ 135
                 +   + N        +  L+++++        K ++  +  +++  + + +  +
Sbjct: 59  VPVFEKIDTFVVNLGGHDTVLQTELQVELSDEAGREMLKQYMPRIRNNLIMLLSSKTADE 118

Query: 136 ITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
           +  A+G    +  I   +         +  V SV+F +FI+
Sbjct: 119 VATAEGKARLRGQIRSVINESLAETGRRDVVRSVVFNSFIV 159


>gi|121608104|ref|YP_995911.1| flagellar basal body-associated protein FliL [Verminephrobacter
           eiseniae EF01-2]
 gi|121552744|gb|ABM56893.1| flagellar basal body-associated protein FliL [Verminephrobacter
           eiseniae EF01-2]
          Length = 208

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/204 (11%), Positives = 46/204 (22%), Gaps = 57/204 (27%)

Query: 8   SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVR 67
                G +             + + CG +   V                     + +   
Sbjct: 21  KPPAAGKKKLFIGIIIGTVALVLVTCGAVAWFV-----------------NRCMHADDEE 63

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKD----IPDKVFLETLHQ 122
                   +        L+ ++ N        + ++ I L  +D       +  L  +  
Sbjct: 64  GGICPRRNAPAASIFLPLENMVVNLADPGGDRFAQIGITLELEDARAEDRIRQHLPVIRN 123

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERV-------------------------KLRS 157
            I+      S  ++    G      DI   V                         +  +
Sbjct: 124 AILMLASQRSSAELLQRNGKEKLAADILREVSRPLGYPVLAQRERAAAGPPSQPSQQEAA 183

Query: 158 QGF----------VSSVIFRTFII 171
            G           V  V+F +FII
Sbjct: 184 PGRASSASMERNPVRRVLFSSFII 207


>gi|86750894|ref|YP_487390.1| flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris HaA2]
 gi|86573922|gb|ABD08479.1| Flagellar basal body-associated protein FliL [Rhodopseudomonas
           palustris HaA2]
          Length = 167

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/118 (16%), Positives = 44/118 (37%), Gaps = 8/118 (6%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDK 114
             +     H      +K      +  I+ N   SP + ++       L++         K
Sbjct: 49  KGHDAEKEHAEAAEKVKPPTFVEVPEIMVNLAGSPGERVQYLKAKIVLELKDEKLVEQIK 108

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
             +  +      Y+R +    + G+ G    KE++  RV +  +   V++V+F+  ++
Sbjct: 109 PTMPRITDLFQTYLRELRSGDLNGSVGMFRMKEELTRRVNVAIAPAQVTAVLFKEVLV 166


>gi|270262387|ref|ZP_06190658.1| flagellar basal body-associated protein FliL [Serratia odorifera
           4Rx13]
 gi|270043071|gb|EFA16164.1| flagellar basal body-associated protein FliL [Serratia odorifera
           4Rx13]
          Length = 160

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 41/122 (33%), Gaps = 12/122 (9%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFD---SSPKDWLRLDIALICKDIP----DK 114
             +   +      +         L     N     ++P   L + + L   D        
Sbjct: 38  KQHKDGAQPAAKALPPAAPVFMPLDTFTVNLVTPDNNPDRVLYIGLTLRLPDENTRRQLN 97

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTF 169
            FL  +   ++  +    + Q++  QG +     I++      VK + +  VS V+F  F
Sbjct: 98  DFLPEVRSRLLMLLSRQEVGQLSSEQGKQQLVAQIKDVLSPPLVKGQPKQVVSDVLFTAF 157

Query: 170 II 171
           I+
Sbjct: 158 IL 159


>gi|330899435|gb|EGH30854.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. japonica str. M301072PT]
          Length = 157

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/158 (9%), Positives = 45/158 (28%), Gaps = 19/158 (12%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           S +          + KL +    V   +      +G    L   +  K +        N 
Sbjct: 4   SEEVKDPATTGKGKGKLKLIIIAVVALLLAVGLSVGATWFLMHKSESKVDPAAAAAAANV 63

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDKVF 116
              +V                      + NF+++ +  ++++ I +           KV 
Sbjct: 64  KPVAVFEP--------------MTPAFVVNFNANGRQRYMQVSITMLGRNAADMEALKVH 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK 154
           +  +  +++     +  + +    G    ++     ++
Sbjct: 110 MPLIRNNLVMLFAAIPFESLASPIGKEMLRQKATASIQ 147


>gi|83747639|ref|ZP_00944675.1| FliL [Ralstonia solanacearum UW551]
 gi|207728362|ref|YP_002256756.1| flagellar flil protein [Ralstonia solanacearum MolK2]
 gi|83725691|gb|EAP72833.1| FliL [Ralstonia solanacearum UW551]
 gi|206591608|emb|CAQ57220.1| flagellar flil protein [Ralstonia solanacearum MolK2]
          Length = 165

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 55/181 (30%), Gaps = 32/181 (17%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +  +T     +G   KL +   +V   IG+        +                     
Sbjct: 5   AAANTVPAPAKGGSTKLLLIILIVLVLIGMGGAAAWFFL--------------------- 43

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFD--SSPKDWLRLDIALICKD----IPDKV 115
              S  +         K+     ++ +  N         +L++ I     D       K 
Sbjct: 44  GGGSHAAAGPAAPPKPKEPYFVPMETLTVNLQPEEGNDRYLQIAITFKSYDKHAEEAIKA 103

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
           +   L   ++  + + +  ++   +G     +++ E+ +        +  ++ V+F  F+
Sbjct: 104 YTPELRSRVLMLLSSKAPAELYSNEGKAKLAKEVVEQCEQAYKAVGKESPIADVLFTNFV 163

Query: 171 I 171
           I
Sbjct: 164 I 164


>gi|94495435|ref|ZP_01302015.1| hypothetical protein SKA58_05285 [Sphingomonas sp. SKA58]
 gi|94424823|gb|EAT09844.1| hypothetical protein SKA58_05285 [Sphingomonas sp. SKA58]
          Length = 206

 Score = 64.8 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/137 (12%), Positives = 38/137 (27%), Gaps = 13/137 (9%)

Query: 48  QKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQ---IFSLQPIITNFDSSPKDWLRLDI 104
            K            +           T +         F LQ   T+  S    + ++ +
Sbjct: 69  AKAHAAPHGEAGALHAMPHGKGIDLPTPANPAAYQATYFQLQAPFTSNMSDTDAFAQISV 128

Query: 105 ALICKDI-----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ- 158
           A+            K     +   ++  +     + +   +G +  +  I   +    + 
Sbjct: 129 AVSTYYDMRVIDAIKTHEMAIRSQVLMMLAQQPQEVLDTPKGKQMLQGKIRTIINDILKQ 188

Query: 159 ----GFVSSVIFRTFII 171
               G V +V F  F+I
Sbjct: 189 KTGYGGVDNVYFTNFVI 205


>gi|290475710|ref|YP_003468599.1| flagellar biosynthesis protein [Xenorhabdus bovienii SS-2004]
 gi|289175032|emb|CBJ81835.1| flagellar biosynthesis [Xenorhabdus bovienii SS-2004]
          Length = 158

 Score = 64.8 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 15/114 (13%), Positives = 35/114 (30%), Gaps = 12/114 (10%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPK---DWLRLDIALICKDIPDKVFL----ETLHQ 122
            T     +      +L+    N   +       L + + L   D   +         +  
Sbjct: 44  STEKAKVISTPVFMTLENFTVNLIDNEDHIDRVLYVGVTLRLPDEKTRQRFHDYLPEVRS 103

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERV---KLRSQG--FVSSVIFRTFII 171
            ++  +       +    G      DI++ +    +  +    V+ V+F TFI+
Sbjct: 104 RMLLLLSRQKAIDLAKNDGKMRLMADIKQTLHPTMIPGEPDQVVTDVLFTTFIL 157


>gi|163852466|ref|YP_001640509.1| flagellar basal body-associated protein FliL [Methylobacterium
           extorquens PA1]
 gi|218531222|ref|YP_002422038.1| flagellar basal body-associated protein FliL [Methylobacterium
           chloromethanicum CM4]
 gi|240139803|ref|YP_002964280.1| Flagellar fliL protein [Methylobacterium extorquens AM1]
 gi|254562218|ref|YP_003069313.1| flagellar fliL protein [Methylobacterium extorquens DM4]
 gi|163664071|gb|ABY31438.1| flagellar basal body-associated protein FliL [Methylobacterium
           extorquens PA1]
 gi|218523525|gb|ACK84110.1| flagellar basal body-associated protein FliL [Methylobacterium
           chloromethanicum CM4]
 gi|240009777|gb|ACS41003.1| Flagellar fliL protein [Methylobacterium extorquens AM1]
 gi|254269496|emb|CAX25462.1| Flagellar fliL protein [Methylobacterium extorquens DM4]
          Length = 172

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 18/122 (14%), Positives = 44/122 (36%), Gaps = 9/122 (7%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK----DWLRLDIALICKDIPDK 114
              + ++             +     ++ ++ N    P     + L+L +AL  KD   +
Sbjct: 50  RAAHADAHGEHGAEKLDPKAQAVFLDMRDMLVNLSPDPGATKSNVLKLRVALELKDAKVE 109

Query: 115 V----FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTF 169
                 +  +      Y+R +    + G+ G    +E++  RV +        +V+F+  
Sbjct: 110 ATVKPLMPRVEDAFQTYLREIRASDLAGSAGLYRLREELLRRVNIALHPAKAEAVLFKDV 169

Query: 170 II 171
           I+
Sbjct: 170 IV 171


>gi|168186130|ref|ZP_02620765.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           C str. Eklund]
 gi|169295729|gb|EDS77862.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           C str. Eklund]
          Length = 163

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/182 (13%), Positives = 58/182 (31%), Gaps = 31/182 (17%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  S  + G   K+ +  F+    +                           + + 
Sbjct: 1   MAETENRSSKV-GGIFKVILIVFLAVILL------------------GGGVFGGYVVASK 41

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD--SSPKDWLRLDIALICKD-------- 110
                + S+ +    +L       L   + N     +   +L+ +I++   D        
Sbjct: 42  TNPKGMASIGSIPQDTLNLKTF-GLDEFLLNLKSDDNSSKYLKTNISIGYADVKENKELE 100

Query: 111 IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
              K     +   I + +R+   +     +     K++I+++V  L  +G + +V F   
Sbjct: 101 DELKNKKAIIRDTINSVLRSKKKEDFATNEQVERIKKEIKDKVNPLLQKGQIYNVYFSEI 160

Query: 170 II 171
           II
Sbjct: 161 II 162


>gi|300696949|ref|YP_003747610.1| flagellar basal body-associated protein FliL [Ralstonia
           solanacearum CFBP2957]
 gi|299073673|emb|CBJ53193.1| Flagellar basal body-associated protein FliL [Ralstonia
           solanacearum CFBP2957]
          Length = 165

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 55/181 (30%), Gaps = 32/181 (17%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +  +T     +G   KL +   +V   IG+        +                     
Sbjct: 5   AAANTVPAPAKGGSTKLLLIILIVLVLIGMGGAAAWFFL--------------------- 43

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFD--SSPKDWLRLDIALICKD----IPDKV 115
              S  +         K+     ++ +  N         +L++ I     D       K 
Sbjct: 44  GGGSHAAAGPAAPPKPKEPYFVPMETLTVNLQPEEGNDRYLQIAITFKSYDKHAEEAIKS 103

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
           +   L   ++  + + +  ++   +G     +++ E+ +        +  ++ V+F  F+
Sbjct: 104 YTPELRSRVLMLLSSKAPTELYSNEGKAKLAKEVVEQCEQAYKAVGKESPIADVLFTNFV 163

Query: 171 I 171
           I
Sbjct: 164 I 164


>gi|295678043|ref|YP_003606567.1| flagellar basal body-associated protein FliL [Burkholderia sp.
           CCGE1002]
 gi|295437886|gb|ADG17056.1| flagellar basal body-associated protein FliL [Burkholderia sp.
           CCGE1002]
          Length = 166

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 39/119 (32%), Gaps = 11/119 (9%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDI----PDKVFL 117
             V                F L+ +  N  S      +LR+ + L   D          +
Sbjct: 47  APVAVSAEAAPALSAAPLFFPLESMTVNLQSDDGQQHFLRIGLTLKLGDAGTQQALTDHM 106

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFII 171
             +   I+  +     +++   +G R   E+++  +     +  +   V  V+F  F++
Sbjct: 107 PEVRSRILLALSNKHPEELAPLEGKRALAEELKTLITEPIERGVAPIRVQDVLFTEFVV 165


>gi|255021442|ref|ZP_05293489.1| Flagellar biosynthesis protein fliL [Acidithiobacillus caldus ATCC
           51756]
 gi|254969147|gb|EET26662.1| Flagellar biosynthesis protein fliL [Acidithiobacillus caldus ATCC
           51756]
          Length = 166

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/129 (14%), Positives = 47/129 (36%), Gaps = 20/129 (15%)

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDI----PDKVF 116
            ++  +          K++   L  ++TN  SS     ++++++ L   D       K  
Sbjct: 37  PSAAPTPAQIAKEREAKVKFIDLGSLVTNLQSSDGSTHYIQVEVQLKTYDPSIDAKVKAL 96

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR--------------SQGFVS 162
           +  +   I+  +      Q+   Q       +I++RV                 ++  ++
Sbjct: 97  MPEIRNSILLLLAAQHADQVGQPQVRTDLLNEIKKRVNGILDSDGGTLPAAQTSAKQPIA 156

Query: 163 SVIFRTFII 171
           +V F +F+I
Sbjct: 157 AVYFSSFVI 165


>gi|77463630|ref|YP_353134.1| flagellar biosynthesis protein, FliL [Rhodobacter sphaeroides
           2.4.1]
 gi|332558486|ref|ZP_08412808.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides WS8N]
 gi|3435104|gb|AAC32318.1| flagellar protein [Rhodobacter sphaeroides]
 gi|77388048|gb|ABA79233.1| flagellar biosynthesis protein, FliL [Rhodobacter sphaeroides
           2.4.1]
 gi|332276198|gb|EGJ21513.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides WS8N]
          Length = 190

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/150 (14%), Positives = 43/150 (28%), Gaps = 16/150 (10%)

Query: 38  GIVMLFLFAGQK------EEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITN 91
                   +  K      E   +        D   +               +  +  +T 
Sbjct: 40  YFYFANPLSPAKDVLRLIERTPEADEPAADPDAPQKVPRPTPERESFVTSYYQFKEPLTT 99

Query: 92  FDSSPKDWLRLDIALICKDI-----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFK 146
              + +  L+  I L  +               L  D++A + T S +++    G     
Sbjct: 100 NLRASRRLLQAGIGLSTQYDQKVMDNVARNEVALRSDMLAIVGTFSEEELQDKAGRDRLA 159

Query: 147 EDIEERVKLRSQ-----GFVSSVIFRTFII 171
           E +   V  R Q     G + +V F +FI+
Sbjct: 160 EALRGAVNARLQQLEGFGGIEAVFFPSFIL 189


>gi|56551538|ref|YP_162377.1| flagellar basal body-associated protein FliL [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|241761176|ref|ZP_04759265.1| flagellar basal body-associated protein FliL [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|260752862|ref|YP_003225755.1| flagellar basal body-associated protein FliL [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|56543112|gb|AAV89266.1| flagellar basal body-associated protein FliL [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|241374795|gb|EER64256.1| flagellar basal body-associated protein FliL [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|258552225|gb|ACV75171.1| flagellar basal body-associated protein FliL [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 189

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 54/188 (28%), Gaps = 17/188 (9%)

Query: 1   MSYDDTTSQYIRG-----NQHKLFVTWFVVYTFIGIFCGWLGG--IVMLFLFAGQKEEKY 53
           MS D+       G      +  + V   VV   +G   G       +           K 
Sbjct: 1   MSEDNAKLPKKGGLLKSIGKILILVVIIVVLVALGSVAGGYFLPRYMPAIFAPATANNKA 60

Query: 54  QKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP- 112
                +      V       +    K   F+      +   +  + +++ I +       
Sbjct: 61  AASKADENLPKKVPLDEKDASSGQFKASYFAFDKPFISNVQNSGNLVQIGIGISTYYDDR 120

Query: 113 ----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-----GFVSS 163
                K     +   I+  I     + I+   G +  +  I++ +    +     G V S
Sbjct: 121 VINNVKKDELPIRSAILMTISNQDNQTISTEAGKKQLQNQIKDVINNVLKDKEGFGGVDS 180

Query: 164 VIFRTFII 171
           V F +F+I
Sbjct: 181 VYFTSFLI 188


>gi|331005860|ref|ZP_08329212.1| Flagellar biosynthesis protein fliL [gamma proteobacterium
           IMCC1989]
 gi|330420304|gb|EGG94618.1| Flagellar biosynthesis protein fliL [gamma proteobacterium
           IMCC1989]
          Length = 147

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 10/125 (8%), Positives = 40/125 (32%), Gaps = 10/125 (8%)

Query: 57  ILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----I 111
                 +    +      +  + + +      + N+    K  +++++I++  +D     
Sbjct: 21  DEEPAEEAVESTEGEAPGVFTRPIYVPIKPAFVVNYGGEGKLQYMKIEISIRVEDVSSAN 80

Query: 112 PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIF 166
             +  +  L   ++      +   I    G    +    + ++        +  V ++ F
Sbjct: 81  AARHHMPLLRDGLVKLFSRQTDADIDTPDGKERLRLTALKVIQDIIEEEDGEQGVINLFF 140

Query: 167 RTFII 171
             F++
Sbjct: 141 SHFVV 145


>gi|221639473|ref|YP_002525735.1| Flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides KD131]
 gi|221160254|gb|ACM01234.1| Flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides KD131]
          Length = 190

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/150 (14%), Positives = 43/150 (28%), Gaps = 16/150 (10%)

Query: 38  GIVMLFLFAGQK------EEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITN 91
                   +  K      E   +        D   +               +  +  +T 
Sbjct: 40  YFYFANPLSPAKDVLRLIERTPEADEPAADPDAPKKVPRPTPERESFVTSYYQFKEPLTT 99

Query: 92  FDSSPKDWLRLDIALICKDI-----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFK 146
              + +  L+  I L  +               L  D++A + T S +++    G     
Sbjct: 100 NLRASRRLLQAGIGLSTQYDQKVMDNVARNEVALRSDMLAIVGTFSEEELQDKAGRDRLA 159

Query: 147 EDIEERVKLRSQ-----GFVSSVIFRTFII 171
           E +   V  R Q     G + +V F +FI+
Sbjct: 160 EALRGAVNARLQQLEGFGGIEAVFFPSFIL 189


>gi|295688786|ref|YP_003592479.1| flagellar basal body-associated protein FliL [Caulobacter segnis
           ATCC 21756]
 gi|295430689|gb|ADG09861.1| flagellar basal body-associated protein FliL [Caulobacter segnis
           ATCC 21756]
          Length = 202

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/180 (12%), Positives = 52/180 (28%), Gaps = 21/180 (11%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRS---- 68
             +  + +        +    G     +M    A +  E   +                 
Sbjct: 22  KKKPPILIIAIAAGVLVLGGGGAAAFFLMKPKPAAEAGEHGAEEKEKKKEKKKEEGEKKE 81

Query: 69  ----------VHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPDKV- 115
                                +  ++L  I+ N  ++     +L+L +     D      
Sbjct: 82  GEGGAAAAAGPAPVIKEGPDGVVFYTLPDIVVNMQTADGKSTFLKLKLTFELPDEETAEA 141

Query: 116 ---FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
               L  L      ++R +  + + G+QG    + ++  RV L  +   V++V+    +I
Sbjct: 142 LTPNLPRLQDMFQTFLRELRPEDLNGSQGTYQLRVELLRRVNLVAAPAKVNAVLIEEMLI 201


>gi|95929860|ref|ZP_01312601.1| flagellar basal body-associated protein FliL [Desulfuromonas
           acetoxidans DSM 684]
 gi|95134156|gb|EAT15814.1| flagellar basal body-associated protein FliL [Desulfuromonas
           acetoxidans DSM 684]
          Length = 136

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/119 (13%), Positives = 39/119 (32%), Gaps = 6/119 (5%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----D 113
                    +     + +     +  +   I N     +  +L+  I L  ++       
Sbjct: 17  AQQAPAGESAEVEDTSKAEGVGPMVDITDFIINILDKNETRYLKAAITLELENEETVVEV 76

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              +  +   I+  I   +  ++   QG    + +I  R+  L  +G V  + F  F++
Sbjct: 77  NERMPQIRDSILLLIGNKTFAELNDLQGKLQLRAEIIVRLNKLLKKGKVKGIYFTEFVV 135


>gi|221235078|ref|YP_002517514.1| flagellar fliL protein [Caulobacter crescentus NA1000]
 gi|300680947|sp|B8GXB6|FLIL_CAUCN RecName: Full=Flagellar FliL protein
 gi|300680948|sp|P0CG27|FLIL_CAUCR RecName: Full=Flagellar FliL protein
 gi|220964250|gb|ACL95606.1| flagellar fliL protein [Caulobacter crescentus NA1000]
          Length = 205

 Score = 64.4 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 42/119 (35%), Gaps = 7/119 (5%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIP----D 113
                   +           +  ++L  I+ N  ++     +L+L +     D       
Sbjct: 86  AEKGAEGAAGTPVIKEGPDGVVFYTLPDIVVNMQTADGKSTFLKLKLTFELPDEETADEL 145

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
              L  L      ++R +  + + G+QG    + ++  RV L  +   V++V+    +I
Sbjct: 146 TPNLPRLQDMFQTFLRELRPEDLNGSQGTYQLRVELLRRVNLVAAPAKVNAVLIEEMLI 204


>gi|194434973|ref|ZP_03067216.1| flagellar basal body-associated protein FliL [Shigella dysenteriae
           1012]
 gi|194416808|gb|EDX32934.1| flagellar basal body-associated protein FliL [Shigella dysenteriae
           1012]
 gi|332095479|gb|EGJ00495.1| flagellar fliL protein [Shigella dysenteriae 155-74]
          Length = 154

 Score = 64.4 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 48/175 (27%), Gaps = 32/175 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T     + ++  L++   V  T                                  + + 
Sbjct: 2   TDYAISKKSKRSLWIPILVFITLAACASAGYSYW----------------------HSHQ 39

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
           V +        +     ++L     N   +    L + I L  KD         +L  + 
Sbjct: 40  VAAEDKAQQRVVPSPIFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVR 98

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 99  SRLLLLFSRQDAAVLATEEGKKNPIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 153


>gi|331006677|ref|ZP_08329955.1| Flagellar biosynthesis protein fliL [gamma proteobacterium
           IMCC1989]
 gi|330419509|gb|EGG93897.1| Flagellar biosynthesis protein fliL [gamma proteobacterium
           IMCC1989]
          Length = 138

 Score = 64.4 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 16/129 (12%), Positives = 46/129 (35%), Gaps = 10/129 (7%)

Query: 53  YQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDI 111
            +        ++    V   +      +      PII NF S  +  +L+ DI L+ ++ 
Sbjct: 9   EESSETEAVDEDGNPIVEEEEVEKGYAIYFPLKPPIIVNFQSRGRQRFLQADITLLTRED 68

Query: 112 PD----KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVS 162
                 +  +  +   ++      + + +   QG    +++  E      ++   +  + 
Sbjct: 69  DVIDAIETHMPMIRNALVLKFGGQTYEDMQTEQGRELLRQESLEALQNIMLQEIDKTGIE 128

Query: 163 SVIFRTFII 171
            ++F  F++
Sbjct: 129 KLLFTNFVM 137


>gi|88704281|ref|ZP_01101995.1| Flagellar basal body-associated protein FliL [Congregibacter
           litoralis KT71]
 gi|88701332|gb|EAQ98437.1| Flagellar basal body-associated protein FliL [Congregibacter
           litoralis KT71]
          Length = 170

 Score = 64.4 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 17/177 (9%), Positives = 52/177 (29%), Gaps = 28/177 (15%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           D   ++   G + KL +    V   +G         ++L      + +  ++ +      
Sbjct: 12  DAPEAEKKSGGKGKLIIVIVAVVVLLGGG---AAAFLLLSGGDEAEADAVEEVVEEA--- 65

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKVFLE 118
                         K      ++ ++ N +   K  +++ ++ L+             + 
Sbjct: 66  -------------PKVPLYLDVEKLLVNLEYKGKTRYVQAEMQLMGYSQDAIDQASRDMP 112

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK----LRSQGFVSSVIFRTFII 171
            +   ++          +   +G    + D  + V     L     +  + F  F++
Sbjct: 113 AIRDGLITLFSVQDFGALKTIEGKDALRADALKAVNQALGLTPPDGIEKIYFENFVL 169


>gi|315127313|ref|YP_004069316.1| flagellar basal body-associated protein FliL [Pseudoalteromonas sp.
           SM9913]
 gi|315015827|gb|ADT69165.1| flagellar basal body-associated protein FliL [Pseudoalteromonas sp.
           SM9913]
          Length = 175

 Score = 64.4 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/182 (10%), Positives = 62/182 (34%), Gaps = 19/182 (10%)

Query: 1   MSYD-DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+ D +   + +  ++ KL +    V   +G   G+      L     +  E       N
Sbjct: 1   MAEDTNLEIEEVSKSKSKLIIIIAAVLLIVGAVAGYF-----LLSGGDEPVETLADDAAN 55

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK---- 114
                +     +        L +   +P I N   + +   +++ + L+ +   ++    
Sbjct: 56  GEVAAA---PTSSSATVGSALYVAMPRPFIFNVPGASRDRIVQIKVQLLVRGDGNEETAK 112

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTF 169
             +  +   +++     +  +++ + G    +    ++V+           +  V+F  F
Sbjct: 113 KHIPLIEGTLLSVFSMTTADELSTSVGKETLRFTALDKVQAAMMDVEGNKVIERVLFTGF 172

Query: 170 II 171
           ++
Sbjct: 173 VM 174


>gi|294678999|ref|YP_003579614.1| flagellar basal body-associated protein FliL [Rhodobacter
           capsulatus SB 1003]
 gi|294477819|gb|ADE87207.1| flagellar basal body-associated protein FliL-1 [Rhodobacter
           capsulatus SB 1003]
          Length = 164

 Score = 64.4 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 13/100 (13%), Positives = 39/100 (39%), Gaps = 4/100 (4%)

Query: 76  SLKKLQIFSLQPIITNFDSSPKDWLRLDIALIC---KDIPDKVFLETLHQDIMAYIRTVS 132
           +  ++   +L P++ +        LR    L     K    ++    +   +  ++R V 
Sbjct: 64  TEPQIAFVALDPMVISLTEGKARHLRFSAQLEVPLLKQKEVELLKPRVMDVLNGFLRAVE 123

Query: 133 IKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
           ++ +         +  +  RV++   +G V+ ++   F++
Sbjct: 124 VRDLEDPAALLRLRAQMLRRVQIVVGEGMVNDLLVIEFVM 163


>gi|326791531|ref|YP_004309352.1| flagellar basal body-associated protein FliL [Clostridium
           lentocellum DSM 5427]
 gi|326542295|gb|ADZ84154.1| flagellar basal body-associated protein FliL [Clostridium
           lentocellum DSM 5427]
          Length = 155

 Score = 64.0 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 18/159 (11%), Positives = 46/159 (28%), Gaps = 8/159 (5%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
           ++ KLFV   +V   I I       +  +   +  +    +K +           +    
Sbjct: 3   SKFKLFVIIAIVVLGISIAASTFFVLKQMNESSNGQTAATEKELNLTEVSMGDAIMTNIA 62

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSI 133
                      ++  +    S  K +                   ++  +++A I   + 
Sbjct: 63  IGEDAVQHFAKIKISLGVDASDKKAY-------EAFTNAVTNQAASMRNELIAVIGEQTY 115

Query: 134 KQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
             +    G     ++I  R+  L S   +  V +  + +
Sbjct: 116 TMLKANDGKAKLADEIVARLNKLLSTDIIYDVYYEEYFV 154


>gi|149188091|ref|ZP_01866386.1| flagellar basal body-associated protein FliL [Vibrio shilonii AK1]
 gi|148838079|gb|EDL55021.1| flagellar basal body-associated protein FliL [Vibrio shilonii AK1]
          Length = 164

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 13/107 (12%), Positives = 38/107 (35%), Gaps = 10/107 (9%)

Query: 75  ISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDIPDKV----FLETLHQDIMAYIR 129
                  +   QP I N         +++   L+ + + ++         +   +++   
Sbjct: 57  PVDPISYVNIAQPFIFNAAGKQRDRVVQIKAQLMVRGLDNEEVARYHSPLIESTLLSTFA 116

Query: 130 TVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFII 171
           + +++Q+    G    ++     V     ++  +  V  V+F  F+I
Sbjct: 117 SATVEQLRSTNGRVELRDQATADVQASLSQVVGKPVVERVLFTDFVI 163


>gi|255091310|ref|ZP_05320788.1| flagellar basal body-associated protein [Clostridium difficile CIP
           107932]
          Length = 136

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 17/147 (11%), Positives = 45/147 (30%), Gaps = 15/147 (10%)

Query: 28  FIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQP 87
            I I      G  +L     ++ +K                + TG      K +   L+ 
Sbjct: 1   MILIIFSAGAGFFILGEGGNKQIDKIAGLF-----------IPTGKGKDEVKTENLDLEE 49

Query: 88  IITNFDSSPKDWLRLDIALICK--DIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYF 145
           ++         +L++ I +         +     +  +I+             A   +  
Sbjct: 50  MVLKLADEGVRYLKVSITVSYDSSYKDIEKNTPLIRDNIINCFMAKRADDF-TADNLKNI 108

Query: 146 KEDIEERVKL-RSQGFVSSVIFRTFII 171
           KE+I+  + +   +  + ++ F   ++
Sbjct: 109 KEEIKNTLNIQLGENVIQNIYFTNIVV 135


>gi|126462462|ref|YP_001043576.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126104126|gb|ABN76804.1| flagellar basal body-associated protein FliL [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 196

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/150 (14%), Positives = 43/150 (28%), Gaps = 16/150 (10%)

Query: 38  GIVMLFLFAGQK------EEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITN 91
                   +  K      E   +        D   +               +  +  +T 
Sbjct: 46  YFYFANPLSPAKDVLRLIERTPEADEPAADPDAPQKVPRPTPERESFVTSYYQFKEPLTT 105

Query: 92  FDSSPKDWLRLDIALICKDI-----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFK 146
              + +  L+  I L  +               L  D++A + T S +++    G     
Sbjct: 106 NLRASRRLLQAGIGLSTQYDQKVMDNVARNEVALRSDMLAIVGTFSEEELQDKAGRDRLA 165

Query: 147 EDIEERVKLRSQ-----GFVSSVIFRTFII 171
           E +   V  R Q     G + +V F +FI+
Sbjct: 166 EALRGAVNARLQQLEGFGGIEAVFFPSFIL 195


>gi|17548600|ref|NP_521940.1| flagellar basal body-associated protein FliL [Ralstonia
           solanacearum GMI1000]
 gi|17430848|emb|CAD17530.1| probable flagellar flil transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 164

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 50/171 (29%), Gaps = 33/171 (19%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           +G   KL +   +V   IG+        +                           +   
Sbjct: 15  KGGSTKLLLIILIVLVLIGMGGAAAWFFLGGGS----------------------HAAGP 52

Query: 72  GDTISLKKLQIFSLQPIITNFD--SSPKDWLRLDIAL----ICKDIPDKVFLETLHQDIM 125
                 K+     ++ +  N         +L++ I         +   K +   L   ++
Sbjct: 53  AAPPKPKEPVFVPMETLTVNLQPEEGNDRYLQIAITFKSYNKHAEEEIKSYTPELRSRVL 112

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
             + + +  ++   +G     ++I E+ +        +  V  V+F  F+I
Sbjct: 113 MLLSSKAPAELYSNEGKAKLAKEIVEQCEQAYKAVGKESPVVDVLFTNFVI 163


>gi|302874601|ref|YP_003843234.1| flagellar basal body-associated protein FliL [Clostridium
           cellulovorans 743B]
 gi|307690788|ref|ZP_07633234.1| flagellar basal body-associated protein FliL [Clostridium
           cellulovorans 743B]
 gi|302577458|gb|ADL51470.1| flagellar basal body-associated protein FliL [Clostridium
           cellulovorans 743B]
          Length = 155

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 27/176 (15%), Positives = 48/176 (27%), Gaps = 33/176 (18%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           +      +G   K+ +   +    +G                                  
Sbjct: 3   EKNENAKKGGFSKILIGLLLAIVLVGAAFATAYFYF----------------------TK 40

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--------IPDKVF 116
           S   V       L     +SL     N  S PK +++  I+L               +  
Sbjct: 41  SAEKVTQKTVHPLAHQVTYSLDEFKLNL-SEPKTYIQTKISLGYDGGEESEEFAKELETK 99

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              +   ++  IRT +       +G    K  I   V  L  +G ++ V F + II
Sbjct: 100 KTIIRDAVITLIRTKTNTDF-TKEGTETLKIQIINTVNPLLEKGEINHVYFDSIII 154


>gi|299068766|emb|CBJ40006.1| Flagellar basal body-associated protein FliL [Ralstonia
           solanacearum CMR15]
          Length = 164

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 21/171 (12%), Positives = 50/171 (29%), Gaps = 33/171 (19%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           +G   KL +   +V   IG+        +                           +   
Sbjct: 15  KGGSTKLLLIILIVLVLIGMGGAAAWFFLGGGS----------------------HAAGP 52

Query: 72  GDTISLKKLQIFSLQPIITNFD--SSPKDWLRLDIALICKD----IPDKVFLETLHQDIM 125
                 K+     ++ +  N         +L++ I     D       K +   L   ++
Sbjct: 53  AAPPKPKEPFFVPMETLTVNLQPEEGNDRYLQIAITFKSYDKHAEEEIKSYTPELRSRVL 112

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
             + + +  ++   +G     ++I E+ +        +  V  V+F  F+I
Sbjct: 113 MLLSSKAPAELYSNEGKAKLAKEIVEQCEQAYKAVGKESPVVDVLFTNFVI 163


>gi|196247628|ref|ZP_03146330.1| flagellar basal body-associated protein FliL [Geobacillus sp.
           G11MC16]
 gi|196212412|gb|EDY07169.1| flagellar basal body-associated protein FliL [Geobacillus sp.
           G11MC16]
          Length = 142

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 19/161 (11%), Positives = 46/161 (28%), Gaps = 24/161 (14%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
             +K+  T  ++   I +       +VM      ++ E     +  +             
Sbjct: 2   KGNKVIQTMVIMLAIIALAGTVALVMVMKMTGGEKQGEPSADELAESS------------ 49

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLETLHQDIMAYIRTV 131
                      +  + TN        +   I           +     +   I+  +  +
Sbjct: 50  ---------IDIPEMTTNLADGRYIKISFKIQTDSDKGKEEAEKRDFQIKDVIIERLSEM 100

Query: 132 SIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
                 G +G    KE +++ +     +G V +V   +FI+
Sbjct: 101 KAADFKGKEGMAALKERLKQDINALMQEGKVENVYITSFIL 141


>gi|138894750|ref|YP_001125203.1| flagellar basal body-associated protein FliL [Geobacillus
           thermodenitrificans NG80-2]
 gi|134266263|gb|ABO66458.1| Flagellar protein [Geobacillus thermodenitrificans NG80-2]
          Length = 142

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 19/161 (11%), Positives = 46/161 (28%), Gaps = 24/161 (14%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
             +K+  T  ++   I +       +VM      ++ E     +  +             
Sbjct: 2   KGNKVIQTMVIMLAIIALAGTVALVMVMKMAGGEKQGEPSADELAESS------------ 49

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLETLHQDIMAYIRTV 131
                      +  + TN        +   I           +     +   I+  +  +
Sbjct: 50  ---------IDIPEMTTNLADGRYIKISFKIQTDSDKGKEEAEKRDFQIKDVIIERLSEM 100

Query: 132 SIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
                 G +G    KE +++ +     +G V +V   +FI+
Sbjct: 101 KAADFKGKEGMTALKERLKQDINALMQEGKVENVYITSFIL 141


>gi|187925746|ref|YP_001897388.1| flagellar basal body-associated protein FliL [Burkholderia
           phytofirmans PsJN]
 gi|187716940|gb|ACD18164.1| flagellar basal body-associated protein FliL [Burkholderia
           phytofirmans PsJN]
          Length = 166

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 35/101 (34%), Gaps = 11/101 (10%)

Query: 82  IFSLQPIITNFDSSPK--DWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQ 135
            F L+ +  N  S      +LR+ + L   D          +  +   I+  +      +
Sbjct: 65  FFPLESMTVNLQSDDGQQHFLRIGLTLKLTDAKTQQELTDHMPEVRSRILLALSNKHPDE 124

Query: 136 ITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
           +   +G R    ++   ++  +        V  V+F  F++
Sbjct: 125 LAPLEGKRALATELRTLIEQPTDKGAAPIHVQDVLFTEFVV 165


>gi|58039166|ref|YP_191130.1| flagellar FliL protein [Gluconobacter oxydans 621H]
 gi|58001580|gb|AAW60474.1| Flagellar FliL protein [Gluconobacter oxydans 621H]
          Length = 157

 Score = 64.0 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 14/180 (7%), Positives = 54/180 (30%), Gaps = 33/180 (18%)

Query: 1   MSYD--DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +  +  +   +G + K+ +   +    +     +                 +    +
Sbjct: 1   MTTETPENETPVKKGGKRKIIILAVLACLLLAGGGAFAWKHF-----------HHAATPV 49

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF--DSSPKDWLRLDIALICKD----IP 112
                  V+                ++  I++N    +    ++R+   L  +D      
Sbjct: 50  AKTAPQPVK------------WTTITIPTILSNLDSGTDRTRYVRIGARLEVEDGKDAAN 97

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
               +  +       +  +   +++G+ G    +E +  ++  + +   V  + F   ++
Sbjct: 98  IAALMPQIQDAFQTCLHGMQPSELSGS-GIYRLRETMLAQITNIVAPLRVRDLFFVEVLV 156


>gi|134095083|ref|YP_001100158.1| flagellar basal body-associated protein FliL [Herminiimonas
           arsenicoxydans]
 gi|55977141|gb|AAV68362.1| FliL [Herminiimonas arsenicoxydans]
 gi|133738986|emb|CAL62034.1| Flagellar FliL protein [Herminiimonas arsenicoxydans]
          Length = 166

 Score = 64.0 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 55/180 (30%), Gaps = 29/180 (16%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +   TTS  +     K  +   V+   I +  G  G    L   A  +  K         
Sbjct: 5   AAPKTTSANVEAKPKKSRILIIVLALLIIMAAGGAGAWYFLGQKAAAQPAKAAHVEAK-- 62

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDIP----DKVF 116
                                  ++    N  S + + +L+    L   D       K++
Sbjct: 63  -----------------PPVFLPMEAFTVNLQSENGEQFLQTSFTLQVLDQAQVDLIKLY 105

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
           +  +   I+  + +    +I   +G     E+I    K           VSSV+F +F++
Sbjct: 106 MPHVRSRILLLLSSKKASEILSVEGKTKLAEEIINIFKQPFTPQGPTVKVSSVLFTSFVV 165


>gi|218528671|ref|YP_002419487.1| flagellar basal body-associated protein FliL [Methylobacterium
           chloromethanicum CM4]
 gi|218520974|gb|ACK81559.1| flagellar basal body-associated protein FliL [Methylobacterium
           chloromethanicum CM4]
          Length = 160

 Score = 63.6 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 76/174 (43%), Gaps = 18/174 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+    + +  +G     ++    + T I +  G       L ++     EK        
Sbjct: 1   MADAKDSKKGGKG-----WIGALALVTLIAVGTGG-----GLGVYLLGTVEKSVDLKQRE 50

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFL 117
               +V++++         L + S+  ++ N       W+R++ +++          V L
Sbjct: 51  EAGKAVKALNYTGD-----LSLRSVGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVTL 105

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             +  D +AY+RT+S+ QI GA G ++ +ED+ ERV  R++G V  +I  + ++
Sbjct: 106 AEIRADALAYLRTLSMAQIEGANGLQHLREDLNERVATRTKGAVRELIVESLVV 159


>gi|187478204|ref|YP_786228.1| flagellar protein [Bordetella avium 197N]
 gi|115422790|emb|CAJ49318.1| flagellar protein [Bordetella avium 197N]
          Length = 208

 Score = 63.6 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 11/100 (11%), Positives = 34/100 (34%), Gaps = 10/100 (10%)

Query: 82  IFSLQPIITNFDS-SPKDWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQI 136
              L+P     +    +  + + I L   D         ++  +   ++  + + + + +
Sbjct: 108 FIPLEPFTVTLNDADSERIMHVGITLRAGDDQTRQRIDRYMPEVRNRLLMVLSSQTPQSV 167

Query: 137 TGAQGFRYFKEDIEERVKL----RSQGF-VSSVIFRTFII 171
               G +   + +   +         G  V+ V+F  F++
Sbjct: 168 QTVDGKQNMAKSLMAAINRPFSPLPDGQNVTDVLFTAFVV 207


>gi|152997441|ref|YP_001342276.1| flagellar basal body-associated protein FliL [Marinomonas sp.
           MWYL1]
 gi|150838365|gb|ABR72341.1| flagellar basal body-associated protein FliL [Marinomonas sp.
           MWYL1]
          Length = 170

 Score = 63.6 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 13/105 (12%), Positives = 37/105 (35%), Gaps = 10/105 (9%)

Query: 77  LKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKVFLETLHQDIMAYIRTV 131
                +        +F    K  +++L++++  K         + +  +   ++    + 
Sbjct: 65  EPSTYLALDPAFTVDFMVDGKQRYVQLNMSVKSKKIEQINAVTLHMPLIRNSLVLLFSSQ 124

Query: 132 SIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
           S   +  A G    K+   + +         QG + +V+F  F++
Sbjct: 125 SFVDLQTADGKEALKKASLDAINGILEQETGQGGIDAVLFTNFVM 169


>gi|293607829|ref|ZP_06690149.1| flagellar FliL protein [Achromobacter piechaudii ATCC 43553]
 gi|292813772|gb|EFF72933.1| flagellar FliL protein [Achromobacter piechaudii ATCC 43553]
          Length = 208

 Score = 63.6 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 13/113 (11%), Positives = 36/113 (31%), Gaps = 10/113 (8%)

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSPKDW-----LRLDIALICKDIPDKVFLETLHQD 123
                 I++       ++       ++  +      L L ++        + ++  +   
Sbjct: 95  APPAGPIAVPAPIFVPIEAFTVTLQNADTERIMHVGLTLRVSDEQTRTRLEKYMPEVRSR 154

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
           I+  + + S   +   QG       I+  V           +V+ V+F  F++
Sbjct: 155 ILMVLSSQSPTGVQTQQGKTDMANAIKVAVNRPFSPLPDGQYVTDVLFTAFVV 207


>gi|332533120|ref|ZP_08408989.1| flagellar biosynthesis protein FliL [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037402|gb|EGI73856.1| flagellar biosynthesis protein FliL [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 176

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 55/181 (30%), Gaps = 16/181 (8%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ + +      G   K  +   V    I         +      +G             
Sbjct: 1   MAEEASLEIEETGKSKKKLIIIIVAVLLIAGGAAGYFFM------SGSDAPVETLDEETA 54

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-----LRLDIALICKDIPDKV 115
              ++  +           L +   +P + N   S +D      ++L +     +   K 
Sbjct: 55  MSTDAAPAASGSSAEVGSALYVAMPRPFVFNVPGSSRDRIVQIKVQLLVRGEVNEETAKK 114

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +  +   +++   T +  +++ + G    +    E+V+     +     +  V+F  F+
Sbjct: 115 HIPLIEGTLLSVFSTTTADELSTSSGKETLRFSALEKVQKALMDVEGSKVIERVLFTGFV 174

Query: 171 I 171
           +
Sbjct: 175 M 175


>gi|163850068|ref|YP_001638111.1| flagellar basal body-associated protein FliL [Methylobacterium
           extorquens PA1]
 gi|163661673|gb|ABY29040.1| flagellar basal body-associated protein FliL [Methylobacterium
           extorquens PA1]
          Length = 160

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 75/174 (43%), Gaps = 18/174 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+    + +  +G     ++    + T I +  G       L ++     EK        
Sbjct: 1   MADAKDSKKGGKG-----WIGALALVTLIAVGTGG-----GLGVYLLGTVEKSVDLKQRE 50

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFL 117
               +V+ ++         L + S+  ++ N       W+R++ +++          V L
Sbjct: 51  EAGKAVKVLNYTGD-----LSLRSVGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVTL 105

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             +  D +AY+RT+S+ QI GA G ++ +ED+ ERV  R++G V  +I  + ++
Sbjct: 106 AEIRADALAYLRTLSLAQIEGANGLQHLREDLNERVATRTKGAVRELIVESLVV 159


>gi|56419764|ref|YP_147082.1| flagellar basal body-associated protein FliL [Geobacillus
           kaustophilus HTA426]
 gi|261419429|ref|YP_003253111.1| flagellar basal body-associated protein FliL [Geobacillus sp.
           Y412MC61]
 gi|297530596|ref|YP_003671871.1| flagellar basal body-associated protein FliL [Geobacillus sp.
           C56-T3]
 gi|319766244|ref|YP_004131745.1| flagellar basal body-associated protein FliL [Geobacillus sp.
           Y412MC52]
 gi|56379606|dbj|BAD75514.1| flagellar basal body-associated protein [Geobacillus kaustophilus
           HTA426]
 gi|261375886|gb|ACX78629.1| flagellar basal body-associated protein FliL [Geobacillus sp.
           Y412MC61]
 gi|297253848|gb|ADI27294.1| flagellar basal body-associated protein FliL [Geobacillus sp.
           C56-T3]
 gi|317111110|gb|ADU93602.1| flagellar basal body-associated protein FliL [Geobacillus sp.
           Y412MC52]
          Length = 142

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/163 (12%), Positives = 46/163 (28%), Gaps = 28/163 (17%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
             +K   T  +V   I +        VM    A ++       +                
Sbjct: 2   KGNKAIKTMIIVLAVIALAGTAALVAVMKMGHAEKQGAPSADELAERS------------ 49

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----IPDKVFLETLHQDIMAYIR 129
                      +  + TN       ++++   +           +     +   I+  + 
Sbjct: 50  ---------IDIPEMTTNLAD--GRYIKISFKIETDSDQGKEEAEKRDFQMKDVIIEQLS 98

Query: 130 TVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            +      G +G    KE ++  +  L  +G V +V   +FI+
Sbjct: 99  QMKAADFKGKEGLTALKERLKREINGLMQEGRVENVYITSFIL 141


>gi|303249195|ref|ZP_07335433.1| flagellar basal body-associated protein FliL [Desulfovibrio
           fructosovorans JJ]
 gi|302489418|gb|EFL49367.1| flagellar basal body-associated protein FliL [Desulfovibrio
           fructosovorans JJ]
          Length = 145

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 14/143 (9%), Positives = 43/143 (30%), Gaps = 4/143 (2%)

Query: 29  IGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPI 88
           +      +   +++           +     +      +     +      + I  +   
Sbjct: 4   LMKVGLLVLAFLLVPPSPSMLMASSEGGHGGDATGGEKKEAGKAENG---AIVIGPMTVN 60

Query: 89  ITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKED 148
           + +        L LD+        +++      QD++ ++ +   + +  + G    + D
Sbjct: 61  VLSNTGYRFLHLTLDVQCEDNASAERLTDADCKQDLIFFLSSKLAEDLMTSAGKMALRRD 120

Query: 149 IEERV-KLRSQGFVSSVIFRTFI 170
           +     K    G V +V F  F+
Sbjct: 121 LILLFSKYTGPGKVKNVYFTEFV 143


>gi|149200769|ref|ZP_01877744.1| flagellar biosynthesis protein, FliL [Roseovarius sp. TM1035]
 gi|149145102|gb|EDM33128.1| flagellar biosynthesis protein, FliL [Roseovarius sp. TM1035]
          Length = 191

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 14/117 (11%), Positives = 39/117 (33%), Gaps = 10/117 (8%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP-----DKVFLET 119
             R         + + +       +T      + +L++ + +  +         +     
Sbjct: 74  PKRIPKEMPEAPVFETRYHEFPDPLTTNLKGSRRFLQIGVGVSTQYDESVIAHIETHAMA 133

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-----GFVSSVIFRTFII 171
           L  D++A I   + + + G  G       ++  +  R +     G +  V F +F++
Sbjct: 134 LRSDMLAVISGFAEEDVEGTAGREALALALKNAINARLEALEGFGGIEGVFFPSFVL 190


>gi|329849712|ref|ZP_08264558.1| flagellar fliL protein [Asticcacaulis biprosthecum C19]
 gi|328841623|gb|EGF91193.1| flagellar fliL protein [Asticcacaulis biprosthecum C19]
          Length = 212

 Score = 63.6 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/114 (14%), Positives = 42/114 (36%), Gaps = 7/114 (6%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIP----DKVFLET 119
                   +         +L   + N  S+     +L+L +   C D       K  L  
Sbjct: 99  DPKTQPVLSEGPDGTTYLTLPDTVANIQSADGRSSYLKLKLTFECADEETADMVKENLPR 158

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
           ++  +  +IR +  + + G+ G    + +I  R+  + +   +++V+    +I 
Sbjct: 159 VNDILQGFIRELRPEDLKGSAGNHQLRLEILRRINLVLAPHKINAVLIEQMLIT 212


>gi|283785714|ref|YP_003365579.1| flagellar protein FliL [Citrobacter rodentium ICC168]
 gi|282949168|emb|CBG88776.1| flagellar protein FliL [Citrobacter rodentium ICC168]
          Length = 155

 Score = 63.6 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/175 (12%), Positives = 46/175 (26%), Gaps = 31/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   + ++  +++   V+ T             M                        
Sbjct: 2   TDSAINKKSKRSVWLPLLVIITLAACATAGYSYWRM---------------------QQQ 40

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
             +              F+L     N   +    L + I L  KD         +L  + 
Sbjct: 41  PTAAAQEAPPPPPAPVFFALDTFTVNLGDA-DRVLYIGITLRLKDEATRARLNEYLPEVR 99

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             ++          +    G +     I+E +    +  Q    V+ V++  FI+
Sbjct: 100 SRLLLLFSRQDAAVLATEDGKQQLIAAIKETLSPPLVAGQPKQVVTDVLYTAFIL 154


>gi|302389671|ref|YP_003825492.1| flagellar basal body-associated protein FliL [Thermosediminibacter
           oceani DSM 16646]
 gi|302200299|gb|ADL07869.1| flagellar basal body-associated protein FliL [Thermosediminibacter
           oceani DSM 16646]
          Length = 155

 Score = 63.6 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/109 (15%), Positives = 45/109 (41%), Gaps = 7/109 (6%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLE----TLHQD 123
           +         K+   + L   +TN       +++L I  I  D   +  ++     +   
Sbjct: 48  AEDGEKKEEKKETITYQLGDFLTNLADKG--YIKLSIVCILSDKETEKQIQAKEYEIKDR 105

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           + + +R+ +   +  ++G    K++++E++  +  +G V  V F   I+
Sbjct: 106 VYSILRSKTYDSVKDSKGMEILKKELKEKINAVVGKGKVEDVFFTNIIV 154


>gi|320325123|gb|EFW81192.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. glycinea str. B076]
          Length = 169

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/181 (7%), Positives = 51/181 (28%), Gaps = 23/181 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +         + KL +   V               +M                 + 
Sbjct: 1   MAKSEEVKDPATKGKLKLIILAVVALLLAVGLSVGATWFLMHKS-------------EST 47

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDKV 115
               +  +      +    +        + NF+S+ +  ++++ I +           K 
Sbjct: 48  PDPAAAAAAAAAANVKPVAVFEPMTPAFVVNFNSNGRQRYMQVSITMLARNAADMEALKA 107

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +  +  +++     +  + +    G    ++     ++  +Q       +  ++F  F+
Sbjct: 108 HMPLIRNNLVMLFAAIPFESLASPIGQEMLRQKATASIQEVAQKELGKTVIEQLLFTNFV 167

Query: 171 I 171
           +
Sbjct: 168 L 168


>gi|332799186|ref|YP_004460685.1| flagellar basal body-associated protein FliL [Tepidanaerobacter sp.
           Re1]
 gi|332696921|gb|AEE91378.1| flagellar basal body-associated protein FliL [Tepidanaerobacter sp.
           Re1]
          Length = 152

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/174 (12%), Positives = 54/174 (31%), Gaps = 26/174 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +   +  +     L +   +++  + +  G    +                     
Sbjct: 1   MATQNNPEKKDKSKFQNLIMIILLLFVLMLLTSGVAYFV--------------------- 39

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLE 118
               ++   +       K    +     +TN        L L   L  KD     K+   
Sbjct: 40  --AKNIAGNNKTVVEQSKSNITYDAGEFLTNLSDKGYIRLSLVYLLNSKDVENELKLKES 97

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            +   I   +R+ +   I  ++G    ++ I+E +  + + G +  V F + I+
Sbjct: 98  EIRDKIFVILRSETYDSIKDSEGMENLRKKIKESLNQILTNGSIVDVYFTSIIV 151


>gi|54307283|ref|YP_128303.1| hypothetical protein PBPRA0046 [Photobacterium profundum SS9]
 gi|46911703|emb|CAG18501.1| Hypothetical protein PBPRA0046 [Photobacterium profundum SS9]
          Length = 164

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 13/176 (7%), Positives = 47/176 (26%), Gaps = 24/176 (13%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T ++       K+ +    V   I +                       +    +     
Sbjct: 2   TATKEQEKTSQKIPLIIAAVVLVIALAGAGGWWYF--------------QQQAKSMVMAV 47

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKVFLETL 120
                      +KK     L+  + +     +  +L ++++++  +       + FL  +
Sbjct: 48  DVEPQVPVAARVKKPVFLELKKFVVSVPGDDRLHYLMMEMSVMSYNQDELDKLQDFLPVI 107

Query: 121 HQDIMAYIRTVSIKQITGAQGFR----YFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              ++  +              +      ++ +   +  + S   +  V+    +I
Sbjct: 108 RNAVVTLLSEQHYNDFAQPGVMKPLQIALRDKLRRVMNDMASSNGIDQVLITKMVI 163


>gi|268316336|ref|YP_003290055.1| flagellar basal body-associated protein FliL [Rhodothermus marinus
           DSM 4252]
 gi|262333870|gb|ACY47667.1| flagellar basal body-associated protein FliL [Rhodothermus marinus
           DSM 4252]
          Length = 184

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 40/121 (33%), Gaps = 6/121 (4%)

Query: 57  ILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKD----I 111
                  +        +   ++  Q   LQ  I N        +L +++ L   +     
Sbjct: 63  AQAAEQFSGTDDDTGEEAKPVEYGQFMELQGFIINPAGTDGTRYLMINLGLESAEGGVLE 122

Query: 112 PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFI 170
             K     +   ++  +   +++++         K+++ + V     +G +  V F  ++
Sbjct: 123 ELKEKEVVVRDTVLKLLGQRTVEELADISLRTQLKQELRDAVNAVLRKGKIDRVYFTQYV 182

Query: 171 I 171
           +
Sbjct: 183 L 183


>gi|254559214|ref|YP_003066309.1| flagellar basal body-associated protein FliL [Methylobacterium
           extorquens DM4]
 gi|254266492|emb|CAX22256.1| Flagellar basal body-associated protein FliL [Methylobacterium
           extorquens DM4]
          Length = 160

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 75/174 (43%), Gaps = 18/174 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+    + +  +G     ++    + T I +  G       L ++     EK        
Sbjct: 1   MADAKDSKKGGKG-----WIGALALVTLIAVGTGG-----GLGVYLLGTVEKSVDLKQRE 50

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFL 117
               +V+ ++         L + S+  ++ N       W+R++ +++          V L
Sbjct: 51  EAGKAVKVLNYTGD-----LSLRSVGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVTL 105

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             +  D +AY+RT+S+ QI GA G ++ +ED+ ERV  R++G V  +I  + ++
Sbjct: 106 AEIRADALAYLRTLSMAQIEGANGLQHLREDLNERVATRTKGAVRELIVESLVV 159


>gi|120613025|ref|YP_972703.1| flagellar basal body-associated protein FliL [Acidovorax citrulli
           AAC00-1]
 gi|120591489|gb|ABM34929.1| flagellar basal body-associated protein FliL [Acidovorax citrulli
           AAC00-1]
          Length = 222

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/186 (11%), Positives = 46/186 (24%), Gaps = 42/186 (22%)

Query: 19  FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLK 78
            V    +   + +  G      +          K      +        +          
Sbjct: 45  LVLIIAIVAVLVLAGGGAAWFFLS---------KRSHGDEDEEGGGGGHAKAAAPAAPKV 95

Query: 79  KLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSI 133
                 ++ ++ N        + ++ I L   D       K +L ++   I+  +   + 
Sbjct: 96  APTFLPIENMVVNLADPGGERFAQIGITLELADAKTSELVKQYLPSIRSAILMLVSQRTA 155

Query: 134 KQITGAQGFRYFKEDIEERVKL----------------------------RSQGFVSSVI 165
           +++ G +G      DI   V                                   V  V+
Sbjct: 156 QELLGREGKEKLAVDIRREVSKPLGYTVPKPRKRPASDEEEDGEEAPRPRVDNNPVRQVL 215

Query: 166 FRTFII 171
           F +FII
Sbjct: 216 FSSFII 221


>gi|240137202|ref|YP_002961671.1| Flagellar basal body-associated protein FliL [Methylobacterium
           extorquens AM1]
 gi|240007168|gb|ACS38394.1| Flagellar basal body-associated protein FliL [Methylobacterium
           extorquens AM1]
          Length = 160

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 75/174 (43%), Gaps = 18/174 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+    + +  +G     ++    + T I +  G       L ++     EK        
Sbjct: 1   MADAKDSKKSGKG-----WIGALALVTLIAVGTGG-----GLGVYLLGTVEKSVDLKQRE 50

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFL 117
               +V+ ++         L + S+  ++ N       W+R++ +++          V L
Sbjct: 51  EAGKAVKVLNYTGD-----LSLRSVGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVTL 105

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             +  D +AY+RT+S+ QI GA G ++ +ED+ ERV  R++G V  +I  + ++
Sbjct: 106 AEIRADALAYLRTLSMAQIEGANGLQHLREDLNERVATRTKGAVRELIVESLVV 159


>gi|269139493|ref|YP_003296194.1| flagellar basal body-associated protein [Edwardsiella tarda EIB202]
 gi|267985154|gb|ACY84983.1| flagellar basal body-associated protein [Edwardsiella tarda EIB202]
 gi|304559382|gb|ADM42046.1| Flagellar biosynthesis protein FliL [Edwardsiella tarda FL6-60]
          Length = 159

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/115 (16%), Positives = 37/115 (32%), Gaps = 12/115 (10%)

Query: 69  VHTGDTISLKKLQIFSLQPIITNF---DSSPKDWLRLDIALICKDIPDKVFL----ETLH 121
            HT     +      +L P   N           L + I L   D   +  L      + 
Sbjct: 44  QHTVKQAPIPLPVFMALDPFTVNLLSNGDDSDRVLYVGITLRLPDEGTRKRLNDYLPEVR 103

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGF----VSSVIFRTFII 171
             ++  +       +   QG +   ++I+  ++     G     V+ V+F  FI+
Sbjct: 104 SRLLMLLSRQQAATLASEQGKKALMDEIKSTLRAPVVSGQPAQMVNDVMFTAFIL 158


>gi|262273513|ref|ZP_06051327.1| flagellar basal body-associated protein FliL [Grimontia hollisae
           CIP 101886]
 gi|262222491|gb|EEY73802.1| flagellar basal body-associated protein FliL [Grimontia hollisae
           CIP 101886]
          Length = 163

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 59/174 (33%), Gaps = 28/174 (16%)

Query: 8   SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVR 67
            +  +     + V   VV+  + +            +   ++E +               
Sbjct: 7   EEQPKSKSRLIVVVAGVVFLLLAVGGWLFYAQWKESVVEVKEETEVA------------- 53

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD----KVFLETLHQ 122
                 T  +KK +  S+   + + +   +  +L L+++L+  +  D    +  +  L  
Sbjct: 54  -----PTAMVKKPKFLSMPRFVVSLEGGSRLHYLMLEMSLMSYEEDDLKKMEDMMPVLRN 108

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIE----ERVKLRSQGF-VSSVIFRTFII 171
            ++  +      +++ A      +EDI     ER+   + G  V  V+    +I
Sbjct: 109 TVVKLLNGKHFNELSKAGALPALEEDIRNALQERMNEMTGGKGVERVLITKMVI 162


>gi|147678414|ref|YP_001212629.1| flagellar basal body-associated protein [Pelotomaculum
           thermopropionicum SI]
 gi|146274511|dbj|BAF60260.1| flagellar basal body-associated protein [Pelotomaculum
           thermopropionicum SI]
          Length = 176

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/160 (10%), Positives = 47/160 (29%), Gaps = 29/160 (18%)

Query: 19  FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLK 78
           F+ +F++   +                  ++  K     +                    
Sbjct: 38  FLIFFIILAVLAGVSAGAYFYFKRPAGEAKEARKSGAVEMET------------------ 79

Query: 79  KLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKVFLE-----TLHQDIMAYIRTVS 132
                 +  ++ N   S    +LR++I L                  +   ++A +R+ +
Sbjct: 80  ----VEMGEVVANLAGSGGAHYLRVNITLEYPRDKKLAEELKKKKHQILDSLIAVLRSKT 135

Query: 133 IKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
           +  +         K D+   + +   +G V+ + F  +++
Sbjct: 136 LADVNSPGSVDSLKRDLLNGINVHLEEGQVTGIYFTDYLV 175


>gi|238912452|ref|ZP_04656289.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
          Length = 155

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 48/175 (27%), Gaps = 31/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   + ++  +++   V+ T             M                        
Sbjct: 2   TDSAINKKSKRSIWIPLLVLITLAACATAGYSYWRM---------------------QQQ 40

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
             +    +         F+L     N   +    L + + L  KD         +L  + 
Sbjct: 41  PTTNAKAEPAPPPAPVFFALDTFTVNLGDA-DRVLYIGVTLRLKDEATRARLNEYLPEVR 99

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
             ++      +   ++   G +     I+E +         +  V+ V++  FI+
Sbjct: 100 SRLLLLFSRQNAAALSTEAGKQKLIAAIKETLAAPLVAGQPKQVVTDVLYTAFIL 154


>gi|42522380|ref|NP_967760.1| flagellar protein required for flagellar formation [Bdellovibrio
           bacteriovorus HD100]
 gi|39574912|emb|CAE78753.1| flagellar protein required for flagellar formation [Bdellovibrio
           bacteriovorus HD100]
          Length = 301

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/166 (12%), Positives = 52/166 (31%), Gaps = 9/166 (5%)

Query: 15  QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDT 74
           +    V   VV    G+    L    ++             +    +  +    V +   
Sbjct: 134 KKLALVGLLVVTAGAGVVLYRLATKGLIPQHEDLFIHSMADWSSQKYQYDPKTEVESFYD 193

Query: 75  ISLKKLQIFSLQPIITNFDSS--------PKDWLRLDIALICKDIPDKVFLETLHQDIMA 126
            +     +F +Q ++ N   S              ++ A     +  K     +    + 
Sbjct: 194 STRAAQNVFLMQRMVVNLRRSAESGTNPMGAFEFYVEGAASDVVVEIKDREAEVEDLFLR 253

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            I  ++  Q    +G +   E + + V  + ++G+V  +  +T I+
Sbjct: 254 TIEEMTFDQAASGEGKQELCERLRKEVNKILTKGYVRRIFIKTAIV 299


>gi|170694408|ref|ZP_02885562.1| flagellar basal body-associated protein FliL [Burkholderia graminis
           C4D1M]
 gi|170140831|gb|EDT09005.1| flagellar basal body-associated protein FliL [Burkholderia graminis
           C4D1M]
          Length = 165

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 13/98 (13%), Positives = 33/98 (33%), Gaps = 11/98 (11%)

Query: 85  LQPIITNFDSSPK--DWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQITG 138
           L+ +  N  S      +LR+ + L   D          +  +   I+  +      ++  
Sbjct: 67  LESMTVNLQSDDGQQHFLRIGLTLKLTDPKTTPELTEHMPEIRSRILLALSNHHPDELAP 126

Query: 139 AQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
            +G      ++   ++  +        V  V+F  F++
Sbjct: 127 LEGKHALATELRTLIEQPTDKGAAPIHVQDVLFTEFVV 164


>gi|89899367|ref|YP_521838.1| flagellar basal body-associated protein FliL [Rhodoferax
           ferrireducens T118]
 gi|89344104|gb|ABD68307.1| flagellar basal body-associated protein FliL [Rhodoferax
           ferrireducens T118]
          Length = 199

 Score = 63.3 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/154 (9%), Positives = 37/154 (24%), Gaps = 17/154 (11%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           D          + K+ +        +    G     +             +K        
Sbjct: 16  DADEPGKKPVWRKKMLIIVIAGVMVLVSAGGGAFFFI------------SKKRAAAAVEG 63

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWL-----RLDIALICKDIPDKVFLE 118
               S    +           L  ++ N      + +      L +         K +L 
Sbjct: 64  TGGASAVAVEAAPKGPPVYLPLDNMVVNLADPGGEKVAQVGITLQVVDAHASESVKAYLP 123

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER 152
           ++   ++  I   +  ++   +G +   +DI   
Sbjct: 124 SIRSGVLMLISQRTAAELLTQEGKQKLAKDIWRE 157


>gi|238920317|ref|YP_002933832.1| flagellar basal body-associated protein FliL [Edwardsiella ictaluri
           93-146]
 gi|238869886|gb|ACR69597.1| flagellar basal body-associated protein, putative [Edwardsiella
           ictaluri 93-146]
          Length = 159

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/115 (14%), Positives = 39/115 (33%), Gaps = 12/115 (10%)

Query: 69  VHTGDTISLKKLQIFSLQPIITNF---DSSPKDWLRLDIALICKDIPDKVFL----ETLH 121
            HT     + +    +L+P   +    +      L + I L   D   +  L      + 
Sbjct: 44  QHTAKQAPIPQPVFMALEPFTVSLMSNNDDSDQVLYVGITLRLPDEGTRKRLNDYLPEVR 103

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
             ++  +       +   QG +   ++I+  ++           V+ V+F  FI+
Sbjct: 104 SRLLMLLSRQQAATLATEQGKKALMDEIKSTLRAPVVSGQPPQIVNDVMFTAFIL 158


>gi|149908451|ref|ZP_01897114.1| hypothetical flagellar protein FliL [Moritella sp. PE36]
 gi|149808614|gb|EDM68549.1| hypothetical flagellar protein FliL [Moritella sp. PE36]
          Length = 168

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 43/123 (34%), Gaps = 10/123 (8%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDIPDK--- 114
                + V +     TI+     +   +P + N      +  +++ + L+ +   +K   
Sbjct: 45  AAADSSGVVTETVDKTINETAYYVALPRPFVFNIIGLKRERLVQIKVQLMVRGSDNKDLA 104

Query: 115 -VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRT 168
              L  +   ++      + +Q+   QG    + D    V         +G V  ++F  
Sbjct: 105 KANLPLIESTLLQVFSATTEQQLATYQGKELLRADSLTNVNEILTKYTGKGVVEKILFSG 164

Query: 169 FII 171
           F++
Sbjct: 165 FVM 167


>gi|251779428|ref|ZP_04822348.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
 gi|243083743|gb|EES49633.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
          Length = 161

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/169 (10%), Positives = 47/169 (27%), Gaps = 30/169 (17%)

Query: 10  YIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSV 69
             +G    +      V   + +  G   G  +                         ++ 
Sbjct: 13  EAKGKSGNMKTIIIFVVALLLVGGGVFAGTYIFM----------------------QKNA 50

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICK------DIPDKVFLETLHQ 122
            T        +    +  +  N      K + +  I++         +   K     +  
Sbjct: 51  TTVVKEQSIDITYVDMGEMTANLADEGGKRYFKGQISIGYDKTDKDAETELKEKKVVVRD 110

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
            I+ Y++++ I  I      +  K  + +R+    ++  +  V F + I
Sbjct: 111 SIIFYLKSLKIDYINDTNNEKEIKAQLMDRINKQLTKSKIVDVRFDSII 159


>gi|320329382|gb|EFW85375.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330883032|gb|EGH17181.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 169

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/181 (7%), Positives = 51/181 (28%), Gaps = 23/181 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +         + KL +   V               +M                 + 
Sbjct: 1   MAKSEEVKDPATKGKLKLIILAVVALLLAVGLSVGATWFLMHKS-------------EST 47

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDKV 115
               +  +      +    +        + NF+S+ +  ++++ I +           K 
Sbjct: 48  PVPAAAAAAAAAANVKPVAVFEPMTPAFVVNFNSNGRQRYMQVSITMLARNAADMEALKA 107

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +  +  +++     +  + +    G    ++     ++  +Q       +  ++F  F+
Sbjct: 108 HMPLIRNNLVMLFAAIPFESLASPIGQEMLRQKATASIQEVAQKELGKTVIEQLLFTNFV 167

Query: 171 I 171
           +
Sbjct: 168 L 168


>gi|237653568|ref|YP_002889882.1| flagellar basal body-associated protein FliL [Thauera sp. MZ1T]
 gi|237624815|gb|ACR01505.1| flagellar basal body-associated protein FliL [Thauera sp. MZ1T]
          Length = 190

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 36/121 (29%), Gaps = 19/121 (15%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFD-SSPKDWLRL----DIALICKDIPDKVFLETLHQDI 124
            TG     K      L     N        +L++     +A    D   K F+  +   I
Sbjct: 69  TTGTVDLTKPPTFIPLDAFTVNLRRDEGDHYLQVVAVMRVADATMDPTLKAFMPEIRHRI 128

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKL--------------RSQGFVSSVIFRTFI 170
              + +    ++   +G       I E V                   G V +V+F +FI
Sbjct: 129 NLLLSSKLPSEVATVEGREALSLAITESVNEALGFKPVRDAAGRPVPNGPVQAVLFTSFI 188

Query: 171 I 171
           I
Sbjct: 189 I 189


>gi|126697830|ref|YP_001086727.1| flagellar basal body-associated protein [Clostridium difficile 630]
 gi|255099426|ref|ZP_05328403.1| flagellar basal body-associated protein [Clostridium difficile
           QCD-63q42]
 gi|115249267|emb|CAJ67080.1| Flagellar basal body-associated protein FliL [Clostridium
           difficile]
          Length = 147

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/141 (10%), Positives = 43/141 (30%), Gaps = 15/141 (10%)

Query: 34  GWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD 93
               G  +L     ++ +K                + TG      K +   L+ ++    
Sbjct: 18  SAGAGFFILGEGGNKQVDKIAGLF-----------IPTGKGKDEVKTENLDLEEMVLKLA 66

Query: 94  SSPKDWLRLDIALICK--DIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEE 151
                +L++ I +         +     +  +I+             A   +  KE+I+ 
Sbjct: 67  DEGVRYLKVSITVSYDSSYKDIEKNTPLIRDNIINCFMAKRADDF-TADNLKNIKEEIKN 125

Query: 152 RVKL-RSQGFVSSVIFRTFII 171
            + +   +  + ++ F   ++
Sbjct: 126 TLNIQLGENVIQNIYFTNIVV 146


>gi|157145262|ref|YP_001452581.1| flagellar basal body-associated protein FliL [Citrobacter koseri
           ATCC BAA-895]
 gi|157082467|gb|ABV12145.1| hypothetical protein CKO_00999 [Citrobacter koseri ATCC BAA-895]
          Length = 155

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/175 (13%), Positives = 47/175 (26%), Gaps = 31/175 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   R ++  +++   V+ T             M                        
Sbjct: 2   TDSAINRKSKRSIWIPLLVLITLAACATAGYSYWRM---------------------QEH 40

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFL----ETLH 121
             +  T           F+L     N   +    L + I L  KD   +  L      + 
Sbjct: 41  PTASATAAPPPPPAPVFFALDTFTVNLGDA-DRVLYIGITLRLKDEVTRARLSEYLPEVR 99

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
             ++          ++   G +     I+E +         +  V+ V++  FI+
Sbjct: 100 SRLLLLFSRQDATALSTEAGKQTLIAAIKETLSTPLVAGQPKQEVTDVLYTAFIL 154


>gi|307546955|ref|YP_003899434.1| flagellar basal body-associated protein FliL [Halomonas elongata
           DSM 2581]
 gi|307218979|emb|CBV44249.1| flagellar basal body-associated protein FliL [Halomonas elongata
           DSM 2581]
          Length = 159

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/123 (11%), Positives = 35/123 (28%), Gaps = 11/123 (8%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD--SSPKDWLRLDIALICKD----IPD 113
                          +  ++     + P   N          L   I+L   D       
Sbjct: 36  QQGGMEQAQAEEHANVEYREPIFVEINPFTVNLAEDDHGARLLYAGISLKVTDTQSRELL 95

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRT 168
           +  +  +   ++  +       +T A G +   ++I   ++   +       +  V+F  
Sbjct: 96  EAHMPQVRSRLLTLLSGRQAADLTSADGKKRLADEIIATLEAPMEKTQPELAIEDVLFTE 155

Query: 169 FII 171
           FI+
Sbjct: 156 FIV 158


>gi|241763649|ref|ZP_04761699.1| flagellar basal body-associated protein FliL [Acidovorax
           delafieldii 2AN]
 gi|241367124|gb|EER61490.1| flagellar basal body-associated protein FliL [Acidovorax
           delafieldii 2AN]
          Length = 188

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/158 (12%), Positives = 43/158 (27%), Gaps = 22/158 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS ++T +        KL V   V+   +    G    +        +      +     
Sbjct: 1   MSANNTAAAPAAAKSKKLLVIGVVIALLVIAGAGAAWFLSSRSHAEEEDGAAPARKDAAK 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKD----IPDKV 115
                                   ++ ++ N        + ++ I L   D       K 
Sbjct: 61  -----------------VVPTFLPMENMVVNLADPGGDRFAQIGITLEVSDAKTAEQIKQ 103

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV 153
           +L ++   I+      + +++   +G      DI   V
Sbjct: 104 YLPSIRSGILLLASQRTSEELLQREGKEKLAADILREV 141


>gi|188586030|ref|YP_001917575.1| flagellar basal body-associated protein FliL [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179350717|gb|ACB84987.1| flagellar basal body-associated protein FliL [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 154

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/116 (13%), Positives = 41/116 (35%), Gaps = 6/116 (5%)

Query: 57  ILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWL-RLDIALICKDI---- 111
           I  +       +   G+ +       F L    TN        + ++++ +   +     
Sbjct: 33  IAVSVASPDQPTTEKGEEVVSYTGITFPLGEFTTNLADEGARRIFQVEVVVELSESGAKS 92

Query: 112 PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIF 166
             +     +   I   +R++  +++   +G    +E I+E +     +G V +V F
Sbjct: 93  ELEEREPQVRDKIYTILRSMKAEELNEQEGMEELREQIKEAIDERIEEGEVVNVYF 148


>gi|329298599|ref|ZP_08255935.1| flagellar basal body-associated protein FliL [Plautia stali
           symbiont]
          Length = 161

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 52/178 (29%), Gaps = 31/178 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           + +   +G +  L +   ++ T             M+    G K E              
Sbjct: 2   SDNAKAKGRKRSLLIPVLLIVTLAACSVAGYAVWRMMNKHEGDKPEAA------------ 49

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIP----DKVFLE 118
                            F++     N  +    P   L +   L   D         +L 
Sbjct: 50  -------KVEPPPAPVFFAMDTFTVNLVNPDNDPDRVLYVGFTLRLPDEDTRRRLNDYLP 102

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
            +   ++  +   S   +   QG +   E I++      VK +    VS V+F TFI+
Sbjct: 103 EVRSRLLLLLSRQSANALATEQGKQALVEQIKQVLAPPLVKGQPAQVVSDVLFTTFIL 160


>gi|149376220|ref|ZP_01893984.1| Flagellar basal body-associated protein [Marinobacter algicola
           DG893]
 gi|149359417|gb|EDM47877.1| Flagellar basal body-associated protein [Marinobacter algicola
           DG893]
          Length = 150

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/125 (10%), Positives = 39/125 (31%), Gaps = 12/125 (9%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIAL------ICKDIP 112
               +         +        I    P +T+          L  A+            
Sbjct: 24  AQEDEGGDEPQEEQEKEPAITDYIEMDPPFVTHVGDPGTKLTYLKAAVTIRASKETTRPA 83

Query: 113 DKVFLETLHQDIMAYIRTVSI-KQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIF 166
            +  +  L  +++      +  +Q++  +G +  +E+  +R+    +       ++ V+F
Sbjct: 84  VEAHMPRLRHELVMLFGEQTDTEQLSSTEGQQSLREEATKRINAALEEQQTGETITGVLF 143

Query: 167 RTFII 171
             F++
Sbjct: 144 TEFVV 148


>gi|209522292|ref|ZP_03270919.1| flagellar basal body-associated protein FliL [Burkholderia sp.
           H160]
 gi|209497268|gb|EDZ97496.1| flagellar basal body-associated protein FliL [Burkholderia sp.
           H160]
          Length = 167

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/101 (15%), Positives = 36/101 (35%), Gaps = 11/101 (10%)

Query: 82  IFSLQPIITNFDSSPK--DWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQ 135
            F L+ +  N  S      +LR+ + L   D          +  +   I+  +      +
Sbjct: 66  FFPLESMTVNLQSDDGQQHFLRIGLTLKLGDAGTQQVLSDHMPEVRSRILLALSNKHPDE 125

Query: 136 ITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
           +   +G R   E+++  +   +        V  V+F  F++
Sbjct: 126 LAPLEGKRALAEELKTLISEPTDKGAAPIRVQDVLFTEFVV 166


>gi|258592492|emb|CBE68801.1| putative Flagellar basal body-associated protein FliL [NC10
           bacterium 'Dutch sediment']
          Length = 183

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 58/176 (32%), Gaps = 21/176 (11%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            +  TS   RG    + V   +V    G   G    ++   L    KE+  +        
Sbjct: 21  EEKKTSAAGRGKLVAMAVQAGIVIALTGAAFGINIYVLKPMLVVNGKEQAKESEPEAKKE 80

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALI-----CKDIPDKVF 116
            ++ +              I  L P I N    + + +L++ + +            +  
Sbjct: 81  HHAGK--------------ILPLDPAIVNIAGTNGRRYLKVTVQIEIPEEEELVKEVEAR 126

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
              L   ++  +    ++++T A   +  K+ I ++  K      + +V    F+I
Sbjct: 127 KALLSDRLIQILSGKPLEEVTSAGSLQALKQQIADQFGKELGADRLQNVYLTEFVI 182


>gi|71906406|ref|YP_283993.1| flagellar basal body-associated protein FliL [Dechloromonas
           aromatica RCB]
 gi|71846027|gb|AAZ45523.1| Flagellar basal body-associated protein FliL [Dechloromonas
           aromatica RCB]
          Length = 187

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/142 (13%), Positives = 50/142 (35%), Gaps = 19/142 (13%)

Query: 49  KEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALI 107
           K+   +    +   +            +       +L+P   N    +   +L++ I+L 
Sbjct: 45  KKGNPEDGDEDVAEETVKSKKKDKKKDAHAAPVFVNLEPFTVNLVPETGDQYLQVVISLE 104

Query: 108 CKDIPDK----VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR------- 156
            +D  ++      +  +  ++   + +    ++   +G  +  E ++E +          
Sbjct: 105 IEDPLEEPTLKAQMPKIRNNLTLLLSSKKASELLPKEGKEHLAESLKEEINSVIEPPKKN 164

Query: 157 -------SQGFVSSVIFRTFII 171
                   +G V SV+F +FII
Sbjct: 165 KKGEVVTPEGPVKSVLFTSFII 186


>gi|331269326|ref|YP_004395818.1| flagellar protein FliL [Clostridium botulinum BKT015925]
 gi|329125876|gb|AEB75821.1| flagellar protein FliL [Clostridium botulinum BKT015925]
          Length = 163

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/182 (16%), Positives = 55/182 (30%), Gaps = 31/182 (17%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +  S    G  + L +   V+   I +  G   G ++      Q        I N 
Sbjct: 1   MAEAENKSG---GKGNILKIIIIVLLAAILLGGGTFAGYLVASKNKPQSSAANLSVIQNT 57

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKD-------- 110
                               + F+L   + N  S      +L+  +++   D        
Sbjct: 58  -----------------LNQKTFALDEFLVNLKSDDGSNRYLKTKVSVGYADIKENAKLQ 100

Query: 111 IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
                        I A +R+   +    +      KE+I+ +V  L   G + +V F   
Sbjct: 101 DELTTKKAIARDAINAILRSKKKEDFATSAQVEKIKEEIKSKVNPLLQDGQIINVYFSEI 160

Query: 170 II 171
           II
Sbjct: 161 II 162


>gi|296157438|ref|ZP_06840273.1| flagellar basal body-associated protein FliL [Burkholderia sp.
           Ch1-1]
 gi|295892210|gb|EFG71993.1| flagellar basal body-associated protein FliL [Burkholderia sp.
           Ch1-1]
          Length = 168

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/124 (12%), Positives = 41/124 (33%), Gaps = 11/124 (8%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDI----P 112
           +     +  +        L     F L+ +  N  S      +LR+ + L   D      
Sbjct: 44  SKRAPAAGSAETASAPAPLAAPLFFPLESMTVNLQSDDGQPHFLRIGLTLKLTDAKTQQE 103

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFR 167
               +  +   I+  +     +++   +G R    +++  ++  +        V  V+F 
Sbjct: 104 LTEHMPEVRSRILLALSNKHPEELAPLEGKRALATELQTLIEQPTDKGAAPIHVQDVLFT 163

Query: 168 TFII 171
            F++
Sbjct: 164 EFVV 167


>gi|288573017|ref|ZP_06391374.1| flagellar basal body-associated protein FliL [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288568758|gb|EFC90315.1| flagellar basal body-associated protein FliL [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 151

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/167 (11%), Positives = 42/167 (25%), Gaps = 31/167 (18%)

Query: 15  QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDT 74
           +  L +    +        G     +                          RSV     
Sbjct: 3   KRILLIAVIALIALALGAGGGYFMGLRFG--------------------AEERSVTGVSK 42

Query: 75  ISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET------LHQDIMAYI 128
              +   I      + N        +  ++AL       +  L        +  +++  +
Sbjct: 43  DLERPGPIVDFGDFVVNLADKEPHLVNFELALEASGTKAEAILTDGGWRSHIRNEVLLTV 102

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
           +   +     A+G     +D+  R+            V  V+FR F+
Sbjct: 103 KDHIVDDFRSAEGIMELSDDMRRRINAILPSVDGKVAVRRVLFRKFV 149


>gi|269792933|ref|YP_003317837.1| flagellar basal body-associated protein FliL [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100568|gb|ACZ19555.1| flagellar basal body-associated protein FliL [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 149

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/171 (12%), Positives = 49/171 (28%), Gaps = 38/171 (22%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
            +  +F    VV   +GI  G + G+        ++                        
Sbjct: 3   KKALIFGVIGVVVLLLGIGGGVMVGLKFFGSDKPEE------------------------ 38

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLE------TLHQDIMAY 127
              L      SL     N        ++L + L  +D      L        +  +++  
Sbjct: 39  -KLLPPGPTVSLGSFTINLADPEPHLIQLGVTLELEDQETATMLADPGWMSRIKNEVILT 97

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-------GFVSSVIFRTFII 171
           ++      +  ++G +   +D+  ++              V  V+F  F++
Sbjct: 98  VKDRRYDDLKSSEGAQILAQDLRGKLNSILPRTKKTRKVPVRQVLFDQFML 148


>gi|85058025|ref|YP_453727.1| flagellar protein FliL [Sodalis glossinidius str. 'morsitans']
 gi|84778545|dbj|BAE73322.1| flagellar protein FliL [Sodalis glossinidius str. 'morsitans']
          Length = 162

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/159 (12%), Positives = 49/159 (30%), Gaps = 22/159 (13%)

Query: 24  VVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIF 83
                +G       G+++      +++                 +V +    +      F
Sbjct: 14  AAVIILGTITVLALGLLVYLQPGIKEDAIPVAQ-----------TVDSLPAENTLPPVYF 62

Query: 84  SLQPIITNFDSSPKDW---LRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQI 136
            L     +      D+   L + + L  +D       +  L  L   ++  +   S   I
Sbjct: 63  PLDAFTVSLQPDNGDYGAMLYVGLTLRLQDEKTRALMESQLPELRNYLILLLSQQSPASI 122

Query: 137 TGAQGFRYFKEDIEERVKLR----SQGFVSSVIFRTFII 171
           + A   +     I++ +  +       +V+ V F +FI+
Sbjct: 123 SSAADKQALLTQIKQELNQQRPNGQPPYVTDVFFNSFIV 161


>gi|254973923|ref|ZP_05270395.1| flagellar basal body-associated protein [Clostridium difficile
           QCD-66c26]
 gi|255312967|ref|ZP_05354550.1| flagellar basal body-associated protein [Clostridium difficile
           QCD-76w55]
 gi|255515726|ref|ZP_05383402.1| flagellar basal body-associated protein [Clostridium difficile
           QCD-97b34]
 gi|255648820|ref|ZP_05395722.1| flagellar basal body-associated protein [Clostridium difficile
           QCD-37x79]
 gi|260682039|ref|YP_003213324.1| flagellar basal body-associated protein [Clostridium difficile
           CD196]
 gi|260685637|ref|YP_003216770.1| flagellar basal body-associated protein [Clostridium difficile
           R20291]
 gi|306518935|ref|ZP_07405282.1| flagellar basal body-associated protein [Clostridium difficile
           QCD-32g58]
 gi|260208202|emb|CBA60550.1| flagellar basal body-associated protein [Clostridium difficile
           CD196]
 gi|260211653|emb|CBE01914.1| flagellar basal body-associated protein [Clostridium difficile
           R20291]
          Length = 147

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/141 (10%), Positives = 43/141 (30%), Gaps = 15/141 (10%)

Query: 34  GWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD 93
               G  +L     ++ +K                + TG      K +   L+ ++    
Sbjct: 18  SAGAGFFILGEGGNKQIDKIAGLF-----------IPTGKGKDEVKTENLDLEEMVLKLA 66

Query: 94  SSPKDWLRLDIALICK--DIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEE 151
                +L++ I +         +     +  +I+             A   +  KE+I+ 
Sbjct: 67  DEGVRYLKVSITVSYDSSYKDIEKNTPLIRDNIINCFMAKRADDF-TADNLKNIKEEIKN 125

Query: 152 RVKL-RSQGFVSSVIFRTFII 171
            + +   +  + ++ F   ++
Sbjct: 126 TLNIQLGENVIQNIYFTNIVV 146


>gi|302872560|ref|YP_003841196.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575419|gb|ADL43210.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 156

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 43/120 (35%)

Query: 52  KYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI 111
                                  ++  K  + +LQ   TN     +  ++L++       
Sbjct: 36  SPASPTAKTTPVEKKPEKLYTYDVNDGKALMSNLQDTQTNAGRIIRLTVQLEVTDKKLSE 95

Query: 112 PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             K     +   I + +R+ +  ++   +G    +++I++R+    +  V +V F  FII
Sbjct: 96  TLKEKNIVIADIIDSVLRSKTADELLKPEGKEKVRKEIKDRLNEVFENKVYNVNFGEFII 155


>gi|194365651|ref|YP_002028261.1| flagellar basal body-associated protein FliL [Stenotrophomonas
           maltophilia R551-3]
 gi|194348455|gb|ACF51578.1| flagellar basal body-associated protein FliL [Stenotrophomonas
           maltophilia R551-3]
          Length = 171

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/123 (11%), Positives = 35/123 (28%), Gaps = 11/123 (8%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS--PKDWLRLDIALICKDIP---- 112
            +  ++                        + N +       +L+L++ L+ +D      
Sbjct: 47  QSKQEDKAAPAPKKAAAPAPAQYFALDPAFVVNLNGPVDGPRYLQLEVQLMTRDPAALEA 106

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFR 167
            K     +   ++     VS  QI    G +  +      V+              ++F 
Sbjct: 107 IKTHAPAIRARLLMLFSQVSPDQIADIAGKQKLQATSLAEVQKVLKAETGSNGADDLLFT 166

Query: 168 TFI 170
           +F+
Sbjct: 167 SFV 169


>gi|33596152|ref|NP_883795.1| flagellar protein FliL [Bordetella parapertussis 12822]
 gi|33601559|ref|NP_889119.1| flagellar protein FliL [Bordetella bronchiseptica RB50]
 gi|33573155|emb|CAE36806.1| flagellar protein FliL [Bordetella parapertussis]
 gi|33575995|emb|CAE33075.1| flagellar protein FliL [Bordetella bronchiseptica RB50]
          Length = 190

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/145 (10%), Positives = 39/145 (26%), Gaps = 10/145 (6%)

Query: 37  GGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP 96
           G    +           Q  +                   +       L+       ++ 
Sbjct: 45  GTWYFMKRMQPPVAVPVQLGVGQPQATPMQFVAPPATPPVVPAPIFIPLEAFTVTLQNAD 104

Query: 97  KDWL-----RLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEE 151
            + +      L ++        + ++  +   I+  + + S + +   QG       I E
Sbjct: 105 SERILHVGITLRVSDEQTRQRIEKYMPEVRSRILMVLSSQSPQAVQTLQGKTEMAHAITE 164

Query: 152 RVKLRSQG-----FVSSVIFRTFII 171
            VK          +V+  +F  F++
Sbjct: 165 AVKRPFSPLPDGQYVTDALFTAFVV 189


>gi|33592496|ref|NP_880140.1| flagellar protein FliL [Bordetella pertussis Tohama I]
 gi|33572142|emb|CAE41685.1| flagellar protein FliL [Bordetella pertussis Tohama I]
 gi|332381914|gb|AEE66761.1| flagellar protein FliL [Bordetella pertussis CS]
          Length = 182

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/145 (10%), Positives = 39/145 (26%), Gaps = 10/145 (6%)

Query: 37  GGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP 96
           G    +           Q  +                   +       L+       ++ 
Sbjct: 37  GTWYFMKRMQPPVAVPVQLGVGQPQATPMQFVAPPATPPVVPAPIFIPLEAFTVTLQNAD 96

Query: 97  KDWL-----RLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEE 151
            + +      L ++        + ++  +   I+  + + S + +   QG       I E
Sbjct: 97  SERILHVGITLRVSDEQTRQRIEKYMPEVRSRILMVLSSQSPQAVQTLQGKTEMAHAITE 156

Query: 152 RVKLRSQG-----FVSSVIFRTFII 171
            VK          +V+  +F  F++
Sbjct: 157 AVKRPFSPLPDGQYVTDALFTAFVV 181


>gi|71737943|ref|YP_275532.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|257484907|ref|ZP_05638948.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|289629024|ref|ZP_06461978.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|289651614|ref|ZP_06482957.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. aesculi str. 2250]
 gi|298487825|ref|ZP_07005865.1| Flagellar biosynthesis protein fliL [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71558496|gb|AAZ37707.1| flagellar protein FliL [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298157550|gb|EFH98630.1| Flagellar biosynthesis protein fliL [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330866454|gb|EGH01163.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. aesculi str. 0893_23]
 gi|330986498|gb|EGH84601.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. lachrymans str. M301315]
 gi|331011073|gb|EGH91129.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 166

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/181 (7%), Positives = 50/181 (27%), Gaps = 26/181 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +         + KL +   V               +M                  +
Sbjct: 1   MAKSEEVKDPATKGKLKLIILAVVALLLAVGLSVGATWFLM----------------HKS 44

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDKV 115
                  +      +    +        + NF+S+ +  ++++ I +           K 
Sbjct: 45  ESTPDPAAAAAAANVKPVAVFEPMTPAFVVNFNSNGRQRYMQVSITMLARNAADMEALKA 104

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +  +  +++     +  + +    G    ++     ++  +Q       +  ++F  F+
Sbjct: 105 HMPLIRNNLVMLFAAIPFESLASPIGQEMLRQKATASIQEVAQKELGKTVIEQLLFTNFV 164

Query: 171 I 171
           +
Sbjct: 165 L 165


>gi|255305284|ref|ZP_05349456.1| flagellar basal body-associated protein [Clostridium difficile ATCC
           43255]
          Length = 147

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/141 (10%), Positives = 44/141 (31%), Gaps = 15/141 (10%)

Query: 34  GWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD 93
               G  +L     ++ +K                + TG      K +   L+ ++    
Sbjct: 18  SAGAGFFILGEGGNKQIDKIAGLF-----------IPTGKGKDEVKTENLDLEEMVLKLA 66

Query: 94  SSPKDWLRLDIALICK--DIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEE 151
                +L++ I +         +     +  +I+             A+  +  KE+I+ 
Sbjct: 67  DEGVRYLKVSITVSYDSSYKDIEKNTPLIRDNIINCFMAKRADDF-TAENLKNIKEEIKN 125

Query: 152 RVKL-RSQGFVSSVIFRTFII 171
            + +   +  + ++ F   ++
Sbjct: 126 TLNIQLGENVIQNIYFTNIVV 146


>gi|220933874|ref|YP_002512773.1| Flagellar basal body-associated protein-like protein
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995184|gb|ACL71786.1| Flagellar basal body-associated protein-like protein
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 134

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 11/113 (9%), Positives = 37/113 (32%), Gaps = 10/113 (8%)

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICKDIPDKV----FLETLHQD 123
           V         +  I    P++ N  +  +  +L++   L  +   D       +  +   
Sbjct: 21  VPVSAAQESFRPYIALDPPLVVNLANPTRAQYLQIVAELQVESPEDAAAVQTHMPVIRDT 80

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-----GFVSSVIFRTFII 171
           ++ +       ++   +     + +    ++   +       V ++ F +F+I
Sbjct: 81  LLVFFGGRDPAEVRPVENREELRAEALGAIRAALETHSGRPAVDALYFTSFLI 133


>gi|256831226|ref|YP_003159954.1| flagellar basal body-associated protein FliL [Desulfomicrobium
           baculatum DSM 4028]
 gi|256580402|gb|ACU91538.1| flagellar basal body-associated protein FliL [Desulfomicrobium
           baculatum DSM 4028]
          Length = 254

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/180 (11%), Positives = 54/180 (30%), Gaps = 13/180 (7%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY-- 62
           +      + N+ KL++        + +  G     +     A  ++   +          
Sbjct: 74  EQLETPAKKNRKKLWIFGIAAGLCLLLGAGGSYFFMKSDPPAPGEQTSTEAESTQEPQTP 133

Query: 63  -----DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDI----P 112
                     S     T   +++Q +SL+     ++   K  +L    ++          
Sbjct: 134 QDSALPADADSPEKAQTQKPEEIQAYSLEQFQIEYNLEGKIRFLTCRFSIPDTTPVMRAE 193

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            +     +   I  Y++   +  +   Q     K DI   +      G VS ++   +++
Sbjct: 194 IQAKRVLIRDGIYRYLKNSPLFFMDNPQESEKLKTDITTVINQTVKSGHVSEILLEEYVV 253


>gi|254446660|ref|ZP_05060136.1| flagellar basal body-associated protein FliL [Verrucomicrobiae
           bacterium DG1235]
 gi|198260968|gb|EDY85276.1| flagellar basal body-associated protein FliL [Verrucomicrobiae
           bacterium DG1235]
          Length = 175

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 11/180 (6%), Positives = 55/180 (30%), Gaps = 15/180 (8%)

Query: 1   MSYD----DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKF 56
           M+ +    +   Q  +G      +   +V   + +    +   +++ +   +  E  ++ 
Sbjct: 1   MAEEQAASEAPKQSAKGGGGSGMIPALLVIVLMPVISFAMFKFMIIPMIKAELPEHGEEA 60

Query: 57  ILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP---- 112
            +              +   + +  + +++       +S   +++    +          
Sbjct: 61  QITAEDLEITYDESGTEYSVVFEPVVANVK------GTSQTRFIQAIFTVYGTHPDFESL 114

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            +   + L     + +  +++  +   +     +  + E       +  V  + F  F++
Sbjct: 115 VEGKKDRLRDHADSILGNLTLADLERREMKNIVRNQLREGFNHKIGKPIVEDISFSQFVV 174


>gi|83816250|ref|YP_446690.1| flagellar basal body-associated protein FliL [Salinibacter ruber
           DSM 13855]
 gi|83757644|gb|ABC45757.1| Flagellar basal body-associated protein FliL [Salinibacter ruber
           DSM 13855]
          Length = 204

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/112 (15%), Positives = 44/112 (39%), Gaps = 6/112 (5%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDIPDKVFLET----L 120
           V     GD  S K   +  L+ ++ N        +L + +    +    K  +E     +
Sbjct: 92  VGGDSGGDAESKKVGALSKLEGLVVNPAGSRGNRYLAISVVFEMEAPKVKKEMEKKKVII 151

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              ++  +   ++++++  +     K+ + E    + S+G V  + F  F++
Sbjct: 152 KDAVLRLLSERTVEELSDPERRDNLKKALREEANGILSKGEVDRLYFTEFVL 203


>gi|317048605|ref|YP_004116253.1| flagellar basal body-associated protein FliL [Pantoea sp. At-9b]
 gi|316950222|gb|ADU69697.1| flagellar basal body-associated protein FliL [Pantoea sp. At-9b]
          Length = 161

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/178 (14%), Positives = 51/178 (28%), Gaps = 31/178 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           + +   +G +  + +   ++ T             M+    G K E              
Sbjct: 2   SDNAKAKGRKRSILIPVLLIVTLAACSVAGYAVWRMMNKHEGDKPEVA------------ 49

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIP----DKVFLE 118
                            F++     N  +    P   L +   L   D         +L 
Sbjct: 50  -------KVEPPPAPVFFAMDTFTVNLVNPDNDPDRVLYVGFTLRLPDEDTRRRLNDYLP 102

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
            +   ++  +   S   +   QG +   + I++      VK +    VS V+F  FI+
Sbjct: 103 EVRSRLLLLLSRQSAAALATEQGKQALVDQIKQVLAPPLVKGQPPQVVSDVLFTAFIL 160


>gi|32490803|ref|NP_871057.1| hypothetical protein WGLp054 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166009|dbj|BAC24200.1| fliL [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 162

 Score = 61.7 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/124 (12%), Positives = 41/124 (33%), Gaps = 11/124 (8%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-------LRLDIALICKDI 111
                 +  ++ +    +      F L     +      ++       L L +       
Sbjct: 38  EEKSIPNSPTIESPQLENSVSNIYFPLDAFTVSLQPEDGEYGSMLYIGLTLRLKNESIKE 97

Query: 112 PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS----QGFVSSVIFR 167
             +  L  L   ++  +   +   ++ ++G     ++I++ +  +S       V+ V F 
Sbjct: 98  LLESKLPELRNQLILLLSQQTPSSLSSSEGKNVLLKEIKKELNKQSIDDQNPMVNDVFFN 157

Query: 168 TFII 171
           +FII
Sbjct: 158 SFII 161


>gi|92114084|ref|YP_574012.1| flagellar basal body-associated protein FliL [Chromohalobacter
           salexigens DSM 3043]
 gi|91797174|gb|ABE59313.1| flagellar basal body-associated protein FliL [Chromohalobacter
           salexigens DSM 3043]
          Length = 165

 Score = 61.7 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/119 (11%), Positives = 37/119 (31%), Gaps = 11/119 (9%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDS--SPKDWLRLDIALICKDIP----DKVFL 117
            +  +  T +           ++P   N  S       L + ++L   D       + ++
Sbjct: 46  QASANEETTEPKEAPAPIFVKIEPFTINLQSDEYSDRLLYVGLSLKVGDETTRAFLEEYM 105

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGF----VSSVIFRTFII 171
             +   ++  +       +   +G +     I        ++      V+ V+F  FI+
Sbjct: 106 PEVRSRLLMLLSGQQADTLIKPEGKQRLANQILAMFDEPLTEPQPSLDVTGVLFSEFIV 164


>gi|288941942|ref|YP_003444182.1| flagellar basal body-associated protein FliL [Allochromatium
           vinosum DSM 180]
 gi|288897314|gb|ADC63150.1| flagellar basal body-associated protein FliL [Allochromatium
           vinosum DSM 180]
          Length = 140

 Score = 61.7 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 38/102 (37%), Gaps = 9/102 (8%)

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLD----IALICKDIPDKVFLETLHQDIMAYIRTVSI 133
                 +L+P +    + P+ +L+L     I          + +  L   +++ +     
Sbjct: 37  PYPGYMALEPPLIVNLAKPRSYLKLSLQFFIETQTDADLITLHMPRLRDRMISLLGGRDG 96

Query: 134 KQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
           +QI   +     + ++ + ++        +  +S+V F  FI
Sbjct: 97  EQIMTTEAREQLRIELLDSLRKTMMEQTGRPAISAVYFTDFI 138


>gi|288962687|ref|YP_003452981.1| FliL protein [Azospirillum sp. B510]
 gi|288914953|dbj|BAI76437.1| FliL protein [Azospirillum sp. B510]
          Length = 179

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/121 (13%), Positives = 44/121 (36%), Gaps = 10/121 (8%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD-SSPKDWLRLDIALIC---KDIPDKV 115
                +V  +      S+    +  +  ++ N    +P  +L++ ++L          + 
Sbjct: 57  AAGTPAVERLWAPAAESVPADAVAEMPELVVNLRRDTPSRFLKIGLSLTVSPRDRQRVEQ 116

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ------GFVSSVIFRTF 169
            +  L   +  ++R +    + G+ G    + +I+ R  L           V+ V+ R+ 
Sbjct: 117 AMPQLTDSLQEFLRNLDQDDLEGSAGLHRLRSEIKRRFNLILSDPAGRRDVVTDVLLRSL 176

Query: 170 I 170
           +
Sbjct: 177 L 177


>gi|332284036|ref|YP_004415947.1| hypothetical protein PT7_0783 [Pusillimonas sp. T7-7]
 gi|330427989|gb|AEC19323.1| hypothetical protein PT7_0783 [Pusillimonas sp. T7-7]
          Length = 161

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 46/174 (26%), Gaps = 25/174 (14%)

Query: 8   SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVR 67
           +Q   G   K+  +       +    G                        +        
Sbjct: 2   AQTNTGKFAKMLKSMLTTALIVAASVGATLFF---------------SSKASQVSSLLES 46

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFD-SSPKDWLRLDIALICKDIP----DKVFLETLHQ 122
           ++     + L K     L+P             L + I L   +         F+  +  
Sbjct: 47  TLPEPKPVELPKPIFSPLEPFTVTLGTDRGTRILYVAITLRVDNELSRRLIAEFMPEVRD 106

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
            I+  +   +   I   QG       ++E ++           V+SV+F  F+I
Sbjct: 107 RILRTLSQQNANHIQTPQGRSELVALLDEAIERPYNPQPIGPSVNSVLFTAFVI 160


>gi|226944506|ref|YP_002799579.1| flagellar basal body-associated protein [Azotobacter vinelandii DJ]
 gi|226719433|gb|ACO78604.1| Flagellar basal body-associated protein [Azotobacter vinelandii DJ]
          Length = 162

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 47/175 (26%), Gaps = 28/175 (16%)

Query: 8   SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVR 67
           +   RG+    ++   ++              +M                 N        
Sbjct: 4   TPPARGSGKVNWLLAILLVLIAAGGSAAGVYFLM-----------------NKGAHAGAD 46

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIP----DKVFLETLH 121
           S        L       + P   N     +    L + ++L   D       K ++  L 
Sbjct: 47  SDAEAAAEPLPAPIFVPISPFTVNLRGEQREERLLYVGLSLQVTDKASEEFLKRYMPQLR 106

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK--LRSQG---FVSSVIFRTFII 171
             ++      +  ++    G       I E ++  + +      V+ V++  FI+
Sbjct: 107 SRLLKLFTAQTAAELMTPNGKDQLSAKILEMLQQPMATPQPTLRVTDVLYTDFIV 161


>gi|188579872|ref|YP_001923317.1| flagellar basal body-associated protein FliL [Methylobacterium
           populi BJ001]
 gi|179343370|gb|ACB78782.1| flagellar basal body-associated protein FliL [Methylobacterium
           populi BJ001]
          Length = 160

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 76/174 (43%), Gaps = 18/174 (10%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+    + +  +G     ++    + T + +  G   G+ +L       + K ++     
Sbjct: 1   MADAKDSKKGGKG-----WIGALALVTLVAVGTGGGLGVYLLGSVEKSVDLKKREEADKA 55

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFL 117
                             +L + S+  ++ N       W+R++ +++ K        V L
Sbjct: 56  VK----------VLNYTGELSLRSVGSVVANLAEPTDSWVRIESSVVFKTGTLPNPDVTL 105

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             +  D +AY+RT+S+ QI GA G ++ +ED+ ERV +R++G V  +I  + ++
Sbjct: 106 AEIRADALAYLRTLSMAQIEGASGLQHLREDLNERVAIRTKGAVRELIVESLVV 159


>gi|323136549|ref|ZP_08071630.1| flagellar basal body-associated protein FliL [Methylocystis sp.
           ATCC 49242]
 gi|322397866|gb|EFY00387.1| flagellar basal body-associated protein FliL [Methylocystis sp.
           ATCC 49242]
          Length = 185

 Score = 61.3 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 50/131 (38%), Gaps = 3/131 (2%)

Query: 44  LFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLD 103
                   ++     +                 L   ++  L  I+TN       W+RL 
Sbjct: 54  NPPPDAGSEHADAHGDPHKKGGGHGDAKKKAPDLASFEVKELPAIVTNLAQPESSWIRLQ 113

Query: 104 IALICKDIPD---KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF 160
            A++         +  +  L  DI A++RT SI  + G+ G R  +E++ ER  +RS+  
Sbjct: 114 AAIVYDPKELPHAEKLIAELTADITAFLRTASISSLEGSDGLRRLQEELGERATIRSERK 173

Query: 161 VSSVIFRTFII 171
           V   I  T ++
Sbjct: 174 VKEFIIETMVV 184


>gi|168180925|ref|ZP_02615589.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           NCTC 2916]
 gi|182668210|gb|EDT80189.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           NCTC 2916]
          Length = 173

 Score = 61.3 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 57/177 (32%), Gaps = 11/177 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS  +  ++     +  + V        I     + G ++      G           NN
Sbjct: 1   MSEKNVETKGEGFKKIIIIVL----VLVIVGAGAFGGYMLFAKNKKGANSANQMPVNNNN 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICK----DIPDKV 115
             ++   +        +   + +SL   + N      K +++  I +  +        + 
Sbjct: 57  VINSQQTNNGMYPQQVVVSSKTYSLDEFLVNLADEDGKRFVKAKIFIGYEEKKLAKELET 116

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               L   ++  +R+     I   +     K +I  ++  +  +G +SS+ F   I+
Sbjct: 117 KKPILRDAVIGVLRSKKAADIN-PKNIDKIKVEIINKISPMLEKGRISSIYFDDLIV 172


>gi|120553404|ref|YP_957755.1| flagellar basal body-associated protein FliL [Marinobacter
           aquaeolei VT8]
 gi|120323253|gb|ABM17568.1| flagellar basal body-associated protein FliL [Marinobacter
           aquaeolei VT8]
          Length = 151

 Score = 61.0 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 11/118 (9%), Positives = 36/118 (30%), Gaps = 12/118 (10%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIAL------ICKDIPDKVFLET 119
                    +      I      +T+          L  ++             +  +  
Sbjct: 32  AEEADEETEVKGVTDYIAMEPAFVTHVGKPDAKVAYLKASVTIRASRETTRPAVEAHMPR 91

Query: 120 LHQDIMAYIRTVS-IKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
           L  +++      + + Q++   G +  +E+  +R+    +       ++ V+F  F++
Sbjct: 92  LRHELVMLFGEQTDLDQLSSMDGQQALREEATKRINGVLEEQQTGETITGVLFTEFVV 149


>gi|304321128|ref|YP_003854771.1| flagellar motor protein [Parvularcula bermudensis HTCC2503]
 gi|303300030|gb|ADM09629.1| flagellar motor protein [Parvularcula bermudensis HTCC2503]
          Length = 165

 Score = 61.0 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 52/176 (29%), Gaps = 17/176 (9%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +    +  +     LF     V      F                        +   
Sbjct: 1   MAAETEEVEPKKEGGGFLFTGVLSVVAAASTFGMVWF------------AAAPPPPVDAA 48

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPDKVFLE- 118
                     T + I  +  +  +L+P   +    +    LR+ +AL       ++    
Sbjct: 49  ACAGFTAEPLTPEEIEARTAKYVALEPFTVSLGPDAGAKHLRMSVALGRPADAVELSESE 108

Query: 119 --TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
              L   ++  +R V +  IT   G    KE + ++ +       V +V+   F++
Sbjct: 109 HLRLRDKLLERLRKVELTTITDPDGMPALKESLLDQAQATLGPDTVYNVLVTEFVM 164


>gi|260893867|ref|YP_003239964.1| flagellar basal body-associated protein FliL [Ammonifex degensii
           KC4]
 gi|260866008|gb|ACX53114.1| flagellar basal body-associated protein FliL [Ammonifex degensii
           KC4]
          Length = 148

 Score = 61.0 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 21/169 (12%), Positives = 50/169 (29%), Gaps = 32/169 (18%)

Query: 10  YIRGNQHKLFVTWFVVYTFIGI-FCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRS 68
             +G + KL +   ++    G+   G   G+ +       +                   
Sbjct: 2   AEKGKKSKLVLILLLLLVLAGVSGGGIFLGVKLAGGKKPAQ------------------- 42

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIP-----DKVFLETLHQ 122
                      L+  SL  I+ N        +LR+ + L            +     L  
Sbjct: 43  -----PPPPPPLKTVSLDSIVVNLADGDTNHYLRVTVVLAVPADEKLAKEIEGKKFELRD 97

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFI 170
            I+  +R  +  ++         KE++++++        V  + F  ++
Sbjct: 98  LIIQLLRHKTFAEVMKPDYPTKLKEELKQKINAYLGGDKVKEIYFTEYL 146


>gi|296103564|ref|YP_003613710.1| flagellar biosynthesis protein FliL [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058023|gb|ADF62761.1| flagellar biosynthesis protein FliL [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 137

 Score = 61.0 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/119 (13%), Positives = 36/119 (30%), Gaps = 10/119 (8%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFL 117
                 +    +         F L     N   +    L + I L  KD         +L
Sbjct: 19  QQKPSTAAAKAELPPPPAPVFFPLDTFTVNLGDA-DRVLYVGITLRLKDEATRSRLNDYL 77

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
             +   ++          +   +G +   + I++      V  + +  V+ V++  FI+
Sbjct: 78  PEVRSRLLLLFSRQDASTLATDEGKQKLVDAIKQTLATPLVNGQPKQEVTDVLYTAFIL 136


>gi|260767949|ref|ZP_05876883.1| flagellar biosynthesis protein FliL [Vibrio furnissii CIP 102972]
 gi|260615979|gb|EEX41164.1| flagellar biosynthesis protein FliL [Vibrio furnissii CIP 102972]
          Length = 167

 Score = 61.0 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 11/167 (6%), Positives = 55/167 (32%), Gaps = 12/167 (7%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
            Q  + V   ++ T   +  G + G +       Q+  + ++   +   ++ +  +    
Sbjct: 3   KQQLITVFIMMIITSALVSAGTVFGGIWYL---KQQSAQQEQPSSDWLANSPLAFLSDTT 59

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLHQDIMAYIR 129
                       + +++    +   +L L+IA+  +          ++  +   ++    
Sbjct: 60  PSPKAPSFHSLDKVVLSVKGKNQNHFLMLEIAVETRHPERIANIGDYMPVVRNSLIKLFS 119

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
             + + +       + + +++  +    +       +  V+   +++
Sbjct: 120 DKTYEDLQQDGAIEHLQNEVKLTILNAFEKTDILRDIDDVLLTKYVV 166


>gi|269796386|ref|YP_003315841.1| flagellar basal body-associated protein [Sanguibacter keddieii DSM
           10542]
 gi|269098571|gb|ACZ23007.1| flagellar basal body-associated protein [Sanguibacter keddieii DSM
           10542]
          Length = 161

 Score = 61.0 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 12/104 (11%), Positives = 37/104 (35%), Gaps = 2/104 (1%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMA 126
                    + +  ++F+++ +  N       +LRL + L       ++         + 
Sbjct: 58  GKEAEAAEPAPEPGEVFTVEAMSINLAD--GHYLRLGLGLQLTAEAHELDAAKARDAAIV 115

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFI 170
                S+++++  +     K ++  ++    +G V  V    F+
Sbjct: 116 LFSGKSVEEVSDPESRDALKGELAHQLDELYEGEVMGVYLTDFV 159


>gi|315179653|gb|ADT86567.1| LafF [Vibrio furnissii NCTC 11218]
          Length = 167

 Score = 61.0 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 11/167 (6%), Positives = 56/167 (33%), Gaps = 12/167 (7%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
            Q  + V   ++ T   +  G + G +       Q+  + ++   +   ++ +  +   +
Sbjct: 3   KQQLITVFIMMIITSALVSAGTVFGGIWYL---KQQSAQQEQPSSDWLANSPLAFLSETN 59

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLHQDIMAYIR 129
                       + +++    +   +L L+IA+  +          ++  +   ++    
Sbjct: 60  QSPKAPSFHSLDKVVLSVKGKNQNHFLMLEIAVETRHPERIANIGDYMPVVRNSLIKLFS 119

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
             + + +       + + +++  +    +       +  V+   +++
Sbjct: 120 DKTYEDLQQDGAIEHLQNEVKLTILNAFEKTDILRDIDDVLLTKYVV 166


>gi|312792658|ref|YP_004025581.1| flagellar basal body-associated protein flil [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312876508|ref|ZP_07736491.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796719|gb|EFR13065.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|312179798|gb|ADQ39968.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 159

 Score = 61.0 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 46/131 (35%)

Query: 41  MLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWL 100
            L +             +                ++  K  + +LQ   TN     +  +
Sbjct: 28  FLTVIKNLSPTTSAAKAVKTINAEKKPEKLYTYDVNDGKALMSNLQDTQTNTGRIIRVTV 87

Query: 101 RLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF 160
           +L++         K     +   I + +R+ +  ++   +G    +++I++R+    +  
Sbjct: 88  QLEVTDKKLPETMKEKNIVIADIIDSVLRSKTADELLKPEGKEKVRKEIKDRLNEIFENK 147

Query: 161 VSSVIFRTFII 171
           V +V F  FII
Sbjct: 148 VYNVNFGEFII 158


>gi|221635436|ref|YP_002523312.1| flagellar basal body-associated protein FliL [Thermomicrobium
           roseum DSM 5159]
 gi|221157605|gb|ACM06723.1| flagellar basal body-associated protein FliL [Thermomicrobium
           roseum DSM 5159]
          Length = 181

 Score = 61.0 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 15/159 (9%), Positives = 42/159 (26%), Gaps = 22/159 (13%)

Query: 35  WLGGIVMLFLFAGQK---------EEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSL 85
              G  +L                     K         +V        ++      +  
Sbjct: 22  AGAGFFLLGGAGAAPFVLNITINQSGDGGKSAAPAEQHLTVSLGERIVNLADPGGYRYLK 81

Query: 86  QPIITNFDSSPKDWLRLDIALICKD------------IPDKVFLETLHQDIMAYIRTVSI 133
             I+       K + RL  A                    +     +   +   + + ++
Sbjct: 82  TEIVVEVAVDQKTYERLTAAGGGGGHGGGGGSTDPLRAELEHSWPKIQDTLTMVLTSKTV 141

Query: 134 KQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            ++   +G  + K+++ E+++       ++ V    F+I
Sbjct: 142 DELATLEGKEHLKDELREKLQPAFGDYKITEVYLTQFVI 180


>gi|168699682|ref|ZP_02731959.1| hypothetical protein GobsU_09174 [Gemmata obscuriglobus UQM 2246]
          Length = 170

 Score = 61.0 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 21/182 (11%), Positives = 61/182 (33%), Gaps = 24/182 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+   T +   +     + +        + +  G +  + M  +    K+ + +K     
Sbjct: 1   MATAATEAAPKKKGGKLILII----VCLVALGGGAVVPMAMGGVPPFGKKAEGEKDKDKA 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK------ 114
                  S           + +              + +LRL IA++     +K      
Sbjct: 57  PKKKPAESKTAIVPFGDVVVNLVE---------ERQQRYLRLKIAVLVDAEAEKEVTAMV 107

Query: 115 -VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR----SQGFVSSVIFRTF 169
                 +   ++ ++   S K ++G+ G +  + ++ ER++          + +V+F  +
Sbjct: 108 TAKKAAVKSALIGHLAGKSTKDVSGSVGVQRMQRELLERIEEVLYPDGSSRIRAVLFEEY 167

Query: 170 II 171
           ++
Sbjct: 168 VV 169


>gi|167949828|ref|ZP_02536902.1| Flagellar basal body-associated protein FliL [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 137

 Score = 61.0 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 18/111 (16%), Positives = 43/111 (38%), Gaps = 9/111 (8%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLHQDIM 125
             G+  S   +  + + P +    +    ++R D+ L+ KD       ++    +  +++
Sbjct: 26  KAGEDGSSGSVLYYEISPSLVANLAKGGKYIRCDVQLMTKDENFLEQMRLHGPAIRHELL 85

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFII 171
             +     K I  +QG    ++   E V     K+     V ++ F T+ +
Sbjct: 86  LLLSEQDGKVIKTSQGKEQLRKQALESVSRVMKKIAGSDSVQALYFTTYYV 136


>gi|218288305|ref|ZP_03492604.1| flagellar basal body-associated protein FliL [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218241664|gb|EED08837.1| flagellar basal body-associated protein FliL [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 144

 Score = 61.0 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 19/163 (11%), Positives = 42/163 (25%), Gaps = 24/163 (14%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           +     + +    +    G   G+L          G   +   K + +            
Sbjct: 2   KKAVRTMLMIVLGIVVIAGAAIGYLLYSKKHHTAGGAPSKLSAKQMADLQ---------- 51

Query: 72  GDTISLKKLQIFSLQPIITNFDSSP--KDWLRLDIALICKDIPDKVFLETLHQDIMAYIR 129
                       +L  + TN   S   +  L L            +    +   +   +R
Sbjct: 52  -----------VTLPQMTTNLAGSGIIQFTLTLQADSKSTKNELNLMEPQISDAVNGIMR 100

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
             +  ++    G    K  I  +V      G V++V     ++
Sbjct: 101 EFTSDELRTDAGLNRLKATIVSQVNRLLPTGKVTAVYLSQVLV 143


>gi|167947457|ref|ZP_02534531.1| flagellar basal body-associated protein FliL [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 131

 Score = 60.6 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 8/111 (7%), Positives = 31/111 (27%), Gaps = 10/111 (9%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLHQDIM 125
              +               + N    P   +++ + +  +        K     +    +
Sbjct: 21  PAAEVEKGPPQYHALDPVFVVNLPGKPS-LIQVGVTVRVRSDQMVEFLKHNDPMIRHHFL 79

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
             +     K +   +     + ++ +++          G V ++ F  F++
Sbjct: 80  DLLGAKDGKVLKNREAKEALQREMLDKLNGIVKELDGPGEVEALYFTNFVM 130


>gi|283850188|ref|ZP_06367477.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           FW1012B]
 gi|283574214|gb|EFC22185.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           FW1012B]
          Length = 149

 Score = 60.6 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 16/97 (16%), Positives = 38/97 (39%), Gaps = 4/97 (4%)

Query: 78  KKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIK 134
               +  L P+  N  S+       L + +     +  +++ L    +D++ ++ +   +
Sbjct: 51  AVDGVIDLGPVTVNVLSNRGFRFLRLSMQVQCETNEEAERLTLPDAKEDLVFFLSSKMAE 110

Query: 135 QITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFI 170
            + G  G    + D+ E   K    G V ++ F  F+
Sbjct: 111 DLLGNPGKMILRRDLTELFSKYAGAGKVKNIFFTEFV 147


>gi|187935791|ref|YP_001885054.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           B str. Eklund 17B]
 gi|187723944|gb|ACD25165.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           B str. Eklund 17B]
          Length = 159

 Score = 60.6 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 20/179 (11%), Positives = 51/179 (28%), Gaps = 31/179 (17%)

Query: 1   MSYDDTTSQYI-RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILN 59
           M+  D +     +G    +      V   + +  G  G   +                  
Sbjct: 1   MADKDKSKDKELKGKSGNMKTIIIFVVALLLVGGGVFGTTYIFM---------------- 44

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICK------DIP 112
                  ++       S   +    +  I  N      K + +  I++         +  
Sbjct: 45  ------QKNAKIVVQESAIDITYVDMGEITANLADEGGKRYFKGQISIGYDKTDKDAETE 98

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
            K     +   I+ Y++++ I  I      +  K  + +++    ++  +  V F + I
Sbjct: 99  LKEKKVVVRDSIIFYLKSLKIDYINDTNNEKEIKVQLMDKINKQLTKSKIVDVRFDSII 157


>gi|312126830|ref|YP_003991704.1| flagellar basal body-associated protein flil [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776849|gb|ADQ06335.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 156

 Score = 60.6 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 43/120 (35%)

Query: 52  KYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI 111
                                  ++  K  + +LQ   TN     +  ++L++       
Sbjct: 36  SPTSSAAKTTPVEKKPEKLYTYDVNDGKALMSNLQDTQTNAGRIIRVTVQLEVTDKKLPE 95

Query: 112 PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             K     +   I + +R+ +  ++   +G    +++I++R+    +  V +V F  FII
Sbjct: 96  TMKEKNIVIADIIDSVLRSKTADELLKPEGKEKVRKEIKDRLNEIFENKVYNVNFGEFII 155


>gi|90023224|ref|YP_529051.1| flagellar basal body-associated protein-like protein
           [Saccharophagus degradans 2-40]
 gi|89952824|gb|ABD82839.1| flagellar basal body-associated protein FliL [Saccharophagus
           degradans 2-40]
          Length = 161

 Score = 60.6 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 56/154 (36%), Gaps = 19/154 (12%)

Query: 31  IFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIIT 90
           I C WL  I +LF          Q        +        G  +    + +    P + 
Sbjct: 12  IGCAWLVAIALLFTGL------AQAQDDPPPEEAPAEEGAEGAEVPASAIYLPIKPPFVV 65

Query: 91  NFDSSPK-DWLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYF 145
           N+  + +  +++ ++++   D       +  L  +  +++    + + + ++  +G    
Sbjct: 66  NYGGAGRLKYIKTELSVRLLDTTAANAVRHHLPYVRNNLVLLFSSQTDETMSSQEGREAL 125

Query: 146 K----EDIEERVKLRSQGFVS----SVIFRTFII 171
           +    ++I E +K      V+     V F +FI+
Sbjct: 126 RIACLKEIREIIKREEGDEVAAGVIDVFFNSFIV 159


>gi|4099303|gb|AAD00576.1| FliL [Rhodobacter sphaeroides]
          Length = 189

 Score = 60.6 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 21/150 (14%), Positives = 43/150 (28%), Gaps = 17/150 (11%)

Query: 38  GIVMLFLFAGQK------EEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITN 91
                   +  K      E   +        D   +               +  +  +T 
Sbjct: 40  YFYFANPLSPAKDVLRLIERTPEADEPAADPDAPQKVPRPTPERESFVTSYYQFKEPLTT 99

Query: 92  FDSSPKDWLRLDIALICKDI-----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFK 146
              + +  L+  I L  +               L  D++A + T S +++    G     
Sbjct: 100 NLRASRRLLQAGIGLSTQYDQKVMDNVARNEVALRSDMLAIVGTFSEEELQDKAGRDRL- 158

Query: 147 EDIEERVKLRSQ-----GFVSSVIFRTFII 171
            ++   V  R Q     G + +V F +FI+
Sbjct: 159 AELRGAVNARLQQLEGFGGIEAVFFPSFIL 188


>gi|312884905|ref|ZP_07744595.1| flagellar basal body-associated protein FliL [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309367382|gb|EFP94944.1| flagellar basal body-associated protein FliL [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 161

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 17/118 (14%), Positives = 44/118 (37%), Gaps = 10/118 (8%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWL-RLDIALICKDIPDKV----FLE 118
                V      +   + I   Q  + N +S  K+ + R+   L+ +   ++      + 
Sbjct: 43  KEEEVVSQPVATAEPVVYIALSQAFVFNVNSKTKNRIARIKAQLMLRGAKNEELARSHMP 102

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFII 171
            +   ++  +   +++Q+    G    ++ I E V     K   +  +  V+F  F++
Sbjct: 103 LIESTMLISLSVATVEQLRTVNGRGELRDKITEDVKTALNKAIGEPVIERVLFTDFVM 160


>gi|258511383|ref|YP_003184817.1| flagellar basal body-associated protein FliL [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257478109|gb|ACV58428.1| flagellar basal body-associated protein FliL [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 144

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 19/163 (11%), Positives = 42/163 (25%), Gaps = 24/163 (14%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           +     + +    +    G   G+L          G   +   K + +            
Sbjct: 2   KKAVRTMLMIVLGIVVIAGAAIGYLLYSKKHHAAGGAPSKLSAKQMADLQ---------- 51

Query: 72  GDTISLKKLQIFSLQPIITNFDSSP--KDWLRLDIALICKDIPDKVFLETLHQDIMAYIR 129
                       +L  + TN   S   +  L L            +    +   +   +R
Sbjct: 52  -----------VTLPQMTTNLAGSGIIQFTLTLQADSKSTKNELNLMEPQISDAVNGIMR 100

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
             +  ++    G    K  I  +V      G V++V     ++
Sbjct: 101 EFTSDELRTDAGLNRLKATIVSQVNRLLPTGKVTAVYLSQVLV 143


>gi|85710185|ref|ZP_01041250.1| hypothetical protein NAP1_14908 [Erythrobacter sp. NAP1]
 gi|85688895|gb|EAQ28899.1| hypothetical protein NAP1_14908 [Erythrobacter sp. NAP1]
          Length = 192

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 55/192 (28%), Gaps = 22/192 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVM--LFLFAGQKEEKYQKFIL 58
           M+ D       +  +  + +    V+  +    G    +             +  +    
Sbjct: 1   MASDKDDETDKKSGKGLMKIALGGVFLLVAGAGGAYAAVASGAFGDSGAGGPDLPEYVRK 60

Query: 59  NNFYDNSVRSVHTGDTISLK---------KLQIFSLQPIITNFDSSPKDWLRLDIALICK 109
            +    ++ S   GD  S+                      N   SP   +++++A+  +
Sbjct: 61  GDSDPYALPSSDKGDETSIVYGDGGSEYRTAYYSFDDSFTANLADSP-ALIQVELAVSTR 119

Query: 110 DIP-----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-----G 159
                    +     L   I+  +   S  +I   +G       + E V    +     G
Sbjct: 120 RDGRVLQWVQAHELALRSAILGQLAATSESEIYSVEGKDALAVRLTEAVNDVLEENEGFG 179

Query: 160 FVSSVIFRTFII 171
            V +V F+  ++
Sbjct: 180 GVDAVHFKGILV 191


>gi|294508626|ref|YP_003572685.1| flagellar protein FliL [Salinibacter ruber M8]
 gi|294344955|emb|CBH25733.1| flagellar protein FliL [Salinibacter ruber M8]
          Length = 136

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/112 (15%), Positives = 44/112 (39%), Gaps = 6/112 (5%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDIPDKVFLET----L 120
           V     GD  S K   +  L+ ++ N        +L + +    +    K  +E     +
Sbjct: 24  VGGDSGGDAESKKVGALSKLEGLVVNPAGSRGNRYLAISVVFEMEAPKVKKEMEKKKVII 83

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              ++  +   ++++++  +     K+ + E    + S+G V  + F  F++
Sbjct: 84  KDAVLRLLSERTVEELSDPERRDNLKKALREEANGILSKGEVDRLYFTEFVL 135


>gi|91785618|ref|YP_560824.1| flagellar basal body-associated protein FliL [Burkholderia
           xenovorans LB400]
 gi|91689572|gb|ABE32772.1| Flagellar basal body-associated protein FliL [Burkholderia
           xenovorans LB400]
          Length = 168

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/98 (14%), Positives = 36/98 (36%), Gaps = 11/98 (11%)

Query: 85  LQPIITNFDSSPK--DWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQITG 138
           L+ +  N  S      +LR+ + L   D          +  +   I+  +     +++  
Sbjct: 70  LESMTVNLQSDDGQQHFLRIGLTLKLNDAKTQQELSEHMPEVRSRILLALSNKHPEELAP 129

Query: 139 AQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
            +G R    +++  ++  +        V  V+F  F++
Sbjct: 130 LEGKRALATELQTLIEQPTDKGAAPIHVQDVLFTEFVV 167


>gi|89072295|ref|ZP_01158874.1| LafF [Photobacterium sp. SKA34]
 gi|89051827|gb|EAR57279.1| LafF [Photobacterium sp. SKA34]
          Length = 161

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 7/111 (6%), Positives = 38/111 (34%), Gaps = 10/111 (9%)

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLETLHQDIM 125
             +  +  +     L  +I +     +  ++ +++A+             ++  +   ++
Sbjct: 50  QSEPKATAQPAFHPLDKVIVSVKGERQSHYVMIELAVQTHYPERMKQIDSYMPLVRNALL 109

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFII 171
                   +++   Q     ++++++ +            +  V+F  ++I
Sbjct: 110 KMFSKKKYEELQNQQSIDQLQQEVKQTLTAAFANTTFARDIDDVLFTKYVI 160


>gi|296274400|ref|YP_003657031.1| flagellar basal body-associated protein FliL [Arcobacter
           nitrofigilis DSM 7299]
 gi|296098574|gb|ADG94524.1| flagellar basal body-associated protein FliL [Arcobacter
           nitrofigilis DSM 7299]
          Length = 176

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/186 (11%), Positives = 59/186 (31%), Gaps = 26/186 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +    +   G +  + V   ++   +    G    +    +F  Q+E+  Q+     
Sbjct: 1   MAEEVVEEKPKSGGKGLMIVLIALIVVLLLAVIGGGYFLYSQGVFNPQEEKAMQELGKKE 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVF 116
             ++        + + L                   +  ++L   +   D       + +
Sbjct: 61  VNNSKEMYKAAINDLVLN-----------ITNAKGREKLMKLSFTIKSNDPAIESIVESY 109

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----------SQGFVSSVI 165
              +   +++ I   S +++    G    K+++ + +               +  V  V+
Sbjct: 110 KAEIVDVVISQISARSSEELLTVGGKALLKDELVDEINKVLNEATATNSDIQKNSVKEVL 169

Query: 166 FRTFII 171
           F TF+I
Sbjct: 170 FTTFVI 175


>gi|24216274|ref|NP_713755.1| flagellar basal body-associated protein FliL [Leptospira
           interrogans serovar Lai str. 56601]
 gi|45656522|ref|YP_000608.1| flagellar protein [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|24197540|gb|AAN50773.1| flagellar basal body-associated protein FliL [Leptospira
           interrogans serovar Lai str. 56601]
 gi|45599757|gb|AAS69245.1| flagellar protein [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 174

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/177 (9%), Positives = 44/177 (24%), Gaps = 19/177 (10%)

Query: 3   YDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFY 62
            ++       G      +  +++Y    IF                              
Sbjct: 8   EEEGGLPAAEGGGGTSPIIKWLLYVAGAIFG-----------IIIVAVIAMIVAKETATK 56

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL------ICKDIPDKV 115
             +                    +    N     +  ++++ +A                
Sbjct: 57  TFTQMKNVALVKPPPPLANYNFTEEFRINTSDKGEAHFVKMKLAFGIAKEDQTLSAELAE 116

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               +   I   +   S  ++   +     +E+I+ +V  + ++G +  V F  FI+
Sbjct: 117 RNAQMRDLINLIVGRKSKDELINIEDQLDLREEIKAQVNHILTEGKIQEVYFTEFIV 173


>gi|294013063|ref|YP_003546523.1| flagellar basal body-associated protein FliL [Sphingobium japonicum
           UT26S]
 gi|292676393|dbj|BAI97911.1| flagellar basal body-associated protein FliL [Sphingobium japonicum
           UT26S]
          Length = 216

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 41/122 (33%), Gaps = 10/122 (8%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD-----IPDK 114
                    + +    +  +   F LQ   T+  S    + ++ IA+            K
Sbjct: 94  AHVPAKGIDLPSPANPAAYQATYFQLQTPFTSNMSDTDAFAQISIAVSTYYDIRVVEAIK 153

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-----GFVSSVIFRTF 169
                +   ++  +    ++ ++  +G R  +  I+  +    +     G V +V F  F
Sbjct: 154 AHEMAIRSQVLMMLAEQPVEALSMPEGKRALQAKIKTVINDILKQKTGYGGVDNVYFTNF 213

Query: 170 II 171
           +I
Sbjct: 214 VI 215


>gi|146296291|ref|YP_001180062.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409867|gb|ABP66871.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 157

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/140 (17%), Positives = 48/140 (34%), Gaps = 6/140 (4%)

Query: 32  FCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITN 91
             G     VM  L       K    +           V+ G  I      + +LQ    N
Sbjct: 23  GMGIGFLSVMKNLSPTSTTGKAAATVEKKPEKTYTYDVNDGKAI------MSNLQDTQNN 76

Query: 92  FDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEE 151
                +  +++++         K     +   I + +R+ +  ++   +G    +++I+E
Sbjct: 77  AGRIIRVTVQIEVTDKKLPEEMKNKNIVISDIIDSVLRSKTADELLEPEGKEKVRKEIKE 136

Query: 152 RVKLRSQGFVSSVIFRTFII 171
           R+       V +V F  FII
Sbjct: 137 RLNEIFNNKVYNVNFGEFII 156


>gi|222530128|ref|YP_002574010.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           bescii DSM 6725]
 gi|312621579|ref|YP_004023192.1| flagellar basal body-associated protein flil [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|222456975|gb|ACM61237.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           bescii DSM 6725]
 gi|312202046|gb|ADQ45373.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 156

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 42/120 (35%)

Query: 52  KYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI 111
                                  ++  K  + +LQ   TN     +  ++L++       
Sbjct: 36  SPTSSAAKTTTVEKKPEKLYTYDVNDGKALMSNLQDTQTNAGRIIRVTVQLEVTDKKLPE 95

Query: 112 PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
             K     +   I + +R+ +  ++   +G    +++I++R+       V +V F  FII
Sbjct: 96  TMKEKNIVIADIIDSVLRSKTADELLKPEGKEKVRKEIKDRLNEIFGNKVYNVNFGEFII 155


>gi|269836613|ref|YP_003318841.1| flagellar basal body-associated protein FliL [Sphaerobacter
           thermophilus DSM 20745]
 gi|269785876|gb|ACZ38019.1| flagellar basal body-associated protein FliL [Sphaerobacter
           thermophilus DSM 20745]
          Length = 183

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/184 (10%), Positives = 55/184 (29%), Gaps = 31/184 (16%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVH 70
            +G   +L + +  V   I +       ++   +  G          +     N+  ++ 
Sbjct: 7   AQGMNKRLLLVFGGVGALIVVALVGAVFVLPSLVPGG--------ISIQLGNGNTTETLS 58

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD---------------- 113
                 +      +L   + N        +L+ +I L                       
Sbjct: 59  VPPPTGVDVGVPVTLGERVVNLADPGGFRYLKTEIVLSLHVPGVVGSELSTEELEKEQAT 118

Query: 114 -----KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFR 167
                +     +   + + +   ++ ++T  +G    +E + E ++ L     ++ + F 
Sbjct: 119 LNARLEPIKPQIQDILTSVLTAKTVAEVTTPEGKEVLREQLIESLQPLLRHHQITGLYFA 178

Query: 168 TFII 171
            F+I
Sbjct: 179 QFVI 182


>gi|296133038|ref|YP_003640285.1| flagellar basal body-associated protein FliL [Thermincola sp. JR]
 gi|296031616|gb|ADG82384.1| flagellar basal body-associated protein FliL [Thermincola potens
           JR]
          Length = 165

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/176 (9%), Positives = 50/176 (28%), Gaps = 17/176 (9%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D   +     ++                   +   +++ + A        +F   +
Sbjct: 1   MAEEDLKEEQEPQGKNSS-----------AGTIKLIIAGIVIIILAAGISFAVARFAAVS 49

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKV----F 116
              +           +      F     +TN       ++++ I     +   +      
Sbjct: 50  APQHGSTYNANAKIKTDNIGTTFDAGEYLTNLAG-GSRYIKVKIVFSFANKELETEITNK 108

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           L  +   I   +R  S   +   +      + +++ +  L   G +  + F  F++
Sbjct: 109 LPAIQNTINKVLREQSADALNEPKSMDKLADRLKKSINELLVTGNIDEIYFTYFVV 164


>gi|330831587|ref|YP_004394539.1| flagellar basal body-associated protein FliL [Aeromonas veronii
           B565]
 gi|328806723|gb|AEB51922.1| Flagellar basal body-associated protein FliL [Aeromonas veronii
           B565]
          Length = 144

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 41/127 (32%), Gaps = 11/127 (8%)

Query: 55  KFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIP 112
                   ++   +                   IITN+ S  K   ++R+ + L+ ++  
Sbjct: 16  ALQQQALAEDEPPAEGAEGAAKPGFSYHALDPDIITNYLSDSKTLGYIRVTVELMAENEA 75

Query: 113 D----KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSS 163
           D    +     +   I+  I + +  Q+         +++ E  V         +  V  
Sbjct: 76  DLKLLEQHDPLIRDAIIRLIGSKNADQVKSLTNREELRKECETTVNELLVKETGKKAVRE 135

Query: 164 VIFRTFI 170
           +IF  F+
Sbjct: 136 LIFTKFL 142


>gi|117928061|ref|YP_872612.1| flagellar basal body-associated protein FliL [Acidothermus
           cellulolyticus 11B]
 gi|117648524|gb|ABK52626.1| flagellar basal body-associated protein FliL [Acidothermus
           cellulolyticus 11B]
          Length = 156

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/114 (15%), Positives = 38/114 (33%), Gaps = 6/114 (5%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET-- 119
              S     TG  +  K   + ++  +  N       +LR+ +AL       K       
Sbjct: 44  GKKSHHPAKTGAAVQEKPGPLVAVDAVTVNLA--GGHYLRIGLALQFTTKTSKTQPPDPA 101

Query: 120 -LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171
                ++ Y        +    G +  KE++ + +        +  V+F +F+I
Sbjct: 102 PATDVVIQYFTGKDPGPLQTPAGLKQAKEELTKAIAQVYPKDPILEVLFTSFVI 155


>gi|150019070|ref|YP_001311324.1| flagellar basal body-associated protein FliL [Clostridium
           beijerinckii NCIMB 8052]
 gi|149905535|gb|ABR36368.1| flagellar basal body-associated protein FliL [Clostridium
           beijerinckii NCIMB 8052]
          Length = 161

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/176 (11%), Positives = 52/176 (29%), Gaps = 30/176 (17%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           ++       G  +K  +    V   + +     GG+ + F      + +           
Sbjct: 7   NEKEKGEKSGKSNKGLMIVLFVLGLLVLGSAAFGGMYLFFKTQKTVDAQ----------- 55

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKD------IPDKVF 116
                        + + +   L     N      K + + ++AL                
Sbjct: 56  -----------EVVVENEYMDLAEFTVNLGDEGGKRFFKGELALGYDKTKAKLKEELTAN 104

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
              +  DI+ Y ++     +         K+ + + +    ++G ++ V F++ II
Sbjct: 105 QVVVRDDIIFYFKSQKADYLNNVANREAIKKQLIDSINKDLTKGKITDVRFKSMII 160


>gi|168182733|ref|ZP_02617397.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           Bf]
 gi|237796090|ref|YP_002863642.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           Ba4 str. 657]
 gi|182674183|gb|EDT86144.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           Bf]
 gi|229262941|gb|ACQ53974.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           Ba4 str. 657]
          Length = 173

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/177 (12%), Positives = 57/177 (32%), Gaps = 11/177 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS  +  ++     +  + V        I     + G ++      G            N
Sbjct: 1   MSEKNVETKGESFKKIIIIVL----VLVIVGAGAFGGYMLFAKNKKGANSTNQMPVNNTN 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDI----PDKV 115
             ++   +        +   + +SL   + N      K +++  I +  ++       + 
Sbjct: 57  VINSQQTNDGMYPQQVIVSSKTYSLDEFLVNLADEDGKRFIKAKIFIGYEEKKLNKELET 116

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               L   ++  +R+     I   +     K +I  ++  +  +G +SS+ F   I+
Sbjct: 117 KKPILRDAVIGVLRSKKAADIN-PKNIDKIKVEIINKISPMLEKGRISSIYFDDLIV 172


>gi|117620220|ref|YP_854712.1| flagellar basal body-associated protein FliL [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117561627|gb|ABK38575.1| flagellar basal body-associated protein FliL [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 144

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 38/101 (37%), Gaps = 11/101 (10%)

Query: 81  QIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETLHQDIMAYIRTVSIK 134
                  IITN+ S  K   ++R+ + L+ ++  D    +     +   I+  + + S  
Sbjct: 42  YHLLDPDIITNYLSDGKTLGYVRVTVELMAENEADLKLLEQHDPLIRDAIIRLMGSKSAD 101

Query: 135 QITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
           QI         +++ + R          +  V  +IF  F+
Sbjct: 102 QIKSLVSREDLRKECQTRANELLVKETGKKAVRELIFTKFL 142


>gi|187778760|ref|ZP_02995233.1| hypothetical protein CLOSPO_02355 [Clostridium sporogenes ATCC
           15579]
 gi|187772385|gb|EDU36187.1| hypothetical protein CLOSPO_02355 [Clostridium sporogenes ATCC
           15579]
          Length = 173

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/147 (14%), Positives = 51/147 (34%), Gaps = 8/147 (5%)

Query: 32  FCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT-GDTISLKKLQIFSLQPIIT 90
             G  GG ++            Q  + N    NS ++ +       +   + +SL   + 
Sbjct: 27  GAGAFGGYMLFAKNKKSANSTNQMPVNNTNVINSQQTNNGMYPQQVVVSSKTYSLDEFLV 86

Query: 91  NFDS-SPKDWLRLDIALICK----DIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYF 145
           N      K +++  I +  +        +     L   ++  +R+     I   +     
Sbjct: 87  NLADEDGKRFVKAKIFIGYEEKKLAKELETKKPILRDAVIGVLRSKKAADIN-PKNIDKI 145

Query: 146 KEDIEERVK-LRSQGFVSSVIFRTFII 171
           K +I  ++  +  +G ++S+ F   I+
Sbjct: 146 KVEIINKISPMLEKGRINSIYFDDLIV 172


>gi|85060030|ref|YP_455732.1| flagellar basal body-associated protein FliL [Sodalis glossinidius
           str. 'morsitans']
 gi|84780550|dbj|BAE75327.1| flagellar protein FliL [Sodalis glossinidius str. 'morsitans']
          Length = 153

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/163 (11%), Positives = 39/163 (23%), Gaps = 38/163 (23%)

Query: 21  TWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKL 80
              +V   I            L                        R+  T         
Sbjct: 16  ITPLVIVLIAASGAAGYFWWQL------------------------RAAATTSLAPPPAP 51

Query: 81  QIFSLQPIITNFDSSP---KDWLRLDIALICKDIPDKVFL----ETLHQDIMAYIRTVSI 133
               L+    N  +        L + + L   +   +         +H  ++  +     
Sbjct: 52  VFMVLETFTVNVANPDNDLDRVLYVGLTLRLPNEETRKTFNDYLPLVHSRLL--LSRQQA 109

Query: 134 KQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
            ++   QG +   + I++ +            V  V+F  FI+
Sbjct: 110 GELASPQGKQGLIDKIKQTLAEPLVAGQPPQVVDDVLFTAFIL 152


>gi|307293810|ref|ZP_07573654.1| flagellar basal body-associated protein FliL [Sphingobium
           chlorophenolicum L-1]
 gi|306879961|gb|EFN11178.1| flagellar basal body-associated protein FliL [Sphingobium
           chlorophenolicum L-1]
          Length = 216

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/112 (16%), Positives = 39/112 (34%), Gaps = 10/112 (8%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD-----IPDKVFLETLHQDI 124
                 +  +   F LQ   T+  S    + ++ IA+            K     +   +
Sbjct: 104 PVPANPAAYQATYFQLQTPFTSNMSDTDAFAQISIAISTYYDIRVVEAIKTHEMAIRSQV 163

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-----GFVSSVIFRTFII 171
           +  +    ++ ++  QG R  +  I+  +    +     G V +V F  F+I
Sbjct: 164 LMMLAEQPVESLSTPQGKRALQGRIKTIINDILKQKMGYGGVDNVYFTNFVI 215


>gi|311693110|gb|ADP95983.1| flagellar basal body-associated protein FliL [marine bacterium
           HP15]
          Length = 149

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/125 (10%), Positives = 39/125 (31%), Gaps = 12/125 (9%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD------IP 112
               +         +  +     I    P +T+  +       L  A+  +         
Sbjct: 23  AVSQEEENAEEEVAEEENSFTDYISMDPPFVTHVGTPGNKPTYLKAAVSLRANSASARPA 82

Query: 113 DKVFLETLHQDIMAYIRTVSIKQ-ITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIF 166
               +  L  +++      +    +T  +G    +E+ ++R+    +       ++ V+F
Sbjct: 83  VDAHMPRLRHELVMLFGEQTDTDRLTSMEGQEALREEAKQRINAVLEEQQTGESIAGVLF 142

Query: 167 RTFII 171
             F++
Sbjct: 143 TEFVV 147


>gi|121997407|ref|YP_001002194.1| flagellar basal body-associated protein FliL [Halorhodospira
           halophila SL1]
 gi|121588812|gb|ABM61392.1| flagellar basal body-associated protein FliL [Halorhodospira
           halophila SL1]
          Length = 159

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/165 (10%), Positives = 45/165 (27%), Gaps = 19/165 (11%)

Query: 17  KLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTIS 76
           K  +        + +    L   +   +F        Q                      
Sbjct: 3   KGLIALLGGLAVLMLATLGLVLAMATGVFTPPGMTPEQPAESQQEPGEPDLEQ------- 55

Query: 77  LKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKD----IPDKVFLETLHQDIMAYIRTV 131
                +   QP+  N D      +L  ++ +           +     +  ++M ++   
Sbjct: 56  --ARYVELEQPLTVNLDGDGPAQYLEAEVEIAAASHAVTEAIETHQAAIRDELMLFLADQ 113

Query: 132 SIKQITGAQGFRYFKEDIEERVK-LRSQGFVSS----VIFRTFII 171
           S   +  A+     +E+  ERV  + ++  V      + F   ++
Sbjct: 114 SFATLNSAEQRDDLREEALERVNTILNEHGVEEPATGLYFTRLVM 158


>gi|84502562|ref|ZP_01000698.1| hypothetical protein OB2597_21141 [Oceanicola batsensis HTCC2597]
 gi|84389374|gb|EAQ02171.1| hypothetical protein OB2597_21141 [Oceanicola batsensis HTCC2597]
          Length = 166

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/165 (12%), Positives = 48/165 (29%), Gaps = 13/165 (7%)

Query: 20  VTWFVVYTFIGIFCGWLGGIVM-----LFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDT 74
           +    V   + +  G +  +       L    G    +    +  N       S      
Sbjct: 1   MVLIAVVGLVALIGGLVAAMGFDDALALATGGGSDTHEAAPEVTKNDSVAITHSSQKSAE 60

Query: 75  ISLKKLQIFSLQPI--ITNFDSSPKDWLRLDIALICK-----DIPDKVFLETLHQDIMAY 127
             +       +  I   T        +L+L+ AL+           +  +  +      Y
Sbjct: 61  TVVVAPFKEIIVNIHATTATGRQTTRFLKLNAALVYDETLPGAAHVEERMVFVRDAFQDY 120

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFV-SSVIFRTFII 171
           +R +S + + G+ G    K ++  R +  S       ++    I+
Sbjct: 121 LRQLSERDVQGSAGITILKAELLRRARSVSDSEAPREILISDLIV 165


>gi|261884816|ref|ZP_06008855.1| flagellar basal body-associated protein FliL [Campylobacter fetus
           subsp. venerealis str. Azul-94]
          Length = 109

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 8/91 (8%), Positives = 27/91 (29%), Gaps = 5/91 (5%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-----LRLDIALICKDIPDK 114
           +    +  S             ++ +   + NF S          L L+++         
Sbjct: 9   STQQQAAPSPKQRSNDFFNVGPMYPMDQFVVNFLSESGSRFLKTTLNLELSEQTLSPEID 68

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYF 145
                +   I+  + + + + ++ ++G    
Sbjct: 69  KKEPLIRDIIIRNLSSKTYEDVSTSKGKERL 99


>gi|145301046|ref|YP_001143887.1| flagellar basal body-associated protein FliL [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142853818|gb|ABO92139.1| putative flagellar basal body-associated protein FliL [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 144

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/101 (13%), Positives = 32/101 (31%), Gaps = 11/101 (10%)

Query: 81  QIFSLQPIITNFDSSPKDWLRLDIALICKDIPD------KVFLETLHQDIMAYIRTVSIK 134
                  IITN+ S  K    + + +      +      +     +   I+  + + +  
Sbjct: 42  YHALDPDIITNYLSDGKTLGYIRVTVELMAENEGDLKLLEQHDPLIRDAIIRLMGSKTAD 101

Query: 135 QITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
           QI         +++   +V         +  V  +IF  F+
Sbjct: 102 QIKSLVNREELRKECLTQVNELLVKETGKKAVRELIFTKFL 142


>gi|300854218|ref|YP_003779202.1| flagellar biosynthesis protein FliL [Clostridium ljungdahlii DSM
           13528]
 gi|300434333|gb|ADK14100.1| flagellar biosynthesis protein FliL [Clostridium ljungdahlii DSM
           13528]
          Length = 179

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/178 (12%), Positives = 52/178 (29%), Gaps = 13/178 (7%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAG------QKEEKYQKFILN 59
                 +G+     +   ++   +     + G    +           Q+    Q     
Sbjct: 2   ENKAEKKGSSKIKIIAIGILILAVVAGGAFFGYNNFIKDKKNTAKNAVQQVNTQQVNTQQ 61

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDK 114
              +             +   Q F L  +  N        +L++ + L   D        
Sbjct: 62  VVNNGQTAGTVANSLDQVVSSQTFQLDEVTVNLADEGGNRYLKVAVYLGFNDKKLTAELT 121

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
                +   ++  +RT     I  A+     K +I +++  +  +G +++V F   II
Sbjct: 122 AKKPIVTDAVIEILRTKKAADI-SAKNMNNIKLEIIQKINPMLEKGQLNNVYFTDIII 178


>gi|26991048|ref|NP_746473.1| flagellar basal body-associated protein FliL [Pseudomonas putida
           KT2440]
 gi|148546746|ref|YP_001266848.1| flagellar basal body-associated protein FliL [Pseudomonas putida
           F1]
 gi|24986080|gb|AAN69937.1|AE016632_8 flagellar protein FliL [Pseudomonas putida KT2440]
 gi|148510804|gb|ABQ77664.1| flagellar basal body-associated protein FliL [Pseudomonas putida
           F1]
 gi|313497805|gb|ADR59171.1| FliL [Pseudomonas putida BIRD-1]
          Length = 165

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/182 (9%), Positives = 53/182 (29%), Gaps = 29/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +         + KL +   V               +M                  +
Sbjct: 1   MAKSEAVKDPATKGKLKLILLAVVGLLLAIGLSVGATWFIM------------------H 42

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKV 115
             + +  +  T   +    +        + NF+ + +  +++L I L  ++       KV
Sbjct: 43  KSEPAPAAEATASNVKPGAIYEALTPAFVVNFNQNGRQRYMQLSITLQARNQADLDALKV 102

Query: 116 FLETLHQDIMAYIRTVSIKQI-TGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTF 169
            +  +  +++          + +   G    ++     V+        +  +  ++F  F
Sbjct: 103 HMPVIRNNLVMMFSGQGFDTLASSPVGQEMLRQKATAVVQEVAQKEVGKPVIDQLLFTNF 162

Query: 170 II 171
           ++
Sbjct: 163 VL 164


>gi|116329293|ref|YP_799013.1| endoflagellar basal body-associated protein [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116330100|ref|YP_799818.1| endoflagellar basal body-associated protein [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
 gi|116122037|gb|ABJ80080.1| Endoflagellar basal body-associated protein [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116123789|gb|ABJ75060.1| Endoflagellar basal body-associated protein [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
          Length = 174

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/106 (11%), Positives = 33/106 (31%), Gaps = 8/106 (7%)

Query: 74  TISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL------ICKDIPDKVFLETLHQDIMA 126
                       +    N     +  ++++ +A                    +   I  
Sbjct: 68  KPPPPLANYNFTEEFRINTSDKGEAHFVKMKLAFGIAKEDQTLSAELAERNAQMRDLINL 127

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            +   S  ++   +     +E+I+ +V  + ++G +  V F  FI+
Sbjct: 128 IVGRKSKDELINIEDQLDLREEIKAQVNHILTEGKIQEVYFTEFIV 173


>gi|167034916|ref|YP_001670147.1| flagellar basal body-associated protein FliL [Pseudomonas putida
           GB-1]
 gi|166861404|gb|ABY99811.1| flagellar basal body-associated protein FliL [Pseudomonas putida
           GB-1]
          Length = 165

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/182 (8%), Positives = 52/182 (28%), Gaps = 29/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +         + KL +   V               +M                  +
Sbjct: 1   MAKSEAVKDPATKGKLKLILLAVVGLLLAIGLSVGATWFIM------------------H 42

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKV 115
             + +  +      +    +        + NF+ + +  +++L I +  ++       KV
Sbjct: 43  KSEPAPAADAAASNVKPAAIYEALTPAFVVNFNQNGRQRYMQLSITMQARNQADLDALKV 102

Query: 116 FLETLHQDIMAYIRTVSIKQI-TGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTF 169
            +  +  +++          + +   G    ++     V+        +  +  ++F  F
Sbjct: 103 HMPVIRNNLVMMFSGQGFDTLASSPVGQEMLRQKATAVVQEVAQKEVGKPVIDQLLFTNF 162

Query: 170 II 171
           ++
Sbjct: 163 VL 164


>gi|197104383|ref|YP_002129760.1| flagellar basal body-associated protein FliL [Phenylobacterium
           zucineum HLK1]
 gi|196477803|gb|ACG77331.1| flagellar basal body-associated protein FliL [Phenylobacterium
           zucineum HLK1]
          Length = 201

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/99 (16%), Positives = 42/99 (42%), Gaps = 7/99 (7%)

Query: 80  LQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSI 133
           +  +++  ++ N  ++     +L+L + L   D          +  L     +++R +  
Sbjct: 102 VVFYTMPDVVVNMQTADGRPTFLKLKLTLELPDHEAVETLDPNMPRLQDMFQSFLRELRP 161

Query: 134 KQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           + + G+QG    + +I  RV L  +    ++V+    +I
Sbjct: 162 EDLAGSQGSYQLRMEILRRVNLVIAPSKANAVLIEEMLI 200


>gi|126653738|ref|ZP_01725656.1| flagellar basal body-associated protein FliL [Bacillus sp. B14905]
 gi|126589702|gb|EAZ83838.1| flagellar basal body-associated protein FliL [Bacillus sp. B14905]
          Length = 142

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 49/161 (30%), Gaps = 25/161 (15%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
            N   L +   ++   I I       +       G  E    + +               
Sbjct: 2   KNNKMLTMIIILLVAVILIGVILFVLLTQFNKPTGAIEPTIDEIVEAT------------ 49

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK--VFLETLHQDIMAYIRT 130
                       +  I TN        L L +    KD   +    +  +    +  +  
Sbjct: 50  ----------VEIPEITTNLADKRVVRLSLKVQTTSKDAAAELTKRVFQVQNIAIQELSE 99

Query: 131 VSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
           +  K + G QG + F++ ++ RV  L  +G V  V F +FI
Sbjct: 100 MEQKDLEGKQGKQIFQKSLKTRVNELMQEGEVQEVYFTSFI 140


>gi|109899346|ref|YP_662601.1| flagellar basal body-associated protein FliL [Pseudoalteromonas
           atlantica T6c]
 gi|109701627|gb|ABG41547.1| flagellar basal body-associated protein FliL [Pseudoalteromonas
           atlantica T6c]
          Length = 175

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/181 (8%), Positives = 55/181 (30%), Gaps = 17/181 (9%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   +   G +    +   ++   + +  G     ++       ++E         
Sbjct: 1   MAEEELQMEE--GGKKSKLMMIIIIVIVLLLGGGGAAYFLLGG-----EDEVATMEGEEQ 53

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKD----IPDKV 115
                     +    +   L +    PI  N    +    + + + L+ +        K+
Sbjct: 54  AQMEGDGGETSEAVKTGTALYVAIPNPITFNVPGANRDRLVEIKVQLMVRGSSAEEQVKM 113

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            + ++   +       +   +    G    +++  + V+   +       V  V+F  F+
Sbjct: 114 HIPSIQGALNRAFSQANADDLITEAGKAAIRDNALKEVQKTLKDVSGNELVEQVLFTGFV 173

Query: 171 I 171
           +
Sbjct: 174 M 174


>gi|124265764|ref|YP_001019768.1| flagellar basal body-associated protein [Methylibium petroleiphilum
           PM1]
 gi|124258539|gb|ABM93533.1| flagellar basal body-associated protein [Methylibium petroleiphilum
           PM1]
          Length = 210

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 11/139 (7%), Positives = 37/139 (26%), Gaps = 12/139 (8%)

Query: 19  FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLK 78
            +   +V   +    G    ++           +         +D   +           
Sbjct: 24  VMILAIVALLVAAGGGAAVYLLKKKAAEAAAAAEEGDDAEEVAHDAGKKDHKAPP----- 78

Query: 79  KLQIFSLQPIITNFDSSP-KDWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSI 133
                 L+P + N      + + ++ + L   D       K+++  +   ++  +   + 
Sbjct: 79  --NFLPLEPFVVNLADRDQERFAQIGVTLQVDDPKVAEELKLYMPAIRNGVLMILSHKTS 136

Query: 134 KQITGAQGFRYFKEDIEER 152
            ++    G      +I   
Sbjct: 137 GELLERAGKEKLAAEIMRE 155


>gi|312135843|ref|YP_004003181.1| flagellar basal body-associated protein flil [Caldicellulosiruptor
           owensensis OL]
 gi|311775894|gb|ADQ05381.1| flagellar basal body-associated protein FliL [Caldicellulosiruptor
           owensensis OL]
          Length = 156

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 42/108 (38%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQD 123
                      +S  K  + +LQ   TN     +  ++L++         K     +   
Sbjct: 48  EKKPEKLYTYDVSDGKGLMSNLQDTQTNAGRIIRVTVQLEVTDKKLSETLKEKNIVIADI 107

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           I + +R+ +  ++   +G    +++I++R+       V +V F  FII
Sbjct: 108 IDSVLRSKTADELLKPEGKEKVRKEIKDRLNEIFDNKVYNVNFGEFII 155


>gi|289523561|ref|ZP_06440415.1| flagellar basal body-associated protein FliL [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503253|gb|EFD24417.1| flagellar basal body-associated protein FliL [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 151

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/113 (15%), Positives = 37/113 (32%), Gaps = 11/113 (9%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP------DKVFLETLHQD 123
                   K   +  L     N        +R ++ L   D        ++ ++  +  +
Sbjct: 38  DGSYKEIAKPGAMLPLGDFTVNLADKDPHIVRFNLVLELSDPTFLTTISEQGWISRIKNE 97

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
           I+   +      +  A G     +DI +R+            V +V+F+ FII
Sbjct: 98  IILTCKNRYYDDLRTADGVLALAQDISKRLNTILPPVKDKLPVRNVLFQEFII 150


>gi|126666625|ref|ZP_01737603.1| hypothetical protein MELB17_20986 [Marinobacter sp. ELB17]
 gi|126629013|gb|EAZ99632.1| hypothetical protein MELB17_20986 [Marinobacter sp. ELB17]
          Length = 147

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 13/137 (9%), Positives = 33/137 (24%), Gaps = 12/137 (8%)

Query: 47  GQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIAL 106
            +         L                       I      +T+          L  ++
Sbjct: 9   PKIFIALFLLALAILAYGEEPDEPAEPAKPTITDYISLEPAFVTHIGPPGGKLSYLKASV 68

Query: 107 ICKD------IPDKVFLETLHQDIMAYIRTVS-IKQITGAQGFRYFKEDIEERVKLRSQG 159
             +          +  +  +  +++      S +  +T     +    +   RV    + 
Sbjct: 69  SLRADASTTRPAVEAHMPRIRHELVLLFGEQSDVDALTRPDTQQTLATEATARVNQVLEN 128

Query: 160 F-----VSSVIFRTFII 171
                 VS V+F  F++
Sbjct: 129 QHTGEVVSGVLFTEFVV 145


>gi|52080233|ref|YP_079024.1| flagellar basal body-associated protein FliL [Bacillus
           licheniformis ATCC 14580]
 gi|52785610|ref|YP_091439.1| flagellar basal body-associated protein FliL [Bacillus
           licheniformis ATCC 14580]
 gi|319645988|ref|ZP_08000218.1| FliL protein [Bacillus sp. BT1B_CT2]
 gi|52003444|gb|AAU23386.1| flagellar protein [Bacillus licheniformis ATCC 14580]
 gi|52348112|gb|AAU40746.1| FliL [Bacillus licheniformis ATCC 14580]
 gi|317391738|gb|EFV72535.1| FliL protein [Bacillus sp. BT1B_CT2]
          Length = 143

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/158 (13%), Positives = 49/158 (31%), Gaps = 23/158 (14%)

Query: 16  HKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTI 75
           +K  +   +         G     V+                       S +  +   +I
Sbjct: 2   NKKLLGIMMTIILAIAVLGTAAFFVIKGS-------------------ASEKDQNAEPSI 42

Query: 76  SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLETLHQDIMAYIRTVSI 133
                    +  I TN  S     L + +    K+     +     +   +++ +   + 
Sbjct: 43  DEVVESSVEVAEITTNLKSDNVVRLSIKLETDSKEAKEELEKRDFQIKDSVISLLANTNA 102

Query: 134 KQITGAQGFRYFKEDIEERVKL--RSQGFVSSVIFRTF 169
            ++ G +G   FKE ++E++      +G V +V   +F
Sbjct: 103 DELEGQKGKEKFKEQLKEKLNTNYMKEGKVKTVYITSF 140


>gi|221069292|ref|ZP_03545397.1| flagellar basal body-associated protein FliL [Comamonas
           testosteroni KF-1]
 gi|220714315|gb|EED69683.1| flagellar basal body-associated protein FliL [Comamonas
           testosteroni KF-1]
          Length = 184

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/138 (15%), Positives = 40/138 (28%), Gaps = 30/138 (21%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIP----DKVFLE 118
           +S        +          L  ++ N        +++L I L   D       K +L 
Sbjct: 46  HSSADGEEEVSAKATVPTFLPLDNMVANLADPGGDRFVQLGITLELSDEKTASTVKQYLP 105

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS--------------------- 157
           ++   I+  +   +  ++   +G      DI   V                         
Sbjct: 106 SIRNGILMLVSQRTADELLAREGKEKLAADILTEVSAPLGFGPSAKKRSRDDEDADEDSP 165

Query: 158 ----QGFVSSVIFRTFII 171
               +G V  V+F +FII
Sbjct: 166 RANRKGPVRRVLFSSFII 183


>gi|119899012|ref|YP_934225.1| putative flagellar basal body-associated protein FliL [Azoarcus sp.
           BH72]
 gi|119671425|emb|CAL95338.1| putative flagellar basal body-associated protein FliL [Azoarcus sp.
           BH72]
          Length = 193

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 37/116 (31%), Gaps = 19/116 (16%)

Query: 75  ISLKKLQIFSLQPIITNF-DSSPKDWLR----LDIALICKDIPDKVFLETLHQDIMAYIR 129
              K     +L+P   N        +L+    L +A        K F+  +   I   + 
Sbjct: 77  DLSKPPSFVTLEPFTVNLQRDEGDHYLQAVVVLRVADAKTAESLKGFMPEIRHRINLLLS 136

Query: 130 TVSIKQITGAQGFRYFKEDIEERVK--------------LRSQGFVSSVIFRTFII 171
           +    Q++   G      +I ++                    G + +V+F +FII
Sbjct: 137 SKLPSQLSTIDGRETLAIEIVDQSNDALGFPPPREANRRAPPTGPIQAVLFNSFII 192


>gi|86157792|ref|YP_464577.1| flagellar basal body-associated protein FliL [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85774303|gb|ABC81140.1| flagellar basal body-associated protein FliL [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 167

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 13/110 (11%), Positives = 35/110 (31%), Gaps = 6/110 (5%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIPDKVF----LETLHQ 122
             H              L   I +   +    + R+   +      D+      +  +  
Sbjct: 57  DPHGKAGAGAPPGPTIKLADFIVHLRDTDADRYARVTFDVEVATEDDRTRLAPLVPRVRD 116

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-FVSSVIFRTFII 171
             +AY+   +++++ G       K  + ER+   + G  + ++     +I
Sbjct: 117 AFIAYLSDRTVEELRGGDAIARTKAALSERLGALAAGVEIRALYITDLVI 166


>gi|207739720|ref|YP_002258113.1| flagellar rotation flil (partial sequence) protein [Ralstonia
           solanacearum IPO1609]
 gi|206593102|emb|CAQ60008.1| putative flagellar rotation flil (partial sequence) protein
           [Ralstonia solanacearum IPO1609]
          Length = 115

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/102 (11%), Positives = 37/102 (36%), Gaps = 11/102 (10%)

Query: 81  QIFSLQPIITNFD--SSPKDWLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSIK 134
               ++ +  N         +L++ I     D       K +   L   ++  + + +  
Sbjct: 13  YFVPMETLTVNLQPEEGNDRYLQIAITFKSYDKHAEEAIKAYTPELRSRVLMLLSSKAPA 72

Query: 135 QITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
           ++   +G     +++ E+ +        +  ++ V+F  F+I
Sbjct: 73  ELYSNEGKAKLAKEVVEQCEQAYKAVGKESPIADVLFTNFVI 114


>gi|299534776|ref|ZP_07048106.1| flagellar fliL protein [Lysinibacillus fusiformis ZC1]
 gi|298729864|gb|EFI70409.1| flagellar fliL protein [Lysinibacillus fusiformis ZC1]
          Length = 142

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 49/161 (30%), Gaps = 25/161 (15%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
            N   L +   ++   I I       +       G  E    + +               
Sbjct: 2   KNNKMLTMIIILLVAVILIGVILFVLLTQFNKPTGAVEPSIDEIVEAT------------ 49

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK--VFLETLHQDIMAYIRT 130
                       +  I TN        L L I    KD   +    +  +    +  +  
Sbjct: 50  ----------VEIPEITTNLADKRVVRLSLKIQTTSKDAAAELTKRVFQVQNIAIQELSE 99

Query: 131 VSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
           +  K + G QG + F++ ++ R+  L  +G V  V F +FI
Sbjct: 100 MEQKDLEGKQGKQIFQKSLKTRLNELMQEGEVQEVYFTSFI 140


>gi|254491872|ref|ZP_05105051.1| flagellar basal body-associated protein FliL [Methylophaga
           thiooxidans DMS010]
 gi|224463350|gb|EEF79620.1| flagellar basal body-associated protein FliL [Methylophaga
           thiooxydans DMS010]
          Length = 136

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 11/120 (9%), Positives = 37/120 (30%), Gaps = 12/120 (10%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK---DWLRLDIALICKDIPD----KVF 116
            +   +          +     +P   NF +  +    +L++ +AL+  +       +  
Sbjct: 16  GASPLMAAESAAETSSIYYSIEEPFTINFLNQSQEKARYLQIKVALMSHEPTVLDSAQHN 75

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
           L  +   +           ++   G    ++    +++           +  + F +FI+
Sbjct: 76  LPMIQDALRTLFTEQGYDTVSTVAGREQLQQQALTKIRTLLQQETGSDGLEQIYFTSFIL 135


>gi|254784511|ref|YP_003071939.1| flagellar basal body-associated protein FliL [Teredinibacter
           turnerae T7901]
 gi|237683913|gb|ACR11177.1| flagellar basal body-associated protein FliL [Teredinibacter
           turnerae T7901]
          Length = 139

 Score = 59.0 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/130 (10%), Positives = 39/130 (30%), Gaps = 11/130 (8%)

Query: 53  YQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDI 111
            Q        + +          S   + +      + NF    K  +++ ++++     
Sbjct: 8   AQDDGEEAAEEPAAAEEGEEGVPSSSAIYLPIKPAFVVNFGGPGKLRYIKAEVSVRVDSS 67

Query: 112 P----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR------SQGFV 161
                 +  L  +  +++    + +   +    G    ++D    V+         +  V
Sbjct: 68  DAANSVRHHLPYIRNNLVMLFASQTEDTVDSQAGKEALRQDALAEVRKILFEEDGLETGV 127

Query: 162 SSVIFRTFII 171
             + F T I+
Sbjct: 128 VDIFFNTLIV 137


>gi|5921669|gb|AAD56293.1| FliL [Pseudomonas putida]
          Length = 165

 Score = 59.0 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/182 (8%), Positives = 52/182 (28%), Gaps = 29/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +         + KL +   V               +M                  +
Sbjct: 1   MAKSEAVKDPATKGKLKLILLAVVGLLLAIGLSVGATWFIM------------------H 42

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKV 115
             + +  +      +    +        + NF+ + +  +++L I L  ++       KV
Sbjct: 43  KSEPAPAAEAAASNVKPAAIYEALTPAFVVNFNQNGRQRYMQLSITLQARNQADLDALKV 102

Query: 116 FLETLHQDIMAYIRTVSIKQI-TGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTF 169
            +  +  +++          + +   G    ++     V+        +  +  ++F  F
Sbjct: 103 HMPVIRNNLVMMFSGQGFDTLASSPVGQEMLRQKATAVVQEVAQKEVGKPVIDQLLFTNF 162

Query: 170 II 171
           ++
Sbjct: 163 VL 164


>gi|309388830|gb|ADO76710.1| flagellar basal body-associated protein FliL [Halanaerobium
           praevalens DSM 2228]
          Length = 150

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/165 (9%), Positives = 53/165 (32%), Gaps = 18/165 (10%)

Query: 8   SQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVR 67
           ++  + N   L +   +V    G+          +     +++E      +   Y+    
Sbjct: 2   AEEGKMNYKMLALIVVLVIIITGVASFTFFTYFSVSNDEKEEKEVQSIEDIRPTYEAGSY 61

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAY 127
           +V+  +                 N  +  +  +  ++               +   +++ 
Sbjct: 62  TVNISNN----------------NRINFIRATIVFELEKSDLAKELDKRTSQIRDRVIST 105

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
           +R+ + + +    G    K  ++E++      G +++V F   ++
Sbjct: 106 LRSQNQEILEEP-GSNTIKRIVKEKINELLISGEITNVWFTELVV 149


>gi|222112244|ref|YP_002554508.1| flagellar basal body-associated protein flil [Acidovorax ebreus
           TPSY]
 gi|221731688|gb|ACM34508.1| flagellar basal body-associated protein FliL [Acidovorax ebreus
           TPSY]
          Length = 190

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 10/100 (10%), Positives = 27/100 (27%), Gaps = 5/100 (5%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKD----IPD 113
               +                     +  ++ N        + ++ I L   D       
Sbjct: 41  AAEDEEGGGRAVAQAGTPKTPPTFLPMDNMVVNLADPGGDRFAQVGITLELADGKTADQV 100

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV 153
           K ++ T+   ++  +   +  ++   +G      DI   V
Sbjct: 101 KAYMPTIRSGVLLLLSQRTTDELLTREGKEKLAVDIRREV 140


>gi|192360424|ref|YP_001980688.1| Flagellar basal body-associated protein FliL [Cellvibrio japonicus
           Ueda107]
 gi|190686589|gb|ACE84267.1| Flagellar basal body-associated protein FliL [Cellvibrio japonicus
           Ueda107]
          Length = 155

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/130 (10%), Positives = 42/130 (32%), Gaps = 23/130 (17%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSP--KDWLRLDIALICKDIPDKV----FLE 118
            V +   GD I      I     +I N+        ++++++++  ++  D       L 
Sbjct: 24  PVWAAGGGDKIPEGINYIPVAPALIVNYGGPDSKTRYIKVELSIRAENAADTKTLMHHLP 83

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----------------SQGFV 161
            +   +++     + + +   +G    + +    +                    +    
Sbjct: 84  LIRDRLISIFSAQTEEALGSVEGKEKLRLEALAEINRVVHEIEYGADAATQHSIPANKPA 143

Query: 162 SSVIFRTFII 171
           S ++F  F++
Sbjct: 144 SDLLFNNFVV 153


>gi|83944185|ref|ZP_00956641.1| Flagellar basal body-associated protein FliL [Sulfitobacter sp.
           EE-36]
 gi|83845052|gb|EAP82933.1| Flagellar basal body-associated protein FliL [Sulfitobacter sp.
           EE-36]
          Length = 212

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/188 (10%), Positives = 56/188 (29%), Gaps = 27/188 (14%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKE---------------EKYQK 55
            RG++  L     +    +G          +    A + E                  + 
Sbjct: 24  PRGSRKMLIAAALMCVVSLGGGFFLARAAYVKDAEAFEPEYKSEEADQTDTKDDHADTED 83

Query: 56  FILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD------WLRLDIALICK 109
              ++   +   +    D        +  L  ++TN     ++      +L++++ +  +
Sbjct: 84  HGKDDHAKDEGDAEDHADNTKAASTGLIDLGEMLTNIQGFDQNGTPTSAFLKVNLMVAYR 143

Query: 110 DIPD-----KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSS 163
              D           +      Y+R ++   + G  G  Y K ++ +R +          
Sbjct: 144 PDEDADKLMVERQPFMRDLFNGYLRGLTENDVRGMAGILYIKAELLKRARAAVGSDLPQE 203

Query: 164 VIFRTFII 171
           ++ +  I+
Sbjct: 204 ILIKDLIV 211


>gi|264676600|ref|YP_003276506.1| flagellar basal body-associated protein FliL [Comamonas
           testosteroni CNB-2]
 gi|299531255|ref|ZP_07044665.1| flagellar basal body-associated protein FliL [Comamonas
           testosteroni S44]
 gi|262207112|gb|ACY31210.1| flagellar basal body-associated protein FliL [Comamonas
           testosteroni CNB-2]
 gi|298720662|gb|EFI61609.1| flagellar basal body-associated protein FliL [Comamonas
           testosteroni S44]
          Length = 184

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/138 (15%), Positives = 40/138 (28%), Gaps = 30/138 (21%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIP----DKVFLE 118
           +S        +          L  ++ N        +++L I L   D       K +L 
Sbjct: 46  HSSADGEEEVSAKATVPTFLPLDNMVANLADPGGDRFVQLGITLELADEKTASTVKQYLP 105

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS--------------------- 157
           ++   I+  +   +  ++   +G      DI   V                         
Sbjct: 106 SIRNGILMLVSQRTADELLAREGKEKLAADILTEVSAPLGFGPSAKKRSRDDEDADEDSP 165

Query: 158 ----QGFVSSVIFRTFII 171
               +G V  V+F +FII
Sbjct: 166 RANRKGPVRRVLFSSFII 183


>gi|158320525|ref|YP_001513032.1| flagellar basal body-associated protein FliL [Alkaliphilus
           oremlandii OhILAs]
 gi|158140724|gb|ABW19036.1| flagellar basal body-associated protein FliL [Alkaliphilus
           oremlandii OhILAs]
          Length = 141

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/159 (10%), Positives = 52/159 (32%), Gaps = 25/159 (15%)

Query: 17  KLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTIS 76
           K  +  +V+   +     +           G++ ++                        
Sbjct: 3   KKKIGIYVLIGIVTSAVVFGAMYYFTQNKNGEQSKEIA---------------------I 41

Query: 77  LKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKVFLETLHQDIMAYIRTVSI 133
             +   + L    TN  S+   +   + +++               +   +++ +   + 
Sbjct: 42  KYQTYEYDLGEFSTNLGSTRSFFKGHIVIEVLDETLLEKLPQKNAAIRDGVISILIGRTS 101

Query: 134 KQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
            ++   +G    K++I E + K+  +  V++V F+ +I+
Sbjct: 102 DKLLSPEGQSELKKEIIEMLSKIAGENRVTNVYFKEYIV 140


>gi|183219623|ref|YP_001837619.1| flagellar FliL protein [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189909762|ref|YP_001961317.1| endoflagellar basal body-associated protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167774438|gb|ABZ92739.1| Endoflagellar basal body-associated protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167778045|gb|ABZ96343.1| Flagellar FliL protein [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 175

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 11/106 (10%), Positives = 32/106 (30%), Gaps = 8/106 (7%)

Query: 74  TISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD------IPDKVFLETLHQDIMA 126
                       +    N     +  +++L ++L  +             +  +   I  
Sbjct: 69  KAPPPLEVYTFQEEFRVNTSDVGESHFVKLKMSLGFESGQPALSAELAARVAQMQNIINL 128

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            I   +   +         +E+I+  +  + + G +  V F  F++
Sbjct: 129 VIARKTKDDLKSITNQLDLREEIKAHLNHILTNGKIKEVYFTEFLV 174


>gi|219670153|ref|YP_002460588.1| flagellar basal body-associated protein FliL [Desulfitobacterium
           hafniense DCB-2]
 gi|219540413|gb|ACL22152.1| flagellar basal body-associated protein FliL [Desulfitobacterium
           hafniense DCB-2]
          Length = 142

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/159 (11%), Positives = 42/159 (26%), Gaps = 25/159 (15%)

Query: 16  HKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTI 75
            KL +  F+                    F+       Q  I                  
Sbjct: 3   RKLIIAIFLAGFLGSTIGVVGTLGAQKLFFSDSPSPTGQAVIKKEEGP------------ 50

Query: 76  SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKV----FLETLHQDIMAYIRTV 131
                 + S+     N       +L+  IAL   +   +         +   I   + + 
Sbjct: 51  ------VISVGEFTVNL--QGGAFLKTSIALEGMNEKSEAVLTAKDAFIKDRINTVLSSK 102

Query: 132 SIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFI 170
           ++K +   +     K ++  ++   +   V  + F +F+
Sbjct: 103 TLKDMQ-PEVREDLKNELISQLNEVTGNQVQGIFFLSFV 140


>gi|330447924|ref|ZP_08311572.1| flagellar basal body-associated FliL family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328492115|dbj|GAA06069.1| flagellar basal body-associated FliL family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 161

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 7/111 (6%), Positives = 38/111 (34%), Gaps = 10/111 (9%)

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLETLHQDIM 125
             +  +  +     L  ++ +     +  ++ L++A+             ++  +   ++
Sbjct: 50  QSEPEATAQPVFHPLDKVVVSVKGERQTHFVMLELAVQTHYPERIKQIDSYMPLVRNALL 109

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFII 171
                   +++   Q     ++++++ +            +  V+F  ++I
Sbjct: 110 KMFSKKRYEELQNQQTIEQLQQEVKQTLTDAFANTTIARDIDDVLFTKYVI 160


>gi|90577363|ref|ZP_01233174.1| LafF [Vibrio angustum S14]
 gi|90440449|gb|EAS65629.1| LafF [Vibrio angustum S14]
          Length = 161

 Score = 58.3 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 6/111 (5%), Positives = 38/111 (34%), Gaps = 10/111 (9%)

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLETLHQDIM 125
             +  +  +     L  ++ +     +  ++ +++A+             ++  +   ++
Sbjct: 50  KSEPEATAQPAFHPLDKVVVSVKGERQTHYVMIELAVQTHYPERIKQIDSYMPLVRNALL 109

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFII 171
                   +++   Q     ++++++ +            +  V+F  ++I
Sbjct: 110 KMFSKKKYEELQNQQSIDQLQQEVKQTLTAAFANTTIARDIDDVLFTKYVI 160


>gi|226950063|ref|YP_002805154.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           A2 str. Kyoto]
 gi|226844467|gb|ACO87133.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           A2 str. Kyoto]
          Length = 173

 Score = 58.3 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/177 (12%), Positives = 56/177 (31%), Gaps = 11/177 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS  +  ++     +  + V        I     + G ++                   N
Sbjct: 1   MSEKNVETKGESFKKIIIIVL----VLVIVGAGAFGGYMLFAKNKKNANSANQMPVNNTN 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDIPDKVFL-- 117
             ++   +        +   + +SL   + N      K +++  I +  ++      L  
Sbjct: 57  VINSQQTNDGMYPQQVVVSSKTYSLDEFLVNLADEDGKRFVKAKIFIGYEEKKLAKELEK 116

Query: 118 --ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               L   ++  +R+     I   +     K +I  ++  +  +G +SS+ F   I+
Sbjct: 117 KKPILRDAVIGVLRSKKAADIN-PKNIDKIKVEIINKISPMLEKGRISSIYFDDLIV 172


>gi|89093824|ref|ZP_01166770.1| hypothetical protein MED92_04979 [Oceanospirillum sp. MED92]
 gi|89081954|gb|EAR61180.1| hypothetical protein MED92_04979 [Oceanospirillum sp. MED92]
          Length = 134

 Score = 58.3 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/114 (14%), Positives = 42/114 (36%), Gaps = 10/114 (8%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLETLHQ 122
           +    +  +   +    L+P +TNF    K  +L+ +I +              +  L  
Sbjct: 20  AEGEENAAADDYVNYIELKPFVTNFGGVGKTRFLKCEITIQVSSEAAHHAVNQHMPHLRN 79

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
           DI+  +   +   +   +  +   +   ++V+        +  VS + F +F++
Sbjct: 80  DIVFLLSAQTDDTVGTVEMQQALAKKALKKVQNILVEEQGEAMVSDLFFTSFVV 133


>gi|295097220|emb|CBK86310.1| Flagellar basal body-associated protein [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 147

 Score = 58.3 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/160 (10%), Positives = 45/160 (28%), Gaps = 25/160 (15%)

Query: 23  FVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQI 82
             +               M                 +   DN+ RS H    +   +   
Sbjct: 1   MFLIALAACGFSGYLFWSM--------------KYAHVQTDNNSRSEHEAPAVQQVEPLY 46

Query: 83  FSLQPIITNF---DSSPKDWLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSIKQ 135
            S+     +           L + +++   D       + FL      +   +   + + 
Sbjct: 47  VSMNTFTVSLTPTQHESDRVLYIGLSVRLGDTSSVQVLEKFLPEYRSRLFMLLSQQTYET 106

Query: 136 ITGAQGFRYFK----EDIEERVKLRSQGFVSSVIFRTFII 171
           ++  +G R        ++++ +    +  V+ V+   FI+
Sbjct: 107 LSTDEGKRQLISNINNELKKPLAFNKKINVTDVLINEFIL 146


>gi|153931184|ref|YP_001384895.1| chemotaxis motB protein [Clostridium botulinum A str. ATCC 19397]
 gi|152927228|gb|ABS32728.1| chemotaxis protein MotB [Clostridium botulinum A str. ATCC 19397]
          Length = 420

 Score = 58.3 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 57/177 (32%), Gaps = 11/177 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS  +  +   +G   K  +   +V   +G    + G ++                   N
Sbjct: 248 MSEKNVET---KGGSLKKIIIIVLVLVIVG-AGAFGGYMLFAKNKKNANSANQMPVNNTN 303

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALIC----KDIPDKV 115
             ++   +        +   + +SL   + N      K +++  I +           + 
Sbjct: 304 VINSQQTNDGMYPQQVVVSSKTYSLDEFLVNLADEDGKRFVKAKIFIGYEEKKLAKELEK 363

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               L   ++  +R+     I   +     K +I  ++  +  +G +SS+ F   I+
Sbjct: 364 KKPILRDAVIGVLRSKKAADIN-PKNIDKIKVEIINKISPMLEKGRISSIYFDDLIV 419


>gi|229544403|ref|ZP_04433461.1| flagellar basal body-associated protein FliL [Bacillus coagulans
           36D1]
 gi|229324888|gb|EEN90565.1| flagellar basal body-associated protein FliL [Bacillus coagulans
           36D1]
          Length = 140

 Score = 58.3 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/112 (16%), Positives = 44/112 (39%), Gaps = 3/112 (2%)

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK--VFLETL 120
            ++  +   G  I         +  + TN   +    + + I    K   D+       +
Sbjct: 28  KSNEATKAKGPNIDEVVDSSVDIDTMTTNLKDNHIVQIAIKIEGNNKKAKDELTKRDFQI 87

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              ++  +  ++++ +   +G + FK DI+ R+  +   G V +V   +F+I
Sbjct: 88  KDIMIDELSNMNMQDLQAEKGKQKFKTDIKNRLNKMMQDGEVVNVYITSFVI 139


>gi|262404840|ref|ZP_06081394.1| flagellar biosynthesis protein FliL [Vibrio sp. RC586]
 gi|262348924|gb|EEY98063.1| flagellar biosynthesis protein FliL [Vibrio sp. RC586]
          Length = 136

 Score = 58.3 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 10/115 (8%), Positives = 37/115 (32%), Gaps = 11/115 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLETL 120
            S       + +         + TNF +      ++++ I ++  +       +     +
Sbjct: 20  ASHAEDPPAAPQLAYFTLEPDLTTNFFTKGNKLGYIQVRIDIMVANAADLPVVEQHQPLI 79

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
              ++  +   +   I    G    ++ +  R+         +  ++ ++F  +I
Sbjct: 80  RDAVVELLGKQTEDTIKSLAGREDLRKSLVNRLNNILLPEVGRTVIADLLFTKYI 134


>gi|148380608|ref|YP_001255149.1| flagellar basal body-associated protein [Clostridium botulinum A
           str. ATCC 3502]
 gi|170754868|ref|YP_001782267.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           B1 str. Okra]
 gi|148290092|emb|CAL84211.1| putative flagellar basal body-associated protein [Clostridium
           botulinum A str. ATCC 3502]
 gi|169120080|gb|ACA43916.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           B1 str. Okra]
          Length = 173

 Score = 58.3 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 57/177 (32%), Gaps = 11/177 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS  +  +   +G   K  +   +V   +G    + G ++                   N
Sbjct: 1   MSEKNVET---KGGSLKKIIIIVLVLVIVG-AGAFGGYMLFAKNKKNANSANQMPVNNTN 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALIC----KDIPDKV 115
             ++   +        +   + +SL   + N      K +++  I +           + 
Sbjct: 57  VINSQQTNDGMYPQQVVVSSKTYSLDEFLVNLADEDGKRFVKAKIFIGYEEKKLAKELEK 116

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               L   ++  +R+     I   +     K +I  ++  +  +G +SS+ F   I+
Sbjct: 117 KKPILRDAVIGVLRSKKAADIN-PKNIDKIKVEIINKISPMLEKGRISSIYFDDLIV 172


>gi|220917686|ref|YP_002492990.1| flagellar basal body-associated protein FliL [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219955540|gb|ACL65924.1| flagellar basal body-associated protein FliL [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 167

 Score = 58.3 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 12/100 (12%), Positives = 35/100 (35%), Gaps = 6/100 (6%)

Query: 78  KKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIPDKVF----LETLHQDIMAYIRTVS 132
                  L   I +   +    + R+   +      D+      +  +    +AY+   +
Sbjct: 67  PPGPTIKLADFIVHLRDTDADRYARVTFDVEVATEEDRTRLTPLVPRVRDAFIAYLSDRT 126

Query: 133 IKQITGAQGFRYFKEDIEERVKLRSQG-FVSSVIFRTFII 171
           ++++ G+      K  + ER+   + G  + ++     +I
Sbjct: 127 VEELRGSDAIARTKAALSERLGALAAGVEIRALYITDLVI 166


>gi|197122894|ref|YP_002134845.1| flagellar basal body-associated protein FliL [Anaeromyxobacter sp.
           K]
 gi|196172743|gb|ACG73716.1| flagellar basal body-associated protein FliL [Anaeromyxobacter sp.
           K]
          Length = 167

 Score = 58.3 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 12/100 (12%), Positives = 35/100 (35%), Gaps = 6/100 (6%)

Query: 78  KKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIPDKVF----LETLHQDIMAYIRTVS 132
                  L   I +   +    + R+   +      D+      +  +    +AY+   +
Sbjct: 67  PPGPTIKLADFIVHLRDTDADRYARVTFDVEVATEEDRTRLTPLVPRVRDAFIAYLSDRT 126

Query: 133 IKQITGAQGFRYFKEDIEERVKLRSQG-FVSSVIFRTFII 171
           ++++ G+      K  + ER+   + G  + ++     +I
Sbjct: 127 VEELRGSDAIARTKAALSERLGALAAGVEIRALYITDLVI 166


>gi|262163663|ref|ZP_06031404.1| flagellar biosynthesis protein FliL [Vibrio mimicus VM223]
 gi|262027879|gb|EEY46543.1| flagellar biosynthesis protein FliL [Vibrio mimicus VM223]
          Length = 121

 Score = 58.3 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 10/115 (8%), Positives = 36/115 (31%), Gaps = 11/115 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLETL 120
            S         +         + TNF +      ++++ I ++  +       +     +
Sbjct: 5   ASHAEDPPAVPQLAYFTLEPDLTTNFFTKGNKLGYIQVRIDIMVANAADLPVIEKHQPLI 64

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
              ++  +   +   I    G    ++ +  R+         +  ++ ++F  +I
Sbjct: 65  RDAVVELLGKQTEDTIKSLAGREDLRKSLVSRLNNILLPEIGRTVIADLLFTKYI 119


>gi|256830499|ref|YP_003159227.1| flagellar basal body-associated protein FliL [Desulfomicrobium
           baculatum DSM 4028]
 gi|256579675|gb|ACU90811.1| flagellar basal body-associated protein FliL [Desulfomicrobium
           baculatum DSM 4028]
          Length = 171

 Score = 58.3 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 15/107 (14%), Positives = 37/107 (34%), Gaps = 6/107 (5%)

Query: 71  TGDTISLKKLQIFSLQPIITNFDSS-PKDWLR----LDIALICKDIPDKVFLETLHQDIM 125
                     Q+ +L   + N      + +L+    +++A           +  +   ++
Sbjct: 64  EQKAEVEPGGQLVTLDSFVVNLSDPMGRRYLKTTLDVEVASAAAAAELTAAMPKVKDTLL 123

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
             + + S   I+        K DI  R+  +  +  V +V F  F++
Sbjct: 124 LLLSSKSFADISSMDKKIELKNDIVSRLNQIIGKNKVRNVYFTEFVV 170


>gi|157736469|ref|YP_001489152.1| flagellar basal body-associated protein [Arcobacter butzleri
           RM4018]
 gi|157698323|gb|ABV66483.1| flagellar basal body-associated protein [Arcobacter butzleri
           RM4018]
          Length = 175

 Score = 57.9 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/184 (9%), Positives = 63/184 (34%), Gaps = 23/184 (12%)

Query: 1   MSYD--DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +  +TT +   G    + +   ++   + +  G    +  +   A   ++  +    
Sbjct: 1   MAEENGETTKKSSEGKGLLIVLIVLILILIMAVAGGTYFLLDKISSTANNGQKTEESAQT 60

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI----PDK 114
               + S  +        +          +        +  ++L  ++   D       +
Sbjct: 61  ATPANTSEATFKADVNDLV----------LNLTDSRGKEKVMKLSFSIRSNDPLIATVIE 110

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-------SQGFVSSVIFR 167
            +   +   +++ + + S +++    G    K+++   +          ++  VS+++F 
Sbjct: 111 EYKAEITDVVISQVSSRSSEELLTVGGKNLLKDELIAEINNVINYVTKSNRNVVSTILFT 170

Query: 168 TFII 171
           TF+I
Sbjct: 171 TFVI 174


>gi|56459377|ref|YP_154658.1| flagellar basal body-associated protein FliL-like protein
           [Idiomarina loihiensis L2TR]
 gi|56178387|gb|AAV81109.1| Flagellar basal body-associated protein [Idiomarina loihiensis
           L2TR]
          Length = 132

 Score = 57.9 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/110 (15%), Positives = 34/110 (30%), Gaps = 13/110 (11%)

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDW----LRLDIALICKDI----PDKVFLETLHQDIM 125
             +           I TN+     D+    +R+ I ++  D       +     L    +
Sbjct: 21  ASADDVSYYGFEPDITTNYLKEGNDYRLGFIRVAIEVMVPDPSYVSVVEHHAPLLRNAFV 80

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
             + T + +Q+    G    +    ER K           +  V+F  +I
Sbjct: 81  TILSTATERQVRTMTGRDQLRLKCIERAKELMQQETGNPVIRDVLFTKYI 130


>gi|224157700|ref|XP_002337883.1| predicted protein [Populus trichocarpa]
 gi|222869964|gb|EEF07095.1| predicted protein [Populus trichocarpa]
          Length = 284

 Score = 57.9 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/151 (11%), Positives = 40/151 (26%), Gaps = 26/151 (17%)

Query: 9   QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRS 68
                N  KL +    V   +G         +        +     K +      +    
Sbjct: 16  AKPPRNIKKLVLAGVAVLALLGGG---AFFFLKHGHKNDSQVAMTPKEMEKMIKAHP--- 69

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDI----PDKVFLETLH 121
                        I  L+P + N +++      +L++ IA    +          +  + 
Sbjct: 70  -------------IIDLKPFVVNLNTASAENSRYLKVRIAFKLDNPQVAKEVDYRMPEIQ 116

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEER 152
             I+  + + +   +    G    +  I  R
Sbjct: 117 NIILILLGSETADDLGTTGGKLALRNQIRHR 147


>gi|90412718|ref|ZP_01220719.1| flagellar basal body-associated protein [Photobacterium profundum
           3TCK]
 gi|90326293|gb|EAS42712.1| flagellar basal body-associated protein [Photobacterium profundum
           3TCK]
          Length = 137

 Score = 57.9 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 17/114 (14%), Positives = 36/114 (31%), Gaps = 11/114 (9%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDI----PDKVFLETLH 121
           +         +         I TN+ +  K   +LRL I L+  D       +     + 
Sbjct: 22  AAADAPLSQPEYSYYTLTPDITTNYVTQGKKLGYLRLQIDLMVSDPSLIKQVEHHTPLIR 81

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFI 170
             I+  I      ++    G    ++    +V         Q  V+ ++F  ++
Sbjct: 82  DAIINIIGQQPEAKVKSLAGREEIRQACLAKVNELLITETRQKLVTELLFTKYL 135


>gi|296282260|ref|ZP_06860258.1| flagellar basal body-associated protein FliL [Citromicrobium
           bathyomarinum JL354]
          Length = 196

 Score = 57.9 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 23/196 (11%), Positives = 55/196 (28%), Gaps = 26/196 (13%)

Query: 1   MSYDDTTSQY------IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQ 54
           MS D  T+          G    L +   ++    G         ++      +++   +
Sbjct: 1   MSNDAQTTADDAPKKKKGGFMKMLLMAIVLLGAGGGGTYAAFATGMIGGAAEKKEDTGPE 60

Query: 55  KFILNNFYDNSVRSVHTGDTISLKKL---------QIFSLQPIITNFDSSPKDWLRLDIA 105
             +       +V+S    +   +                     +N        +++ +A
Sbjct: 61  YVLKGEEDPYAVKSEKGEEEGKVVHGSGGSKYRTAYYEFQDEFTSNLAGGID-LVQISLA 119

Query: 106 LICKDIP-----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL----- 155
                              +   I+  + +     I+ AQG    ++ + + +       
Sbjct: 120 ASTHKDGRVLMWLHDHELAIRSRILVELASTDAADISTAQGKEKLQQRLTKAINDELIAH 179

Query: 156 RSQGFVSSVIFRTFII 171
              G V +V FR+ II
Sbjct: 180 EGFGGVDNVYFRSLII 195


>gi|261210189|ref|ZP_05924486.1| flagellar biosynthesis protein FliL [Vibrio sp. RC341]
 gi|260840729|gb|EEX67278.1| flagellar biosynthesis protein FliL [Vibrio sp. RC341]
          Length = 121

 Score = 57.9 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 11/115 (9%), Positives = 38/115 (33%), Gaps = 11/115 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETL 120
            S       + +         + TNF +      ++++ I ++  +  D    +     +
Sbjct: 5   ASYAEDPPAAPQLAYFTLEPDLTTNFFTKGNKLGYIQVRIDIMVANAADLPIVEQHQPLI 64

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
              ++  +   +   I    G    ++ +  R+         +  ++ ++F  +I
Sbjct: 65  RDAVVELLGKQTEDTIKSLAGREDLRKSLVNRLNNILLPEVGRTVIADLLFTKYI 119


>gi|149908615|ref|ZP_01897277.1| flagellar basal body-associated protein [Moritella sp. PE36]
 gi|149808449|gb|EDM68386.1| flagellar basal body-associated protein [Moritella sp. PE36]
          Length = 132

 Score = 57.9 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 13/119 (10%), Positives = 44/119 (36%), Gaps = 11/119 (9%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIP----DKVFL 117
            S+ +  + +      +       IITN+ S      ++ + +  +  D       ++  
Sbjct: 13  ASLSTAVSANDHQPVYIYFGLEPDIITNYTSETNKIGFISVSVEFMLADNDGLDIIEMHE 72

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
             +   I++ +   S + +    G    +++I+  V         +  + +++F  +++
Sbjct: 73  PLIRDKIISLLGQQSPQHLRSLTGREEIRKEIQNEVNSLLKQETGKAVIENLLFTKYLL 131


>gi|54307382|ref|YP_128402.1| flagellar basal body-associated protein FliL-like protein
           [Photobacterium profundum SS9]
 gi|46911802|emb|CAG18600.1| Putative flagellar protein FliL [Photobacterium profundum SS9]
          Length = 138

 Score = 57.9 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 17/114 (14%), Positives = 35/114 (30%), Gaps = 11/114 (9%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDI----PDKVFLETLH 121
           +                   I TN+ +  K   +LRL I L+  D       +     + 
Sbjct: 23  AAADVPLSQPNYSYYTLTPDITTNYVTQGKKLGYLRLQIDLMVSDPSLIKQVEHHTPLIR 82

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFI 170
             I+  I      ++    G    ++    +V         Q  V+ ++F  ++
Sbjct: 83  DAIINIIGQQPEAKVKSLAGREEIRQACLAKVNELLITETRQKLVTELLFTKYL 136


>gi|323493105|ref|ZP_08098236.1| flagellar biosynthesis protein FliL [Vibrio brasiliensis LMG 20546]
 gi|323312576|gb|EGA65709.1| flagellar biosynthesis protein FliL [Vibrio brasiliensis LMG 20546]
          Length = 165

 Score = 57.9 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 14/168 (8%), Positives = 55/168 (32%), Gaps = 16/168 (9%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
            Q  + + + ++ T   +    + G +     +G + E        + + +S  +  T  
Sbjct: 3   KQQLIAIFFAMIITSALVSAATVVGGLWFLKQSGSETES------KDLFADSPLAFLTQP 56

Query: 74  TISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLETLHQDIMAYI 128
               +      L  I+ +     +  ++ L++A+  +          ++  +   ++   
Sbjct: 57  PAPSRTPSFHELDKIVLSVKGKRQTHFVMLEVAVETRRPERIESIDDYMPIVRNSLLKLF 116

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVKLRSQ-----GFVSSVIFRTFII 171
              +   +         +  +++ V L  +       +  V+   +++
Sbjct: 117 SDKTYDDLRQDGAVNQLQNQVKQTVLLALENTDIVAEIDDVLLTKYVV 164


>gi|154686047|ref|YP_001421208.1| flagellar basal body-associated protein FliL [Bacillus
           amyloliquefaciens FZB42]
 gi|154351898|gb|ABS73977.1| FliL [Bacillus amyloliquefaciens FZB42]
          Length = 139

 Score = 57.9 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 41/109 (37%), Gaps = 3/109 (2%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP--KDWLRLDIALICKDIPDKVFLETLH 121
           +         TI        S+  I TN  S    +  ++L+          +     + 
Sbjct: 28  SGHSGKDKKPTIDEVVAATVSVDDITTNLKSDSIIRIGIKLETDSAKAKEELEKRDFQVK 87

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
            +I++ +   S  +I G +G   FK+ ++E+V     +G V  V   +F
Sbjct: 88  DNIISILADTSAGEIEGDKGREAFKQSLKEKVNSYLQEGKVQKVYITSF 136


>gi|163744329|ref|ZP_02151689.1| Flagellar basal body-associated protein [Oceanibulbus indolifex
           HEL-45]
 gi|161381147|gb|EDQ05556.1| Flagellar basal body-associated protein [Oceanibulbus indolifex
           HEL-45]
          Length = 177

 Score = 57.9 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/158 (12%), Positives = 50/158 (31%), Gaps = 12/158 (7%)

Query: 26  YTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSL 85
              + +  G  G + M  L   +  E+  +   N   + +    H     +  K+ +   
Sbjct: 19  VGGVTLAIGPSGLLKMAGLGGDEAAEETVETADNAHGEEAADDGHGDKPKAEVKMPVMPF 78

Query: 86  QPIITNFDSSP------KDWLRLDIALICK-----DIPDKVFLETLHQDIMAYIRTVSIK 134
             II N   +         +L+L++ ++                 L      ++R + + 
Sbjct: 79  PEIIVNVTDTGPQGGQTSRFLKLNMLMVYDETVEGADRLVAREIYLRDSFQDFLRQLHVS 138

Query: 135 QITGAQGFRYFKEDIEERVKLRS-QGFVSSVIFRTFII 171
            + G+ G    K ++  R +          ++    ++
Sbjct: 139 DLNGSYGLAMLKTELLRRARAVGHTDAPHEILIADMVV 176


>gi|146305355|ref|YP_001185820.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas mendocina ymp]
 gi|145573556|gb|ABP83088.1| flagellar basal body-associated protein FliL [Pseudomonas mendocina
           ymp]
          Length = 134

 Score = 57.9 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 14/115 (12%), Positives = 36/115 (31%), Gaps = 11/115 (9%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIP----DKVFLETLH 121
           +         + L    +  +I N         + + D+AL           K     + 
Sbjct: 19  ASSEKKEEVPQTLYYNLVPALIGNLADGGNRLKFFKADVALRVNGAEAEARIKHHDPLIR 78

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
             ++      + + I   +G    +++  ++V+        +  V  ++F   II
Sbjct: 79  HQLVLLFSAQTSESINAPEGRENLRQEALKQVQQALTAEEGKPVVEDLLFNNLII 133


>gi|258623126|ref|ZP_05718138.1| flagellar protein FliL, putative [Vibrio mimicus VM573]
 gi|258626616|ref|ZP_05721446.1| flagellar protein FliL, putative [Vibrio mimicus VM603]
 gi|262172860|ref|ZP_06040538.1| flagellar biosynthesis protein FliL [Vibrio mimicus MB-451]
 gi|258581120|gb|EEW06039.1| flagellar protein FliL, putative [Vibrio mimicus VM603]
 gi|258584609|gb|EEW09346.1| flagellar protein FliL, putative [Vibrio mimicus VM573]
 gi|261893936|gb|EEY39922.1| flagellar biosynthesis protein FliL [Vibrio mimicus MB-451]
          Length = 127

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 10/115 (8%), Positives = 36/115 (31%), Gaps = 11/115 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLETL 120
            S         +         + TNF +      ++++ I ++  +       +     +
Sbjct: 11  ASHAEDPPAVPQLAYFTLEPDLTTNFFTKGNKLGYIQVRIDIMVANAADLPVIEKHQPLI 70

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
              ++  +   +   I    G    ++ +  R+         +  ++ ++F  +I
Sbjct: 71  RDAVVELLGKQTEDTIKSLAGREDLRKSLVSRLNNILLPEIGRTVIADLLFTKYI 125


>gi|330501287|ref|YP_004378156.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas mendocina NK-01]
 gi|328915573|gb|AEB56404.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas mendocina NK-01]
          Length = 134

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 12/118 (10%), Positives = 32/118 (27%), Gaps = 11/118 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW------LRLDIALICKDIPDKVFLE 118
              +       +   L       +I N   +          + L +     +   K    
Sbjct: 16  PALASSEKKEEAPTTLYYNLTPALIGNLADTGNRLKFFKADVSLRVTGTEAEEKIKQHEP 75

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
            +   ++      + + I    G    + +  ++V+        +  V  ++F   II
Sbjct: 76  LIRHQMVMLFSAQTSETINAPDGRENLRLEALKKVQDAINGEEGKPIVEDLLFNNLII 133


>gi|315178777|gb|ADT85691.1| flagellar protein FliL, hypothetical [Vibrio furnissii NCTC 11218]
          Length = 135

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 12/113 (10%), Positives = 39/113 (34%), Gaps = 11/113 (9%)

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLETLHQ 122
            H  +  + K         + TNF +  K   ++++ I ++          +     +  
Sbjct: 21  AHAEENEAPKFAYFTLEPDLTTNFYTKGKKLGYIQVRIDIMVASSTDLPLIETHQPLIRD 80

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            ++  +   +   I    G    ++ + E++         +  ++ ++F  +I
Sbjct: 81  AVVELLGKQTEDTIKSLAGREDLRKTLVEQLNNILLTETGRRVIADLLFTKYI 133


>gi|89068712|ref|ZP_01156098.1| flagellar M-ring protein [Oceanicola granulosus HTCC2516]
 gi|89045675|gb|EAR51737.1| flagellar M-ring protein [Oceanicola granulosus HTCC2516]
          Length = 169

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/155 (12%), Positives = 46/155 (29%), Gaps = 12/155 (7%)

Query: 29  IGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPI 88
           +          +         E         +    +        T +  +  +  L  +
Sbjct: 14  VAGAGLDGLRALASGDAPPADEAADHGAEPADDGHGTQDGYGGTGTGTGAEQALHHLDEM 73

Query: 89  ITNFDSSP------KDWLRLDIALICK-----DIPDKVFLETLHQDIMAYIRTVSIKQIT 137
           I N  S+         +L++++A++           +     L      Y+R +S  ++ 
Sbjct: 74  IVNVTSASASGRLTTRFLKVNVAIVYDPAAPGADELEARTLFLRDTFQDYLRQLSETELE 133

Query: 138 GAQGFRYFKEDIEERVKLRSQGFV-SSVIFRTFII 171
           G+ G    K ++  R +    G     ++    II
Sbjct: 134 GSLGLHRLKAELLRRARAVVGGDAPQEILVSDLII 168


>gi|153214611|ref|ZP_01949487.1| flagellar protein FliL, putative [Vibrio cholerae 1587]
 gi|229527156|ref|ZP_04416550.1| flagellar biosynthesis protein FliL [Vibrio cholerae 12129(1)]
 gi|124115217|gb|EAY34037.1| flagellar protein FliL, putative [Vibrio cholerae 1587]
 gi|229335387|gb|EEO00870.1| flagellar biosynthesis protein FliL [Vibrio cholerae 12129(1)]
          Length = 136

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 10/117 (8%), Positives = 37/117 (31%), Gaps = 11/117 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLE 118
              S     +   +         + TNF +      ++++ I ++  +       +    
Sbjct: 18  PFHSHAEEKSAVPQLAYFTLEPDLTTNFFTKGNKLGYIQVRIDIMVANAADLPVVEQHQP 77

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +   ++  +   +   I    G    ++ +  R+         +  ++ ++F  +I
Sbjct: 78  LIRDAVVELLGKQTEDTIKSLAGREDLRKSLVNRLNNILLPEVGRTVIADLLFTKYI 134


>gi|260767583|ref|ZP_05876519.1| flagellar biosynthesis protein FliL [Vibrio furnissii CIP 102972]
 gi|260617483|gb|EEX42666.1| flagellar biosynthesis protein FliL [Vibrio furnissii CIP 102972]
          Length = 126

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 12/113 (10%), Positives = 39/113 (34%), Gaps = 11/113 (9%)

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLETLHQ 122
            H  +  + K         + TNF +  K   ++++ I ++          +     +  
Sbjct: 12  AHAEENEAPKFAYFTLEPDLTTNFYTKGKKLGYIQVRIDIMVASSTDLPLIETHQPLIRD 71

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            ++  +   +   I    G    ++ + E++         +  ++ ++F  +I
Sbjct: 72  AVVELLGKQTEDTIKSLAGREDLRKTLVEQLNNILLTETGRRVIADLLFTKYI 124


>gi|205373387|ref|ZP_03226191.1| flagellar basal body-associated protein FliL [Bacillus coahuilensis
           m4-4]
          Length = 144

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 15/110 (13%), Positives = 43/110 (39%), Gaps = 6/110 (5%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----IPDKVFLETLHQ 122
            +  +  +I         +  + TN  S+   ++R+   +           +     ++ 
Sbjct: 35  EAAESEPSIDEILEYSVDIPELTTNLLSNND-FIRISFKIQTDSKKAKEELEKRNFQVND 93

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            I+  +  ++  +I G  G R  ++ I+ ++  L  +G +  V   +++I
Sbjct: 94  IIIEEMSELTSDEIRGKDGKRNIEDTIKTKLNSLMQEGKIEKVYITSWVI 143


>gi|167630300|ref|YP_001680799.1| flagellar basal body-associated protein flil, putative
           [Heliobacterium modesticaldum Ice1]
 gi|167593040|gb|ABZ84788.1| flagellar basal body-associated protein flil, putative
           [Heliobacterium modesticaldum Ice1]
          Length = 161

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 15/119 (12%), Positives = 35/119 (29%), Gaps = 10/119 (8%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDI--------P 112
             ++V               +F      TN      K +L+  + L   +          
Sbjct: 41  SPDAVSDHTPKAAAPKTVGVLFEAGDFTTNLADPGGKRFLKAKVILELNEEKKDEKKLAE 100

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFI 170
            K  L  +   I+  +   +++     +     K+DI   +  +       +V F+  +
Sbjct: 101 LKEQLPVIRDRILYILSAKTVEDFQVTESKEKVKKDILVALNKQFGADKFRNVYFQELV 159


>gi|330447176|ref|ZP_08310826.1| flagellar basal body-associated FliL family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491367|dbj|GAA05323.1| flagellar basal body-associated FliL family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 139

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 39/121 (32%), Gaps = 11/121 (9%)

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDI----PDK 114
               +V S         +         I TN+ +  K   ++RL I L+ +D       +
Sbjct: 17  QSPIAVASSSEDVANQPQITYYTLEPDITTNYVTQGKRLGYIRLQIDLMIRDQKHLTEIE 76

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTF 169
                +   I+  +      +I    G    +   +++V            V+ ++F  F
Sbjct: 77  YHTPLIRDAIIEIVSKQPEAKIKSLAGREEIRRACQDQVNRLLLAETRHQPVAELLFTKF 136

Query: 170 I 170
           +
Sbjct: 137 L 137


>gi|332187931|ref|ZP_08389664.1| flagellar basal body-associated FliL family protein [Sphingomonas
           sp. S17]
 gi|332012092|gb|EGI54164.1| flagellar basal body-associated FliL family protein [Sphingomonas
           sp. S17]
          Length = 225

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 13/110 (11%), Positives = 37/110 (33%), Gaps = 10/110 (9%)

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP-----DKVFLETLHQDIMA 126
           GD         + +    T+        +++ +A+            K     +   I+ 
Sbjct: 115 GDGGERYASNYYEMPKDFTSNLRDSVHVIQVGLAISTPYDDTVINNLKTNDLAVRSAILM 174

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
            +   + +Q+  ++G R  +  +   +          G +++V F  F++
Sbjct: 175 TLGDANEEQVFSSEGKRDLQRKLVNSINEILRQKEGFGGIANVYFTNFVV 224


>gi|15640129|ref|NP_229756.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           cholerae O1 biovar El Tor str. N16961]
 gi|121591576|ref|ZP_01678832.1| flagellar protein FliL, putative [Vibrio cholerae 2740-80]
 gi|121727776|ref|ZP_01680852.1| flagellar protein FliL, putative [Vibrio cholerae V52]
 gi|147673890|ref|YP_001218319.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           cholerae O395]
 gi|153818204|ref|ZP_01970871.1| flagellar protein FliL, putative [Vibrio cholerae NCTC 8457]
 gi|153824038|ref|ZP_01976705.1| flagellar protein FliL, putative [Vibrio cholerae B33]
 gi|153826618|ref|ZP_01979285.1| flagellar protein FliL, putative [Vibrio cholerae MZO-2]
 gi|227080333|ref|YP_002808884.1| putative flagellar protein FliL [Vibrio cholerae M66-2]
 gi|229508380|ref|ZP_04397884.1| flagellar biosynthesis protein FliL [Vibrio cholerae BX 330286]
 gi|229508939|ref|ZP_04398429.1| flagellar biosynthesis protein FliL [Vibrio cholerae B33]
 gi|229515864|ref|ZP_04405322.1| flagellar biosynthesis protein FliL [Vibrio cholerae TMA 21]
 gi|229517053|ref|ZP_04406499.1| flagellar biosynthesis protein FliL [Vibrio cholerae RC9]
 gi|229520105|ref|ZP_04409533.1| flagellar biosynthesis protein FliL [Vibrio cholerae TM 11079-80]
 gi|229606654|ref|YP_002877302.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           cholerae MJ-1236]
 gi|254225612|ref|ZP_04919221.1| flagellar protein FliL, putative [Vibrio cholerae V51]
 gi|254291841|ref|ZP_04962625.1| flagellar protein FliL, putative [Vibrio cholerae AM-19226]
 gi|254851482|ref|ZP_05240832.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           cholerae MO10]
 gi|255743944|ref|ZP_05417899.1| flagellar biosynthesis protein FliL [Vibrio cholera CIRS 101]
 gi|262151319|ref|ZP_06028453.1| flagellar biosynthesis protein FliL [Vibrio cholerae INDRE 91/1]
 gi|262167238|ref|ZP_06034949.1| flagellar biosynthesis protein FliL [Vibrio cholerae RC27]
 gi|262192235|ref|ZP_06050393.1| flagellar biosynthesis protein FliL [Vibrio cholerae CT 5369-93]
 gi|297581856|ref|ZP_06943777.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298501128|ref|ZP_07010928.1| flagellar basal body-associated protein FliL [Vibrio cholerae MAK
           757]
 gi|9654495|gb|AAF93275.1| flagellar protein FliL, putative [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121546569|gb|EAX56768.1| flagellar protein FliL, putative [Vibrio cholerae 2740-80]
 gi|121629900|gb|EAX62312.1| flagellar protein FliL, putative [Vibrio cholerae V52]
 gi|125621932|gb|EAZ50257.1| flagellar protein FliL, putative [Vibrio cholerae V51]
 gi|126511233|gb|EAZ73827.1| flagellar protein FliL, putative [Vibrio cholerae NCTC 8457]
 gi|126518441|gb|EAZ75664.1| flagellar protein FliL, putative [Vibrio cholerae B33]
 gi|146315773|gb|ABQ20312.1| putative flagellar protein FliL [Vibrio cholerae O395]
 gi|149739556|gb|EDM53780.1| flagellar protein FliL, putative [Vibrio cholerae MZO-2]
 gi|150422277|gb|EDN14240.1| flagellar protein FliL, putative [Vibrio cholerae AM-19226]
 gi|227008221|gb|ACP04433.1| putative flagellar protein FliL [Vibrio cholerae M66-2]
 gi|227011901|gb|ACP08111.1| putative flagellar protein FliL [Vibrio cholerae O395]
 gi|229342893|gb|EEO07883.1| flagellar biosynthesis protein FliL [Vibrio cholerae TM 11079-80]
 gi|229346116|gb|EEO11088.1| flagellar biosynthesis protein FliL [Vibrio cholerae RC9]
 gi|229347127|gb|EEO12088.1| flagellar biosynthesis protein FliL [Vibrio cholerae TMA 21]
 gi|229354056|gb|EEO18989.1| flagellar biosynthesis protein FliL [Vibrio cholerae B33]
 gi|229354653|gb|EEO19575.1| flagellar biosynthesis protein FliL [Vibrio cholerae BX 330286]
 gi|229369309|gb|ACQ59732.1| flagellar biosynthesis protein FliL [Vibrio cholerae MJ-1236]
 gi|254847187|gb|EET25601.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           cholerae MO10]
 gi|255738427|gb|EET93817.1| flagellar biosynthesis protein FliL [Vibrio cholera CIRS 101]
 gi|262024302|gb|EEY42992.1| flagellar biosynthesis protein FliL [Vibrio cholerae RC27]
 gi|262030858|gb|EEY49488.1| flagellar biosynthesis protein FliL [Vibrio cholerae INDRE 91/1]
 gi|262031908|gb|EEY50488.1| flagellar biosynthesis protein FliL [Vibrio cholerae CT 5369-93]
 gi|297533950|gb|EFH72790.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297540162|gb|EFH76223.1| flagellar basal body-associated protein FliL [Vibrio cholerae MAK
           757]
 gi|327483003|gb|AEA77410.1| Flagellar biosynthesis protein FliL [Vibrio cholerae LMA3894-4]
          Length = 136

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 10/117 (8%), Positives = 37/117 (31%), Gaps = 11/117 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLE 118
              S     +   +         + TNF +      ++++ I ++  +       +    
Sbjct: 18  PFHSHAEEKSAVPQLAYFTLEPDLTTNFFTKGNKLGYIQVRIDIMVANAADLPVVEQHQP 77

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +   ++  +   +   I    G    ++ +  R+         +  ++ ++F  +I
Sbjct: 78  LIRDAVVELLGKQTEDTIKSLAGREDLRKSLVNRLNNILLPEVGRTVIADLLFTKYI 134


>gi|315635629|ref|ZP_07890892.1| flagellar basal body-associated protein [Arcobacter butzleri JV22]
 gi|315479926|gb|EFU70596.1| flagellar basal body-associated protein [Arcobacter butzleri JV22]
          Length = 175

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 18/184 (9%), Positives = 64/184 (34%), Gaps = 23/184 (12%)

Query: 1   MSYD--DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +  +TT +   G    + +   ++   + +  G    +  +   A   ++  +    
Sbjct: 1   MAEENGETTKKSSEGKGLLIILIVLILILIMAVAGGTYFLLDKISSTANNGQKTEETAQS 60

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI----PDK 114
           +   + S  +        +          +        +  ++L  ++   D       +
Sbjct: 61  STPANTSEATFKADVNDLV----------LNLTDSRGKEKVMKLSFSIRSNDPLIATVIE 110

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-------SQGFVSSVIFR 167
            +   +   +++ + + S +++    G    K+++   +          ++  VS+++F 
Sbjct: 111 EYKAEITDVVISQVSSRSSEELLTVGGKNLLKDELIAEINNVINYVTKSNRNVVSTILFT 170

Query: 168 TFII 171
           TF+I
Sbjct: 171 TFVI 174


>gi|229524998|ref|ZP_04414403.1| flagellar biosynthesis protein FliL [Vibrio cholerae bv. albensis
           VL426]
 gi|229338579|gb|EEO03596.1| flagellar biosynthesis protein FliL [Vibrio cholerae bv. albensis
           VL426]
          Length = 136

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 10/117 (8%), Positives = 37/117 (31%), Gaps = 11/117 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLE 118
              S     +   +         + TNF +      ++++ I ++  +       +    
Sbjct: 18  PFHSHAEEKSAVPQLAYFTLEPDLTTNFFTKGNKLGYIQVRIDIMVANAADIPVVEQHQP 77

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +   ++  +   +   I    G    ++ +  R+         +  ++ ++F  +I
Sbjct: 78  LIRDAVVELLGKQTEDTIKSLAGREDLRKSLVNRLNNILLPEVGRTVIADLLFTKYI 134


>gi|330828805|ref|YP_004391757.1| flagellar basal body-associated protein FliL [Aeromonas veronii
           B565]
 gi|328803941|gb|AEB49140.1| Flagellar basal body-associated protein FliL [Aeromonas veronii
           B565]
          Length = 171

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 24/181 (13%), Positives = 55/181 (30%), Gaps = 21/181 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ D+  +        K  +   +    I +  G  G  +ML                  
Sbjct: 1   MADDNELTLKDPAAGKKKKLIIIIALAVILLGGGGAGAFLMLSGSNKPPV---------- 50

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDIPDKVF--- 116
                       +      L +   +P + N         +++ I L+ +   D+     
Sbjct: 51  -EAAEGAEAAPKEEAPKPSLYVGMPRPFVFNVAGAQRDRLVQIKIQLMVRGTADETLAKQ 109

Query: 117 -LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +  +   ++      S +Q+   +G    ++D  E  +     L S   +  V+F  F+
Sbjct: 110 NIPLIEGTLLRVFSAASAEQLMTFEGKEKLRKDSLEECRRVLKDLVSSPVIEQVLFTGFV 169

Query: 171 I 171
           +
Sbjct: 170 M 170


>gi|146284387|ref|YP_001174540.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas stutzeri A1501]
 gi|145572592|gb|ABP81698.1| flagellar protein FliL, putative [Pseudomonas stutzeri A1501]
          Length = 167

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 11/122 (9%), Positives = 41/122 (33%), Gaps = 10/122 (8%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK---- 114
                +  +    ++ + + L       ++ N+ S  +  + + D+AL       +    
Sbjct: 45  AVAGAAQANESADESAAPQTLYYALTPAMVGNYASGERLKYFKADVALRISSKEVEDRVK 104

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTF 169
                +   ++      + + +   +     +++  ++V+   +       V  ++F   
Sbjct: 105 HHEPLIRHQLVMLFSEQTDETLGSVEAKELLRQEALKQVREVLEQEEGKPLVDDLLFNNL 164

Query: 170 II 171
           II
Sbjct: 165 II 166


>gi|114765264|ref|ZP_01444396.1| flagellar motor switch protein M [Pelagibaca bermudensis HTCC2601]
 gi|114542399|gb|EAU45427.1| flagellar motor switch protein M [Roseovarius sp. HTCC2601]
          Length = 196

 Score = 57.1 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 57/181 (31%), Gaps = 23/181 (12%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLG-------GIVMLFLFAGQKEEKY 53
           M+    TSQ     + K  +  F +     +             G + L   A   E++ 
Sbjct: 1   MADSTGTSQDAETPKKKTLLRIFALLLLCVVALAGGFVASVGPQGAMELVGLADDPEDEA 60

Query: 54  QKFILNNFYDNSV-----RSVHTGDTISLKKLQIFSLQPIITNF------DSSPKDWLRL 102
                +   D++       +  T   +  + + +   Q II N             +L+L
Sbjct: 61  AASGEDAVEDHAAGDGHGAAPATPAGLPGEHIVVTPFQEIIVNITATTATGRQTTRFLKL 120

Query: 103 DIALICK-----DIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS 157
           ++AL            +     L      Y+R ++   + G+ G    K ++  R +  S
Sbjct: 121 NLALAYDNRVSGAENIESRKLFLRDSFQEYLRQLNENDLQGSIGLVRLKSELLRRARAIS 180

Query: 158 Q 158
            
Sbjct: 181 D 181


>gi|119475482|ref|ZP_01615835.1| flagellar protein [marine gamma proteobacterium HTCC2143]
 gi|119451685|gb|EAW32918.1| flagellar protein [marine gamma proteobacterium HTCC2143]
          Length = 132

 Score = 57.1 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 42/111 (37%), Gaps = 11/111 (9%)

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDI-----PDKVFLETLHQDIM 125
                +    I      + N+    K  +L+ DIAL  +         +  +  +   ++
Sbjct: 20  SSAQDVSSRYIDLKPAFVVNYGDGGKLRYLKTDIALRVEGDSEGPVDIRHHMPYIRHSLV 79

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFII 171
             +   S ++++  +G    +++  E V     K     +V  ++F +FI+
Sbjct: 80  MRLSRASEEELSSMEGKELLRQEALESVRDVLMKEEGVQYVEDLLFNSFIV 130


>gi|320107030|ref|YP_004182620.1| flagellar basal body-associated protein FliL [Terriglobus saanensis
           SP1PR4]
 gi|319925551|gb|ADV82626.1| flagellar basal body-associated protein FliL [Terriglobus saanensis
           SP1PR4]
          Length = 174

 Score = 57.1 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 21/184 (11%), Positives = 51/184 (27%), Gaps = 30/184 (16%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +  + + Q  + N   L +   V           +   +                     
Sbjct: 5   ASANASGQPAKINLGSLLIVAIVAAVLSAGGAAAVFYFL----------------AKRMG 48

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICKDIPDKVFLETL 120
                 +          + +    +P++ N      + +LRL + L   D P+K   E +
Sbjct: 49  VSPFSETKTFDSRQGAAQTKQVPFEPMLVNLADSDGQAYLRLGVVLSVLDEPEKAGKEKV 108

Query: 121 ------------HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-FVSSVIFR 167
                          I++ +       +  + G    K  +   ++ R     ++ V F 
Sbjct: 109 DAAHPVYGSAAMRDTILSVVGAEKSGDLLMSSGKSALKTKLRSAIQQRDPALKIADVFFT 168

Query: 168 TFII 171
            F++
Sbjct: 169 EFLV 172


>gi|160896093|ref|YP_001561675.1| flagellar basal body-associated protein FliL [Delftia acidovorans
           SPH-1]
 gi|160361677|gb|ABX33290.1| flagellar basal body-associated protein FliL [Delftia acidovorans
           SPH-1]
          Length = 191

 Score = 57.1 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 17/148 (11%), Positives = 44/148 (29%), Gaps = 35/148 (23%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIP----D 113
           +  + +      +    ++       L  ++ N   +    ++++ I L   D       
Sbjct: 43  SKRHSSGDEEEGSASKAAVTVPTFLPLDNLVVNLSDTGGDRFVQIGITLELADEKTATTV 102

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL------------------ 155
           K +L ++   I+  +   + +++   +G      D+   V                    
Sbjct: 103 KQYLPSIRNGILMLVSQRTAEELLEREGKERLAADVLNEVSAPLGYGNQAKAKKRSRDED 162

Query: 156 ------------RSQGFVSSVIFRTFII 171
                         +  V  V+F +FII
Sbjct: 163 AEDEDGERRRSSAGKNPVRRVLFSSFII 190


>gi|308173593|ref|YP_003920298.1| flagellar basal-body associated protein [Bacillus amyloliquefaciens
           DSM 7]
 gi|307606457|emb|CBI42828.1| flagellar basal-body associated protein [Bacillus amyloliquefaciens
           DSM 7]
 gi|328553475|gb|AEB23967.1| flagellar basal body-associated protein FliL [Bacillus
           amyloliquefaciens TA208]
 gi|328911734|gb|AEB63330.1| flagellar basal-body associated protein [Bacillus amyloliquefaciens
           LL3]
          Length = 139

 Score = 57.1 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 41/109 (37%), Gaps = 3/109 (2%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP--KDWLRLDIALICKDIPDKVFLETLH 121
           +         TI        S+  I TN  S    +  ++L+          +     + 
Sbjct: 28  SGNSDKDKKPTIDEVVAATVSVDDITTNLKSDSIIRIGIKLETDSAKAKEELEKRDFQVK 87

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
            +I++ +   S  +I G +G   FK+ ++E+V     +G V  V   +F
Sbjct: 88  DNIISILADTSAGEIEGDKGREAFKQSLKEKVNSYLQEGKVQKVYITSF 136


>gi|326793916|ref|YP_004311736.1| flagellar basal body-associated protein FliL [Marinomonas
           mediterranea MMB-1]
 gi|326544680|gb|ADZ89900.1| flagellar basal body-associated protein FliL [Marinomonas
           mediterranea MMB-1]
          Length = 146

 Score = 57.1 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 15/115 (13%), Positives = 41/115 (35%), Gaps = 10/115 (8%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDI---PDKVFLETL 120
                  +  +   + I      I N+ +      +++  I+L          +  +  +
Sbjct: 30  PAVQAEDEAAAPMPVYIELTPDFIVNYTAGGGKLRYIKTKISLRSSSDMAGAIEGNMPMV 89

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
              I+ ++ + + +Q++GA      +E+    V    +       V  V+F +F+
Sbjct: 90  RDAIVMFLSSRTQEQVSGALAREKTREEAAIAVNEALKEETGIEPVKDVLFASFV 144


>gi|312115244|ref|YP_004012840.1| flagellar basal body-associated protein FliL [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220373|gb|ADP71741.1| flagellar basal body-associated protein FliL [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 144

 Score = 57.1 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 48/108 (44%), Gaps = 2/108 (1%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI--PDKVFLETLHQD 123
                T +     + ++  L PI+ N  +     +RL+ A++ K            +  D
Sbjct: 36  PAPSVTPNQTVTIRNEVRVLAPIVANLANGSDLSVRLEAAVVLKPDIADAAEICAKISDD 95

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFII 171
           ++ +++TVSI++I G  GF+  K D+  R      G    ++  TF++
Sbjct: 96  LVTFLKTVSIREIEGPTGFQLLKNDLRTRASRVGNGATLDLLILTFVV 143


>gi|283850863|ref|ZP_06368149.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           FW1012B]
 gi|283573786|gb|EFC21760.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           FW1012B]
          Length = 131

 Score = 57.1 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 10/102 (9%), Positives = 33/102 (32%), Gaps = 4/102 (3%)

Query: 74  TISLKKLQIFSLQPIITNFDSSPKD---WLRLDIALICKDIPDKVFLETLHQDIMAYIRT 130
           + ++ +  I     +  N     +     +  +   +              + I+ ++R 
Sbjct: 29  SDAVVRGGIAVYPGLDVNIADGGRLARLHIAFEAQCVDAPSAQMAAAPQTREAILLFLRD 88

Query: 131 VSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            ++ ++    G R  K+D+   +        V  + F   ++
Sbjct: 89  KTVAELATVPGKRKLKQDLLAVMNKAVGGPRVVRLYFLQLVV 130


>gi|153801701|ref|ZP_01956287.1| flagellar protein FliL, putative [Vibrio cholerae MZO-3]
 gi|153829077|ref|ZP_01981744.1| putative flagellar protein FliL [Vibrio cholerae 623-39]
 gi|124122794|gb|EAY41537.1| flagellar protein FliL, putative [Vibrio cholerae MZO-3]
 gi|148875405|gb|EDL73540.1| putative flagellar protein FliL [Vibrio cholerae 623-39]
          Length = 136

 Score = 57.1 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 9/117 (7%), Positives = 36/117 (30%), Gaps = 11/117 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLE 118
                    +   +         + TNF +      ++++ I ++  +       +    
Sbjct: 18  PFHGHAEEKSAVPQLAYFTLEPDLTTNFFTKGNKLGYIQVRIDIMVANAADLPVVEQHQP 77

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +   ++  +   +   I    G    ++ +  R+         +  ++ ++F  +I
Sbjct: 78  LIRDAVVELLGKQTEDTIKSLAGREDLRKSLVNRLNNILLPEVGRTVIADLLFTKYI 134


>gi|90581420|ref|ZP_01237215.1| flagellar basal body-associated protein [Vibrio angustum S14]
 gi|90437397|gb|EAS62593.1| flagellar basal body-associated protein [Vibrio angustum S14]
          Length = 139

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/114 (13%), Positives = 38/114 (33%), Gaps = 11/114 (9%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDI----PDKVFLETLH 121
           + +       +         I TN+ +  K   ++RL + L+  +       +     + 
Sbjct: 24  ASNEDVAAPSQITYYTLEPDITTNYVTQGKRLGYIRLQVDLMINNQTNLTNIEHHTPLIR 83

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFI 170
             I+  +      +I    G    +   +++V         Q  V+ ++F  F+
Sbjct: 84  DAIIDIVSKQPEAKIKSLAGREEIRRACQDQVNRLLLAETRQQPVAELLFTKFL 137


>gi|289607246|emb|CBI60850.1| unnamed protein product [Sordaria macrospora]
          Length = 98

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/97 (13%), Positives = 37/97 (38%), Gaps = 10/97 (10%)

Query: 85  LQPIITNFDSSPKDWLRLDIALICKD-----IPDKVFLETLHQDIMAYIRTVSIKQITGA 139
           ++   T+  S    ++++ +A+            K     +   I+  +   +  Q+   
Sbjct: 1   MEKEFTSNLSDSTHFIQVGVAISTSYDNKVIENLKTHEIAIRSAILLALGETTEDQVFTP 60

Query: 140 QGFRYFKEDIEERVKLRSQ-----GFVSSVIFRTFII 171
           +G +     I++ +    +     G + +V F TF++
Sbjct: 61  EGKKQLSLRIKKAINDTLEQKEGFGGIGNVYFTTFVV 97


>gi|83955114|ref|ZP_00963770.1| Flagellar basal body-associated protein FliL [Sulfitobacter sp.
           NAS-14.1]
 gi|83840443|gb|EAP79616.1| Flagellar basal body-associated protein FliL [Sulfitobacter sp.
           NAS-14.1]
          Length = 212

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/188 (10%), Positives = 55/188 (29%), Gaps = 27/188 (14%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKE---------------EKYQK 55
            RG++  L     +    +G          +    A + E                  + 
Sbjct: 24  PRGSRKMLIAAALMCVVSLGGGFFLARAAYVKDAEAFEPEYKSEEADQTDTKDDHADTED 83

Query: 56  FILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD------WLRLDIALICK 109
              ++   +   +    D        +  L  ++TN     ++      +L++++ +  +
Sbjct: 84  HGKDDHAKDEGDAEDHADDTKAASTGLIDLGEMLTNIQGFDQNGTPTSAFLKVNLMVAYR 143

Query: 110 DIP-----DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSS 163
                          +      Y+R ++   + G  G  Y K ++ +R +          
Sbjct: 144 PDAGADKLMVERQPFMRDLFNGYLRGLTENDVRGMAGILYIKAELLKRARAAVGSDLPQE 203

Query: 164 VIFRTFII 171
           ++ +  I+
Sbjct: 204 ILIKDLIV 211


>gi|325567521|ref|ZP_08144188.1| hypothetical protein HMPREF9087_0477 [Enterococcus casseliflavus
           ATCC 12755]
 gi|325158954|gb|EGC71100.1| hypothetical protein HMPREF9087_0477 [Enterococcus casseliflavus
           ATCC 12755]
          Length = 167

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/173 (10%), Positives = 51/173 (29%), Gaps = 9/173 (5%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++   +  +  +    V    +   + +     G +V      G+K    +      
Sbjct: 1   MAKEEKVPKAEKEKKGLSMVVLLPILLIVVVGGSIGGTLVTNHFLTGEKTAAAE------ 54

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
                   + + + I      + +L           K  L + +A   K       +  +
Sbjct: 55  -TAKDSSKISSDEAIVALDEFLVNLAKEDNQEQQYMKVNLSILVADEEKSAEATKNVAVI 113

Query: 121 HQDIMAYIRTVSIKQ-ITGAQGFRYFKEDIEERVKLRSQGFV-SSVIFRTFII 171
              ++  +R       ++ A+     K+ ++E +       +   V     +I
Sbjct: 114 RDSVVNLLRQQKASGILSSAESVPNLKKALKETINQEYGSEIAKDVYVTDLVI 166


>gi|89076085|ref|ZP_01162445.1| flagellar basal body-associated protein [Photobacterium sp. SKA34]
 gi|89048237|gb|EAR53819.1| flagellar basal body-associated protein [Photobacterium sp. SKA34]
          Length = 139

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/114 (12%), Positives = 36/114 (31%), Gaps = 11/114 (9%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDI----PDKVFLETLH 121
           + +       +         I TN+ +  K   ++ L + L+  +       +     + 
Sbjct: 24  ASNQDVAAPPQITYYTLEPDITTNYVTQGKRLGYIHLQVDLMINNQTNLTNIEHHTPLIR 83

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFI 170
             I+  +      +I    G    +   ++ V         Q  V+ ++F  F+
Sbjct: 84  DAIIDIVSKQPEAKIKSLAGREEIRRACQDEVNRLLLTETRQQPVAELLFTKFL 137


>gi|256376461|ref|YP_003100121.1| flagellar basal body-associated protein FliL [Actinosynnema mirum
           DSM 43827]
 gi|255920764|gb|ACU36275.1| flagellar basal body-associated protein FliL [Actinosynnema mirum
           DSM 43827]
          Length = 149

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/154 (13%), Positives = 44/154 (28%), Gaps = 33/154 (21%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +   V    +G    W                                          
Sbjct: 26  LLIIVAVAVLALGGAGSWFFLF------------------------------RDSTPAPP 55

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALI-CKDIPDKVFLETLHQDIMAYIRTVSIKQI 136
           +   + +L  I  N       +L+L ++L   KD  + V        +++     SI ++
Sbjct: 56  EPGTVVALDSITMNLAD--GHYLKLKLSLQQTKDAAEDVDGSKALDLVVSEFSNRSIAEL 113

Query: 137 TGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFI 170
           +  +     K  ++E+V    +  V  + F  F+
Sbjct: 114 SSNEARESLKAALQEKVVSAYEDLVMGIYFTEFV 147


>gi|153939184|ref|YP_001391951.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           F str. Langeland]
 gi|152935080|gb|ABS40578.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           F str. Langeland]
          Length = 173

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 59/177 (33%), Gaps = 11/177 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS  +  +   +G   K  +   +V   +G    + G ++                   N
Sbjct: 1   MSEKNVET---KGGSLKKIIIIVLVLVIVG-AGAFGGYMLFAKNKKNANSANQMPVNNTN 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICK----DIPDKV 115
             ++   +        +   + +SL  ++ N      K +++  I +  +        + 
Sbjct: 57  VINSQQTNDGMYQQQVVVSSKTYSLDEVLVNLADEDGKRFIKAKIFIGYEEKKLSKELET 116

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               L   ++  +R+     I   +     K +I  ++  +  +G +SS+ F   I+
Sbjct: 117 KKPILRDAVIGVLRSKKAADIN-PKNIDKIKVEIINKISPMLEKGRISSIYFDDLIV 172


>gi|169827131|ref|YP_001697289.1| flagellar fliL protein [Lysinibacillus sphaericus C3-41]
 gi|168991619|gb|ACA39159.1| Flagellar fliL protein [Lysinibacillus sphaericus C3-41]
          Length = 137

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 48/157 (30%), Gaps = 25/157 (15%)

Query: 17  KLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTIS 76
            L +   ++   I I       +       G  E    + +                   
Sbjct: 1   MLTMIIILLVAVILIGVILFVLLTQFNKPTGAIEPTIDEIVEAT---------------- 44

Query: 77  LKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK--VFLETLHQDIMAYIRTVSIK 134
                   +  I TN        L L +    KD   +    +  +    +  +  +  K
Sbjct: 45  ------VEIPEITTNLADKRVVRLSLKVQTTSKDAAAELTKRVFQVQNIAIQELSEMEQK 98

Query: 135 QITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
            + G QG + F++ ++ RV  L  +G V  V F +FI
Sbjct: 99  DLEGKQGKQIFQKSLKTRVNELMQEGEVQEVYFTSFI 135


>gi|209963532|ref|YP_002296447.1| flagellar basal body-associated protein FliL [Rhodospirillum
           centenum SW]
 gi|209956998|gb|ACI97634.1| flagellar basal body-associated protein FliL [Rhodospirillum
           centenum SW]
          Length = 161

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 35/109 (32%), Gaps = 5/109 (4%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALIC---KDIPDKVFLETLHQD 123
           +                L  +  N   + K   L++ + L     K          L   
Sbjct: 52  TDEAPPPAQAGWSAFVKLPDLTVNLRPTSKVKLLKIGVTLRTAPDKAAELATLEPVLIDG 111

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-VSSVIFRTFII 171
           +  Y+R +    + G  G    +E +  R +L +    V  V+ RT I+
Sbjct: 112 MQDYLRQLDEHDLEGNAGLARLREGLLRRSRLLAAPVPVEDVLLRTMIL 160


>gi|238788327|ref|ZP_04632121.1| hypothetical protein yfred0001_7750 [Yersinia frederiksenii ATCC
           33641]
 gi|238723573|gb|EEQ15219.1| hypothetical protein yfred0001_7750 [Yersinia frederiksenii ATCC
           33641]
          Length = 178

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/183 (13%), Positives = 53/183 (28%), Gaps = 40/183 (21%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS +   ++     +  ++V   V+        G     ++                   
Sbjct: 23  MSENTFPAK----RKSSIWVILLVLIAVAATAGGGYSWWML------------------- 59

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDI----PD 113
                 +S  T    +        L+    N  +        L + + L   D       
Sbjct: 60  -----NKSKPTTTKAAPVSPVFMPLETFTVNLITPDNNLDRVLYIGLTLRLPDDTTRAKL 114

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRT 168
             +L  +   ++  +   S   ++  +G +    +I+       VK +    VS V+F  
Sbjct: 115 NDYLPEVRSRLLLLLSRQSADSLSNEEGKQRLVGEIKNVLSPPMVKGQPNQVVSDVLFTA 174

Query: 169 FII 171
           FI+
Sbjct: 175 FIL 177


>gi|312884406|ref|ZP_07744111.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309367928|gb|EFP95475.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 136

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/112 (10%), Positives = 41/112 (36%), Gaps = 11/112 (9%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETLHQD 123
              +  + +         + TNF +  K   ++++ I ++  +  D    ++    +   
Sbjct: 23  AKQEGGTPQAAYFTLEPDLTTNFYTKGKRLGYIQVRIDIMVSNQADLEIIELHQPLIRDT 82

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
           ++  +   S   IT   G    ++ + +++            ++ ++F  +I
Sbjct: 83  VIELLGKQSQDMITSLAGREDLRKTLIQQLNDILLPETGRTIIADLLFTKYI 134


>gi|312884822|ref|ZP_07744514.1| LafF [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367474|gb|EFP95034.1| LafF [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 163

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/168 (7%), Positives = 53/168 (31%), Gaps = 18/168 (10%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
            +  + +   +V+T   +    + G +           K+     ++F+  S  S  + +
Sbjct: 3   KKQMIVLFALMVFTSFIVSAATIIGSLWYL--------KHTSQDTSDFWSQSHLSFLSQE 54

Query: 74  TISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLETLHQDIMAYI 128
             +        L  ++ +     +  ++ L+IA+  +          ++  +   ++   
Sbjct: 55  KTTDIPPTFHELDKVVLSVKGKRQTHFVMLEIAIETRRPERIQSIDNYMPVVRNALLKLF 114

Query: 129 RTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFII 171
              +   +         +  +++ V            +  V+   +++
Sbjct: 115 SDKTYDDLRQDGSVDLLQNQVKQTVLLAFENTDLVEGIDDVLLTKYVV 162


>gi|303248006|ref|ZP_07334272.1| flagellar basal body-associated protein FliL [Desulfovibrio
           fructosovorans JJ]
 gi|302490563|gb|EFL50468.1| flagellar basal body-associated protein FliL [Desulfovibrio
           fructosovorans JJ]
          Length = 234

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 10/172 (5%), Positives = 53/172 (30%), Gaps = 9/172 (5%)

Query: 7   TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSV 66
            ++  + ++ KL +    V   +      +   ++       +  +              
Sbjct: 64  ETEGEKPSKKKLILIVAPVLLLLIGAA--VYFFLLRKPAPPPESAEETPPAEEAPMPPPA 121

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNF--DSSPKDWLRLDIALICKDIPDKVFLET----L 120
                 +  + K+  +  ++P +           +L +    + ++ P ++  +     +
Sbjct: 122 PVPPPPEPPAPKQEIVMPMEPFLVELTDAQGRTRFLTIRFTAVTQEKPVELEFKRNIIVV 181

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              +  Y++    + +         K+D+   +        + +++   +++
Sbjct: 182 RDAVYYYLKNKKFEFLADKNNAEVLKKDVLSVINQFIGAQPLDNLLIEDYLV 233


>gi|330964687|gb|EGH64947.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. actinidiae str. M302091]
          Length = 167

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 10/181 (5%), Positives = 51/181 (28%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +   +          +   V+   + +         ++                 +
Sbjct: 1   MAKSEEVVKDPAAKGKLKLIIIAVLALLLAVGLSVGATWFLM---------------HKS 45

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDKV 115
                  +      +    +        + NF+++ +  ++++ I +           K 
Sbjct: 46  ESAPDPAAAAAAANVKPVAVFEPMTPAFVVNFNANGRQRYMQVSITMLGRNAADMEALKA 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +  +  +++     +  + +    G    ++     ++  +Q       +  ++F  F+
Sbjct: 106 HMPLIRNNLVMLFAAIPFESLASPIGQEMLRQKATASIQEVAQKELGKTVIEQLLFTNFV 165

Query: 171 I 171
           +
Sbjct: 166 L 166


>gi|332294874|ref|YP_004436797.1| flagellar basal body-associated protein FliL [Thermodesulfobium
           narugense DSM 14796]
 gi|332177977|gb|AEE13666.1| flagellar basal body-associated protein FliL [Thermodesulfobium
           narugense DSM 14796]
          Length = 159

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/128 (9%), Positives = 33/128 (25%), Gaps = 26/128 (20%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----------------- 110
                          + LQ  + N       +L+  I L   +                 
Sbjct: 33  PKPAPKEKHEPIFFTYPLQEFVVNTRD--GRFLKASIVLELNEEIPLKSEAQAAEGKKVV 90

Query: 111 ------IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSS 163
                          L    +  + + + + +  +QG    ++ + ++   +  +  V  
Sbjct: 91  LEPKAKPILDALTPELRNAAIIILSSQTYQDLITSQGKERLRQMLFQKFNQIVGRDIVKD 150

Query: 164 VIFRTFII 171
           V F   ++
Sbjct: 151 VYFTNLVM 158


>gi|303248679|ref|ZP_07334933.1| flagellar basal body-associated protein FliL [Desulfovibrio
           fructosovorans JJ]
 gi|302489935|gb|EFL49861.1| flagellar basal body-associated protein FliL [Desulfovibrio
           fructosovorans JJ]
          Length = 131

 Score = 56.3 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/108 (12%), Positives = 36/108 (33%), Gaps = 1/108 (0%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDI 124
              +      +         +   IT+     +  L  +   I +D           + +
Sbjct: 23  DAPAQQRETFVRGGTAVYSDVDVNITDGARLARLHLAFEAQCISEDAARLAASPETREAV 82

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           + ++R  ++ +++  +G R FK  +   +        V  + F  F+I
Sbjct: 83  LLFLRERTVAELSTPRGKREFKRQLLAVMNKAVGGPRVVRIYFLQFVI 130


>gi|288553054|ref|YP_003424989.1| flagellar basal body-associated protein FliL [Bacillus pseudofirmus
           OF4]
 gi|288544214|gb|ADC48097.1| flagellar basal body-associated protein FliL [Bacillus pseudofirmus
           OF4]
          Length = 143

 Score = 56.3 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 40/109 (36%), Gaps = 3/109 (2%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI--PDKVFLETLHQD 123
               +   TI     Q +  + I TN  S+     +  I +  K      +     +   
Sbjct: 34  QPEANAEPTIDEIIAQSYVTEEITTNLLSNDFVRTQFHIHVDSKKALQEIQKRDFQVENI 93

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           I+  +       + G+ G    + +I+E++  L  +G V  V   +++I
Sbjct: 94  ILRTLSGKKSPDLAGSAGIEELEAEIKEQINQLLQEGSVVQVYTTSWVI 142


>gi|268680900|ref|YP_003305331.1| flagellar basal body-associated protein FliL [Sulfurospirillum
           deleyianum DSM 6946]
 gi|268618931|gb|ACZ13296.1| flagellar basal body-associated protein FliL [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 150

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 55/160 (34%), Gaps = 22/160 (13%)

Query: 17  KLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTIS 76
           K+ + +  V   +GIF                          +    +      T  +  
Sbjct: 8   KISLAFIAVLILLGIFMINYA------------------LNDDGKRSSYEGVSSTKSSKG 49

Query: 77  LKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKV----FLETLHQDIMAYIRTVS 132
                  SL  I  N  S     L+ DIAL  ++  +K      ++ +   ++ Y+  + 
Sbjct: 50  SSSANEVSLDTIYINIKSPKFKILKADIALEMRNAENKKAIQSDMQNVRNAVLRYLNEME 109

Query: 133 IKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA 172
            K +   +G    KE+++E +K      V  +  + FI++
Sbjct: 110 AKGLETNEGKERLKEELKEFLKESFGYEVEQIYLKNFILS 149


>gi|16078693|ref|NP_389512.1| flagellar basal body-associated protein FliL [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221309508|ref|ZP_03591355.1| flagellar basal body-associated protein FliL [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221313832|ref|ZP_03595637.1| flagellar basal body-associated protein FliL [Bacillus subtilis
           subsp. subtilis str. NCIB 3610]
 gi|221318755|ref|ZP_03600049.1| flagellar basal body-associated protein FliL [Bacillus subtilis
           subsp. subtilis str. JH642]
 gi|221323027|ref|ZP_03604321.1| flagellar basal body-associated protein FliL [Bacillus subtilis
           subsp. subtilis str. SMY]
 gi|321315397|ref|YP_004207684.1| flagellar basal body-associated protein FliL [Bacillus subtilis
           BSn5]
 gi|120341|sp|P23452|FLIL_BACSU RecName: Full=Flagellar protein FliL
 gi|39913|emb|CAA39529.1| unnamed protein product [Bacillus subtilis subsp. subtilis str.
           168]
 gi|2634002|emb|CAB13503.1| flagellar basal-body associated protein [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|291484183|dbj|BAI85258.1| flagellar basal body-associated protein FliL [Bacillus subtilis
           subsp. natto BEST195]
 gi|320021671|gb|ADV96657.1| flagellar basal body-associated protein FliL [Bacillus subtilis
           BSn5]
          Length = 140

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/110 (15%), Positives = 43/110 (39%), Gaps = 5/110 (4%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----IPDKVFLETL 120
             +S  +    S+ ++   S+       +    + +RL I L           +     +
Sbjct: 28  GGKSEKSEAKKSIDEIVASSVDVEEITTNLKSDNIIRLAIKLETDSDKSKEELEKRDFQV 87

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
              +++ +   +  QI G +G   FK+++++++     +G V  V   +F
Sbjct: 88  KDAVISLLADTNADQIEGDKGKETFKKELKDKINSYLQEGKVEKVYITSF 137


>gi|94501663|ref|ZP_01308179.1| flagellar protein [Oceanobacter sp. RED65]
 gi|94426239|gb|EAT11231.1| flagellar protein [Oceanobacter sp. RED65]
          Length = 134

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/102 (12%), Positives = 34/102 (33%), Gaps = 12/102 (11%)

Query: 81  QIFSLQPIITNFDSSPK---DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSI 133
            +      + N+  +      ++R D+AL                 +   ++  +   + 
Sbjct: 30  YVHLQPAFVLNYGENSSGKLKYIRTDVALRVTGAEAAGKVNHHQAYIRNQLVLLLSQQTD 89

Query: 134 KQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
           + +  A G    ++   E VK        + +V  + F+ F+
Sbjct: 90  ETVNTATGREELRQVALEEVKALLSELEGKPYVDDLYFQNFV 131


>gi|104782812|ref|YP_609310.1| flagellar basal body-associated protein FliL [Pseudomonas
           entomophila L48]
 gi|95111799|emb|CAK16523.1| flagellar protein FliL [Pseudomonas entomophila L48]
          Length = 165

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/182 (8%), Positives = 50/182 (27%), Gaps = 29/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  D         + KL +   +                M                  +
Sbjct: 1   MAKSDAVKDPATKGKLKLILLLVLALLLAVGLSVGATWFFM------------------H 42

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKV 115
             +++         +    +        + NF+ + +  ++++ I +  +        KV
Sbjct: 43  KSESAPAVDPAQANVKAAAIYEPLAPAFVVNFNQNGRQRYMQVSITMQGRSQADLEALKV 102

Query: 116 FLETLHQDIMAYIRTVSIKQI-TGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTF 169
            +  +  +++          + +   G    ++     V+        +  V  ++F  F
Sbjct: 103 HMPVIRNNLVMMFSGQGFDTLASSPVGQEMLRQKATAVVQEVAQKEVGRPVVDQLLFTNF 162

Query: 170 II 171
           ++
Sbjct: 163 VL 164


>gi|330876025|gb|EGH10174.1| flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. morsprunorum str. M302280PT]
          Length = 167

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 11/181 (6%), Positives = 52/181 (28%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +   +          +   V+   + +         ++                 +
Sbjct: 1   MAKSEEVVKDPAAKGKLKLIIIAVLALLLAVGLSVGATWFLM---------------HKS 45

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL----ICKDIPDKV 115
                  +      +    +        + NF+++ +  ++++ I +           KV
Sbjct: 46  ESAPDPAAAAAAANVKPVAVFEPMTPAFVVNFNANGRQRYMQVSITMLGRNAADMEALKV 105

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +  +  +++     +  + +    G    ++     ++  +Q       +  ++F  F+
Sbjct: 106 HMPLIRNNLVMLFAAIPFESLASPIGQEMLRQKATASIQEVAQKELGKTVIEQLLFTNFV 165

Query: 171 I 171
           +
Sbjct: 166 L 166


>gi|212639556|ref|YP_002316076.1| flagellar basal body-associated protein FliL [Anoxybacillus
           flavithermus WK1]
 gi|212561036|gb|ACJ34091.1| Flagellar basal body-associated protein FliL [Anoxybacillus
           flavithermus WK1]
          Length = 148

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 37/106 (34%), Gaps = 3/106 (2%)

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIAL--ICKDIPDKVFLETLHQDIMA 126
                T+       F +  I+TN        +   I           +     +   I+ 
Sbjct: 42  EPKEPTVDEIVASSFDVPEIMTNLMDGSFIKIAFKIQTDSEKAKEEAEKRDFQIKNIIIE 101

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            +  ++ +Q  G QG    ++ + ER+  L  +G V  +   +FI+
Sbjct: 102 ELSEMTAEQFKGKQGKLLLEKKLRERINELMQEGKVEKIYITSFIL 147


>gi|170760109|ref|YP_001787971.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           A3 str. Loch Maree]
 gi|169407098|gb|ACA55509.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           A3 str. Loch Maree]
          Length = 173

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 59/177 (33%), Gaps = 11/177 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS  +  +   +G   K  +   +V   +G    + G ++                   N
Sbjct: 1   MSEKNVET---KGGSLKKIIIIVLVLVIVG-AGAFGGYMLFAKNKKNANGANQMPVNNTN 56

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPKDWLRLDIALICK----DIPDKV 115
             ++   +        +   + +SL  ++ N      K +++  I +  +        + 
Sbjct: 57  VINSQQTNDGMYQQQVVVSSKTYSLDEVLVNLADEDGKRFIKAKIFIGYEEKKLSKELET 116

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               L   ++  +R+     I   +     K +I  ++  +  +G +SS+ F   I+
Sbjct: 117 KKPILRDAVIGVLRSKKAADIN-PKNIDKIKVEIINKISPMLEKGRISSIYFDDLIV 172


>gi|89056672|ref|YP_512123.1| flagellar basal body-associated protein FliL [Jannaschia sp. CCS1]
 gi|88866221|gb|ABD57098.1| flagellar basal body-associated protein FliL [Jannaschia sp. CCS1]
          Length = 168

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 11/124 (8%), Positives = 38/124 (30%), Gaps = 4/124 (3%)

Query: 52  KYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD- 110
             +  +       +          ++    +     +IT         L    +L     
Sbjct: 44  APESTMETPVETAAEHDDDATHMDAVDVAFLELETLVITLGAEESNRNLIFSASLEIAPQ 103

Query: 111 --IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFR 167
                      +   + +Y+R ++I +++        +  +  R+++    G V +++  
Sbjct: 104 YLDEVTQLSPRVLDVLNSYLRVIAISELSEPTSLARLRSQMLRRIQVVTGTGRVQNLLVT 163

Query: 168 TFII 171
            F++
Sbjct: 164 QFLV 167


>gi|121596088|ref|YP_987984.1| flagellar basal body-associated protein FliL [Acidovorax sp. JS42]
 gi|120608168|gb|ABM43908.1| flagellar basal body-associated protein FliL [Acidovorax sp. JS42]
          Length = 190

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 10/100 (10%), Positives = 27/100 (27%), Gaps = 5/100 (5%)

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKD----IPD 113
               +                     +  ++ N        + ++ I L   D       
Sbjct: 41  AAEDEEGGGRAVAQAGTPKTPPTFLPMDNMVVNLADPGGDRFAQVGITLELADGKTADQV 100

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV 153
           K ++ T+   ++  +   +  ++   +G      DI   V
Sbjct: 101 KAYMPTIRSGVLLPLSQRTTDELLTREGKEKLAVDIRREV 140


>gi|21959350|gb|AAM86039.1|AE013852_1 flagellar biosynthesis [Yersinia pestis KIM 10]
          Length = 189

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/174 (12%), Positives = 46/174 (26%), Gaps = 42/174 (24%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
             +  +++   V+        G     ++                         +S  T 
Sbjct: 42  KRKSSIWLILLVLVAIAASAGGGYSWWLL------------------------HKSKPTN 77

Query: 73  DTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDI----PDKVFLETLHQDIM 125
             I         L+    N  +        L + + L   D         +L  +   ++
Sbjct: 78  TQIVAAIPVFMPLETFTVNLITPDNNLDRVLYIGLTLRLPDDTTRTKLNDYLPEVRSRLL 137

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVS--------SVIFRTFII 171
             +   S   ++  +G +    DI+    + S   V          V+F  FI+
Sbjct: 138 LLLSRQSADSLSNEEGKQRLVNDIK---NILSPPMVKGQPNQVISDVLFTAFIL 188


>gi|91794981|ref|YP_564632.1| flagellar basal body-associated protein FliL [Shewanella
           denitrificans OS217]
 gi|91716983|gb|ABE56909.1| flagellar basal body-associated protein FliL [Shewanella
           denitrificans OS217]
          Length = 151

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/110 (13%), Positives = 37/110 (33%), Gaps = 10/110 (9%)

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK----VFLETLHQDIMA 126
            +   +   + + L   I +        +L L++AL   +   K         +   +M 
Sbjct: 41  AEEPVVPVAKFYPLDKFIISIPGDKYPHYLLLELALKSNNPKLKSVLDEADPLIRNSLMK 100

Query: 127 YIRTVSIKQITGAQGFRYFKED-IEERVKLRSQGF----VSSVIFRTFII 171
                S +Q+   +     + + +   VK+  +      +  V+F   +I
Sbjct: 101 MFSRKSFEQLNSTEQLDSLQNEALMHIVKVLVEHKFPSDIDEVLFTRMVI 150


>gi|311068152|ref|YP_003973075.1| flagellar basal body-associated protein FliL [Bacillus atrophaeus
           1942]
 gi|310868669|gb|ADP32144.1| flagellar basal body-associated protein FliL [Bacillus atrophaeus
           1942]
          Length = 140

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 38/106 (35%), Gaps = 3/106 (2%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSS--PKDWLRLDIALICKDIPDKVFLETLHQDI 124
                  TI         ++ I TN  S    +  ++L+          +     +   I
Sbjct: 32  GKSDEEPTIDEIVESSVDIEEITTNLKSDHIIRIAIKLETDSKKAKEELEKRDFQVKDAI 91

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
           +  +   +  +I G +G   FK +++++V     +G V  V   +F
Sbjct: 92  ITLLADTNADKIEGDKGKEAFKRELKDKVNSYLQEGKVEKVYITSF 137


>gi|306820126|ref|ZP_07453774.1| flagellar basal body-associated protein FliL [Eubacterium yurii
           subsp. margaretiae ATCC 43715]
 gi|304551904|gb|EFM39847.1| flagellar basal body-associated protein FliL [Eubacterium yurii
           subsp. margaretiae ATCC 43715]
          Length = 146

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/110 (16%), Positives = 39/110 (35%), Gaps = 6/110 (5%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKVFLETLHQDI 124
             +       +  Q   +  I T    + + +   + L++         K  +  +   I
Sbjct: 36  PQNAPKKEKKEATQNIDVGDITTQIGQAGRFYKGFVVLEVKGKKTPETIKAKMPQIKDSI 95

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF---VSSVIFRTFII 171
           +  I  ++  ++T  +G    K+ I+  V    +     V SV+F   II
Sbjct: 96  ITSISAMTANEMTSPEGMSKLKDKIKNDVNAIIESETQDVVSVLFTENII 145


>gi|142921|gb|AAA22445.1| ORF-A, 3' end [Bacillus subtilis]
          Length = 84

 Score = 55.6 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 11/71 (15%), Positives = 31/71 (43%), Gaps = 1/71 (1%)

Query: 100 LRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQ 158
           ++L+          +     +   +++ +   +  QI G +G   FK+++++++     +
Sbjct: 11  IKLETDSDKSKEELEKRDFQVKDAVISLLADTNADQIEGDKGKETFKKELKDKINSYLQE 70

Query: 159 GFVSSVIFRTF 169
           G V  V   +F
Sbjct: 71  GKVEKVYITSF 81


>gi|308047880|ref|YP_003911446.1| flagellar basal body-associated protein FliL [Ferrimonas balearica
           DSM 9799]
 gi|307630070|gb|ADN74372.1| flagellar basal body-associated protein FliL [Ferrimonas balearica
           DSM 9799]
          Length = 129

 Score = 55.6 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 44/120 (36%), Gaps = 11/120 (9%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIP----DKV 115
             ++V +   G+              I+TN+ S  K   ++R+ + L+ KD       + 
Sbjct: 8   AGSAVAAQEGGEIAHDNYGYYGLEPEIVTNYVSPRKRLGYVRVSVELMLKDADTVEMVEH 67

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
               +   I+  +     ++I    G    + D  E V         Q  V++++F  ++
Sbjct: 68  HAPLIRATIVEILGQQPEEKIKSLSGREEIRRDCFETVNNLLAKEVGQPLVANLLFTRYL 127


>gi|331673457|ref|ZP_08374225.1| flagellar basal body-associated protein FliL [Escherichia coli
           TA280]
 gi|331069655|gb|EGI41042.1| flagellar basal body-associated protein FliL [Escherichia coli
           TA280]
          Length = 104

 Score = 55.6 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/103 (14%), Positives = 34/103 (33%), Gaps = 10/103 (9%)

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSI 133
                ++L     N   +    L + I L  KD         +L  +   ++        
Sbjct: 2   PSPVFYALDTFTVNLGDA-DRVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDA 60

Query: 134 KQITGAQGFRYFKEDIEERVK---LRSQGF--VSSVIFRTFII 171
             +   +G +    +I+  +    +  Q    V+ V++  FI+
Sbjct: 61  AVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFIL 103


>gi|239907328|ref|YP_002954069.1| putative flagellar FliL protein [Desulfovibrio magneticus RS-1]
 gi|239797194|dbj|BAH76183.1| putative flagellar FliL protein [Desulfovibrio magneticus RS-1]
          Length = 151

 Score = 55.6 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/93 (15%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query: 82  IFSLQPIITNFDSSPK-DWLRLDIALICKDI--PDKVFLETLHQDIMAYIRTVSIKQITG 138
           + ++ P+  N  S     ++RL++ + C D    ++++     +D++  +     + +  
Sbjct: 57  VITIGPMTVNILSKKGYRFMRLEMIVECVDDPSAERLYKADAREDLVLMLSNKLAEDLLT 116

Query: 139 AQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFI 170
             G    ++++ +   K    G V ++ F  F+
Sbjct: 117 NSGKMILRKELMDLFTKYAGPGKVKNIYFGEFV 149


>gi|89895729|ref|YP_519216.1| hypothetical protein DSY2983 [Desulfitobacterium hafniense Y51]
 gi|89335177|dbj|BAE84772.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 118

 Score = 55.6 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 14/117 (11%), Positives = 39/117 (33%), Gaps = 7/117 (5%)

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKV-- 115
               + +   S      I  ++  + S+     N       +L+  IAL   +   +   
Sbjct: 3   AQKLFFSDSPSPTGQAVIKKEEGPVISVGEFTVNL--QGGAFLKTSIALEGMNEKSEAVL 60

Query: 116 --FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFI 170
                 +   I   + + ++K +   +     K ++  ++   +   V  + F +F+
Sbjct: 61  TAKDAFIKDRINTVLSSKTLKDMQ-PEVREDLKHELITQLNEVTGNQVQGIFFLSFV 116


>gi|238785485|ref|ZP_04629468.1| hypothetical protein yberc0001_18160 [Yersinia bercovieri ATCC
           43970]
 gi|238713587|gb|EEQ05616.1| hypothetical protein yberc0001_18160 [Yersinia bercovieri ATCC
           43970]
          Length = 156

 Score = 55.6 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/183 (13%), Positives = 53/183 (28%), Gaps = 40/183 (21%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS +   ++     +  ++V   V+        G     ++                   
Sbjct: 1   MSENTFPAK----RKSSIWVILLVLIAVAASAGGGYSWWLL------------------- 37

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDI----PD 113
                 +S  T    +        L+    N  +        L + + L   D       
Sbjct: 38  -----NKSKPTTAKAAPVIPVFMPLETFTVNLITPDNNLDRVLYIGLTLRLPDDTTRTKL 92

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRT 168
             +L  +   ++  +   S   ++   G +   ++I+       VK +    VS V+F  
Sbjct: 93  NDYLPEVRSRLLLLLSRQSADSLSNEAGKQRLVDEIKNVLSPPMVKGQPNQVVSDVLFTA 152

Query: 169 FII 171
           FI+
Sbjct: 153 FIL 155


>gi|27364578|ref|NP_760106.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           vulnificus CMCP6]
 gi|37678303|ref|NP_932912.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           vulnificus YJ016]
 gi|320154981|ref|YP_004187360.1| flagellar biosynthesis protein FliL [Vibrio vulnificus MO6-24/O]
 gi|27360697|gb|AAO09633.1| Flagellar biosynthesis protein fliL [Vibrio vulnificus CMCP6]
 gi|37197042|dbj|BAC92883.1| flagellar basal body-associated protein [Vibrio vulnificus YJ016]
 gi|319930293|gb|ADV85157.1| flagellar biosynthesis protein FliL [Vibrio vulnificus MO6-24/O]
          Length = 136

 Score = 55.6 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 10/112 (8%), Positives = 38/112 (33%), Gaps = 11/112 (9%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETLHQD 123
              +    +         + TNF +  K   ++++ I ++     D    +     +   
Sbjct: 23  AEEEQTGPQLAYFTLEPDLTTNFYTKGKKLGYIQVRIDIMVMSNADLALVEHHQPLIRDA 82

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
           ++  +   S   +    G    ++ + E++         +  ++ ++F  ++
Sbjct: 83  VVELLGQQSEDTVKSLAGREDLRKHLVEKLNEILLPETGKTVIADLLFTKYL 134


>gi|114561237|ref|YP_748750.1| flagellar basal body-associated protein FliL-like protein
           [Shewanella frigidimarina NCIMB 400]
 gi|114332530|gb|ABI69912.1| flagellar basal body-associated protein FliL [Shewanella
           frigidimarina NCIMB 400]
          Length = 133

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/112 (15%), Positives = 41/112 (36%), Gaps = 11/112 (9%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETLHQD 123
              +              I+TN+ S+ K   ++++ + L+ KD  D    +     L   
Sbjct: 20  AADEPAVEDYAYYGFEPDIVTNYISNRKKLGFVKISVELMVKDPNDLMSLEHHDPLLRSA 79

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
           I+  +   S +++    G    + +  E V    +       V +++F  ++
Sbjct: 80  IVEILGNQSEEKVKSLSGREEIRRECYETVNRLMEQEVGRSIVVNLLFTKYL 131


>gi|145598588|ref|YP_001162664.1| flagellar basal body-associated protein FliL [Yersinia pestis
           Pestoides F]
 gi|165926006|ref|ZP_02221838.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165938710|ref|ZP_02227265.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166010945|ref|ZP_02231843.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166210501|ref|ZP_02236536.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167401113|ref|ZP_02306616.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167420081|ref|ZP_02311834.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167425840|ref|ZP_02317593.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|167467513|ref|ZP_02332217.1| flagellar basal body-associated protein FliL [Yersinia pestis FV-1]
 gi|270486622|ref|ZP_06203696.1| flagellar basal body-associated protein FliL [Yersinia pestis KIM
           D27]
 gi|294504009|ref|YP_003568071.1| flagellar protein FliL [Yersinia pestis Z176003]
 gi|108776108|gb|ABG18627.1| flagellar protein FliL [Yersinia pestis Nepal516]
 gi|108779109|gb|ABG13167.1| flagellar protein FliL [Yersinia pestis Antiqua]
 gi|145210284|gb|ABP39691.1| flagellar protein FliL [Yersinia pestis Pestoides F]
 gi|165913324|gb|EDR31946.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165922210|gb|EDR39387.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165990289|gb|EDR42590.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166207681|gb|EDR52161.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166961776|gb|EDR57797.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167049502|gb|EDR60910.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167055239|gb|EDR65036.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|262361805|gb|ACY58526.1| flagellar protein FliL [Yersinia pestis D106004]
 gi|262366059|gb|ACY62616.1| flagellar protein FliL [Yersinia pestis D182038]
 gi|270335126|gb|EFA45903.1| flagellar basal body-associated protein FliL [Yersinia pestis KIM
           D27]
 gi|294354468|gb|ADE64809.1| flagellar protein FliL [Yersinia pestis Z176003]
          Length = 187

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/174 (12%), Positives = 46/174 (26%), Gaps = 42/174 (24%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
             +  +++   V+        G     ++                         +S  T 
Sbjct: 40  KRKSSIWLILLVLVAIAASAGGGYSWWLL------------------------HKSKPTN 75

Query: 73  DTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDI----PDKVFLETLHQDIM 125
             I         L+    N  +        L + + L   D         +L  +   ++
Sbjct: 76  TQIVAAIPVFMPLETFTVNLITPDNNLDRVLYIGLTLRLPDDTTRTKLNDYLPEVRSRLL 135

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVS--------SVIFRTFII 171
             +   S   ++  +G +    DI+    + S   V          V+F  FI+
Sbjct: 136 LLLSRQSADSLSNEEGKQRLVNDIK---NILSPPMVKGQPNQVISDVLFTAFIL 186


>gi|89098633|ref|ZP_01171515.1| flagellar basal body-associated protein FliL [Bacillus sp. NRRL
           B-14911]
 gi|89086595|gb|EAR65714.1| flagellar basal body-associated protein FliL [Bacillus sp. NRRL
           B-14911]
          Length = 142

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/106 (15%), Positives = 33/106 (31%), Gaps = 3/106 (2%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLETLHQD 123
             +     +I         +  I TN  S     +   +    K      +     +   
Sbjct: 33  DGAEEKEPSIEEVLEASVDINQITTNLASDDFIRISFKVETDSKKAKEELEKRDFQVKNI 92

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRT 168
           I+  +     + + G +G    +ED++ ++  L   G V SV    
Sbjct: 93  IIQELSEKKAEDLQGKEGKISLQEDLKSKINSLMQNGKVESVYITE 138


>gi|300717237|ref|YP_003742040.1| flagellar basal body protein [Erwinia billingiae Eb661]
 gi|299063073|emb|CAX60193.1| Flagellar basal body protein [Erwinia billingiae Eb661]
          Length = 159

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 50/177 (28%), Gaps = 32/177 (18%)

Query: 7   TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSV 66
           T +  +  + KL +   ++ T +           M+                     +  
Sbjct: 2   TDKKAKSGKRKLLIPLLLLVTVVACSVAGYMVWHMM--------------------KSPA 41

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIP----DKVFLET 119
            S              ++L     N  +    P   L +   L   D         +L  
Sbjct: 42  DSAKAEKPAVPVAPVFYALDTFTVNLINPDNDPDRVLYVGFTLRLPDEDTRRRINDYLPE 101

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
           +   ++  +       ++  QG +   + I+       V+   Q  V+ V+F  FI+
Sbjct: 102 VRSRLLLLLSRQDASALSSEQGKQELMKQIKAVLAPPLVQGEPQQVVNDVLFTAFIL 158


>gi|310659032|ref|YP_003936753.1| flagellar basal body-associated protein flil [Clostridium
           sticklandii DSM 519]
 gi|308825810|emb|CBH21848.1| putative Flagellar basal body-associated protein FliL precursor
           [Clostridium sticklandii]
          Length = 141

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/110 (17%), Positives = 42/110 (38%), Gaps = 6/110 (5%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLET----LHQ 122
               +  +        + L    TN  SS   + +  I +   +      +E     +  
Sbjct: 32  APAPSDSSPKKIDTYKYDLGDFSTNIGSSG-RYFKGKIVIETTNKKTPKLIEQNVEPIRD 90

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
            I++ + +  +K +    G    K+DI ++V ++     +S+V F  +II
Sbjct: 91  YILSVLISQDVKTMMSESGIENIKKDITKKVSEIIGTNDISNVYFTDYII 140


>gi|294143029|ref|YP_003559007.1| flagellar protein FliL [Shewanella violacea DSS12]
 gi|293329498|dbj|BAJ04229.1| flagellar protein FliL, putative [Shewanella violacea DSS12]
          Length = 140

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/112 (16%), Positives = 42/112 (37%), Gaps = 11/112 (9%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETLHQD 123
              + I            +ITN+ S+ K   ++R+ I L+ KD  D    +     L   
Sbjct: 27  AADEKIVDNYAYYGFEPELITNYISNGKKLGFVRIGIELMVKDPEDLLALEHHDPLLRAA 86

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
           I+  + + +  ++    G    + +  + V         +  V +++F  ++
Sbjct: 87  ILEIMGSQTADKVKSLTGREEIRRECYDTVNRLIEQEVGRPIVVNLLFTKYL 138


>gi|289209496|ref|YP_003461562.1| flagellar basal body-associated protein FliL [Thioalkalivibrio sp.
           K90mix]
 gi|288945127|gb|ADC72826.1| flagellar basal body-associated protein FliL [Thioalkalivibrio sp.
           K90mix]
          Length = 132

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/99 (13%), Positives = 38/99 (38%), Gaps = 10/99 (10%)

Query: 82  IFSLQPIITNFDSSPKDW-----LRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQI 136
             +L+P++ N +SS +       ++L+ A +      +  +  +   ++  +   S   +
Sbjct: 32  YVTLEPVVVNMESSDRARYLQAKIQLEAAEMEDAREIRGHIPAVRDRLIRILGGRSPDSL 91

Query: 137 TGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
            G+      +++  E +            + ++ F  FI
Sbjct: 92  RGSAAREDLRQEAMEELNELLEELTGAPRIEALYFSDFI 130


>gi|7025354|gb|AAF35845.1|AF220002_2 unknown [Rhodospirillum centenum]
          Length = 161

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 34/109 (31%), Gaps = 5/109 (4%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALIC---KDIPDKVFLETLHQD 123
           +                L  +  N   + K   L++ + L     K          L   
Sbjct: 52  TDEAPPPAQAGWSAFVKLPDLTVNLRPTSKVKLLKIGVTLRTAPDKAAELATLEPVLIDG 111

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-VSSVIFRTFII 171
           +  Y R +    + G  G    +E +  R +L +    V  V+ RT I+
Sbjct: 112 MQDYFRQLDEHDLEGNAGLARLREGLLRRSRLLAAPVPVEDVLLRTMIL 160


>gi|238755313|ref|ZP_04616656.1| hypothetical protein yruck0001_10690 [Yersinia ruckeri ATCC 29473]
 gi|238706449|gb|EEP98823.1| hypothetical protein yruck0001_10690 [Yersinia ruckeri ATCC 29473]
          Length = 156

 Score = 55.2 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 47/171 (27%), Gaps = 36/171 (21%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
             +  ++V   V+        G     ++                          S    
Sbjct: 9   KRKSSIWVILLVLIAVASAAGGGYSWWML------------------------HNSKPIN 44

Query: 73  DTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDI----PDKVFLETLHQDIM 125
              +       +L     N  +        L + + L   D         +L  +   ++
Sbjct: 45  AKPAPVAPVFMALDTFTVNLITPDNNLDRVLYIGLTLRLPDENTRRALNDYLPEVRSRLL 104

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
             +   + + +T  +G +   + I+       VK +    +S V+F  FI+
Sbjct: 105 LLLSRQTAESLTNEEGKQLLIKQIKTVLSPAMVKGQPNQVISDVLFTAFIL 155


>gi|157692310|ref|YP_001486772.1| flagellar basal body-associated protein FliL [Bacillus pumilus
           SAFR-032]
 gi|157681068|gb|ABV62212.1| flagellar protein FliL [Bacillus pumilus SAFR-032]
          Length = 142

 Score = 55.2 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/111 (14%), Positives = 34/111 (30%), Gaps = 4/111 (3%)

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKVFLET 119
            +         T          +  IITN  S        L ++          +     
Sbjct: 29  GSDEAKAEKEPTADEVVKASVEIPEIITNLKSEGNAVKLVLNIETDSEKAKEELEKRSFQ 88

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTF 169
           +   ++  +   +  ++ G +G  +FK  ++ +V      G V  V   +F
Sbjct: 89  VKDAVIDILSDTNADELDGKKGREHFKTLVKNKVNNYLQDGKVKEVYITSF 139


>gi|301166583|emb|CBW26159.1| putative flagellar transmembrane protein [Bacteriovorax marinus SJ]
          Length = 156

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/166 (13%), Positives = 54/166 (32%), Gaps = 20/166 (12%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
           GN+    +   + +    +  G      M+      ++    + +      +  +     
Sbjct: 3   GNKLADNIILILSFLATAVCVGVFVFTEMI-----YQKPLPSEQVELQRLMSDNKKKAFP 57

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALIC------KDIPDKVFLETLHQDIMA 126
                     F L  +I N +S       L +           D   + +   ++  I+ 
Sbjct: 58  AP--------FKLDSLIINLNSRKTRLRFLSVETQLVPFNHDSDDKFESYRSMINDSIID 109

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               ++ +++    G    +E I++ V  L  + FV  V+F  F+I
Sbjct: 110 IAGRMTAEELNSISGKILLEERIKKSVNKLMGKQFVKGVLFTKFVI 155


>gi|86148639|ref|ZP_01066920.1| flagellar basal body-associated protein [Vibrio sp. MED222]
 gi|218710912|ref|YP_002418533.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           splendidus LGP32]
 gi|85833558|gb|EAQ51735.1| flagellar basal body-associated protein [Vibrio sp. MED222]
 gi|218323931|emb|CAV20292.1| putative flagellar protein FliL [Vibrio splendidus LGP32]
          Length = 135

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 10/115 (8%), Positives = 39/115 (33%), Gaps = 11/115 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLETL 120
            S    +  + K         + TNF +  K   ++++ + ++  +       +     +
Sbjct: 19  ASSFAEEESTPKLAYFTLEPDLTTNFYTKGKKLGYIQVRLDIMVANSNDLEAIEHHQPLI 78

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
              ++  +   + + I    G    ++ + E +            ++ ++F  ++
Sbjct: 79  RDAVIELLGKQNEETIKSLSGREDLRKSLVEHLNKILLPETGKTLIADLLFTKYL 133


>gi|238794010|ref|ZP_04637628.1| hypothetical protein yinte0001_21260 [Yersinia intermedia ATCC
           29909]
 gi|238726642|gb|EEQ18178.1| hypothetical protein yinte0001_21260 [Yersinia intermedia ATCC
           29909]
          Length = 156

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/183 (13%), Positives = 54/183 (29%), Gaps = 40/183 (21%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS ++  ++     +  ++V   V+        G     V+                   
Sbjct: 1   MSDNNFPAK----RKSSIWVILLVLIAVAASAGGGYSWWVL------------------- 37

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDIPDKV-- 115
                 +S  T             L+    N  +        L + + L   D   +   
Sbjct: 38  -----HKSKPTTAKAVPVIPVFMPLETFTVNLITPDNNLDRVLYIGLTLRLPDDATRAKL 92

Query: 116 --FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRT 168
             +L  +   ++  +   S   ++  +G +    +I+       VK +    VS V+F  
Sbjct: 93  NDYLPEVRSRLLLLLSRQSADSLSNEEGKQRLVGEIKNVLSPPMVKGQPNQVVSDVLFTA 152

Query: 169 FII 171
           FI+
Sbjct: 153 FIL 155


>gi|15615010|ref|NP_243313.1| flagellar basal body-associated protein FliL [Bacillus halodurans
           C-125]
 gi|10175067|dbj|BAB06166.1| flagellar protein required for flagellar formation [Bacillus
           halodurans C-125]
          Length = 143

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/157 (13%), Positives = 50/157 (31%), Gaps = 26/157 (16%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           + +   +V T +G+                                N+        TI  
Sbjct: 9   IMLIILIVLTLVGVAVLIFVNYF-----------------------NNEDEQDREPTIDE 45

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI--PDKVFLETLHQDIMAYIRTVSIKQ 135
              Q +  + I TN  S+     R  I +  ++     +     ++  I+  +  +   Q
Sbjct: 46  IIAQSYETEEITTNLLSNDFVRARFLIHVDNRNALQEVQKRDFQVNNIIIRSLAGMDASQ 105

Query: 136 ITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
           ++GA G    +  +++ +     +G V  +    ++I
Sbjct: 106 LSGADGIEKLEAQLQDDINALMQEGSVVKIYTTEWVI 142


>gi|330957122|gb|EGH57382.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 135

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 14/121 (11%), Positives = 39/121 (32%), Gaps = 12/121 (9%)

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKV 115
               +     +    K   +    P + N+       LR       L +     +   K 
Sbjct: 14  PAMAQEEAKEEGGPPKASYVSLTPPFVGNYALDGGPKLRVYKADIALRVTGADAEAAVKR 73

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +   ++A     ++  ++ A+     +++  ++V+        +  V  ++F  FI
Sbjct: 74  HDALIRNQLVALFTQQTVDSMSSAEAKENIRQEALKQVQRVMNDEEGKPVVEDLLFNNFI 133

Query: 171 I 171
           +
Sbjct: 134 V 134


>gi|323498066|ref|ZP_08103072.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           sinaloensis DSM 21326]
 gi|323316874|gb|EGA69879.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           sinaloensis DSM 21326]
          Length = 135

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 11/114 (9%), Positives = 38/114 (33%), Gaps = 11/114 (9%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETLH 121
                +    +         + TNF +      ++++ I ++     D    ++    + 
Sbjct: 20  PASAEEEAVPQLAYFTLEPDLTTNFYTKGNKLGYIQVRIDIMVAAEADLAVIELHQPLIR 79

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
             ++  +   S   IT   G    ++ + E++            ++ ++F  ++
Sbjct: 80  DAVIELLGQQSEDTITSLAGREDLRKTLVEQLNSILLPETGKTIIADLLFTKYL 133


>gi|149182514|ref|ZP_01860987.1| flagellar basal body-associated protein FliL [Bacillus sp. SG-1]
 gi|148849774|gb|EDL63951.1| flagellar basal body-associated protein FliL [Bacillus sp. SG-1]
          Length = 140

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/160 (14%), Positives = 51/160 (31%), Gaps = 25/160 (15%)

Query: 15  QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDT 74
           ++KL     ++   I +       +V+ F     KE    + I  +              
Sbjct: 2   KNKLLTISLILLVTITLVGVLALIVVLKFNEEEVKEPSIDEVIEAS-------------- 47

Query: 75  ISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLETLHQDIMAYIRTVS 132
                     +  I TN  S     +   +    K      +     +   I+  +  + 
Sbjct: 48  --------VDVPEITTNLLSGDYIRISFKVQTDSKKAKEELEKRDFQVKNIIIEELSEMK 99

Query: 133 IKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
             Q+ G +G +  +  I+++   L  +G V  V   +++I
Sbjct: 100 SDQLQGKEGKQELETTIKDKANSLMQEGKVEKVYITSYMI 139


>gi|45441386|ref|NP_992925.1| flagellar basal body-associated protein FliL [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51596033|ref|YP_070224.1| flagellar basal body-associated protein FliL [Yersinia
           pseudotuberculosis IP 32953]
 gi|149366228|ref|ZP_01888263.1| flagellar protein FliL [Yersinia pestis CA88-4125]
 gi|153947506|ref|YP_001401267.1| flagellar basal body-associated protein FliL [Yersinia
           pseudotuberculosis IP 31758]
 gi|161484784|ref|NP_669788.2| flagellar basal body-associated protein FliL [Yersinia pestis KIM
           10]
 gi|162100176|ref|YP_651112.2| flagellar basal body-associated protein FliL [Yersinia pestis
           Antiqua]
 gi|162139436|ref|YP_648227.2| flagellar basal body-associated protein FliL [Yersinia pestis
           Nepal516]
 gi|170024623|ref|YP_001721128.1| flagellar basal body-associated protein FliL [Yersinia
           pseudotuberculosis YPIII]
 gi|186895138|ref|YP_001872250.1| flagellar basal body-associated protein FliL [Yersinia
           pseudotuberculosis PB1/+]
 gi|218928945|ref|YP_002346820.1| flagellar basal body-associated protein FliL [Yersinia pestis CO92]
 gi|229896269|ref|ZP_04511439.1| flagellar protein FliL [Yersinia pestis Pestoides A]
 gi|229897206|ref|ZP_04512362.1| flagellar protein FliL [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229897933|ref|ZP_04513084.1| flagellar protein FliL [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229902836|ref|ZP_04517953.1| flagellar protein FliL [Yersinia pestis Nepal516]
 gi|45436246|gb|AAS61802.1| flagellar protein FliL [Yersinia pestis biovar Microtus str. 91001]
 gi|51589315|emb|CAH20936.1| flagellar protein FliL [Yersinia pseudotuberculosis IP 32953]
 gi|115347556|emb|CAL20465.1| flagellar protein FliL [Yersinia pestis CO92]
 gi|149292641|gb|EDM42715.1| flagellar protein FliL [Yersinia pestis CA88-4125]
 gi|152959001|gb|ABS46462.1| flagellar basal body-associated protein FliL [Yersinia
           pseudotuberculosis IP 31758]
 gi|169751157|gb|ACA68675.1| flagellar basal body-associated protein FliL [Yersinia
           pseudotuberculosis YPIII]
 gi|186698164|gb|ACC88793.1| flagellar basal body-associated protein FliL [Yersinia
           pseudotuberculosis PB1/+]
 gi|229680283|gb|EEO76382.1| flagellar protein FliL [Yersinia pestis Nepal516]
 gi|229688974|gb|EEO81039.1| flagellar protein FliL [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229693543|gb|EEO83592.1| flagellar protein FliL [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229701192|gb|EEO89221.1| flagellar protein FliL [Yersinia pestis Pestoides A]
 gi|320015438|gb|ADV99009.1| flagellar protein FliL [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 156

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/174 (12%), Positives = 46/174 (26%), Gaps = 42/174 (24%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
             +  +++   V+        G     ++                         +S  T 
Sbjct: 9   KRKSSIWLILLVLVAIAASAGGGYSWWLL------------------------HKSKPTN 44

Query: 73  DTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDI----PDKVFLETLHQDIM 125
             I         L+    N  +        L + + L   D         +L  +   ++
Sbjct: 45  TQIVAAIPVFMPLETFTVNLITPDNNLDRVLYIGLTLRLPDDTTRTKLNDYLPEVRSRLL 104

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVS--------SVIFRTFII 171
             +   S   ++  +G +    DI+    + S   V          V+F  FI+
Sbjct: 105 LLLSRQSADSLSNEEGKQRLVNDIK---NILSPPMVKGQPNQVISDVLFTAFIL 155


>gi|224826627|ref|ZP_03699728.1| flagellar basal body-associated protein FliL [Lutiella nitroferrum
           2002]
 gi|224601228|gb|EEG07410.1| flagellar basal body-associated protein FliL [Lutiella nitroferrum
           2002]
          Length = 170

 Score = 54.8 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 60/179 (33%), Gaps = 20/179 (11%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +    +   G  +KL +    +   + +  G L   +   L A   +   ++ +   
Sbjct: 1   MAEEKKAEKKSGGGGNKLMIVVIALLLLVLVAVGGLAAYMFTSLHAPAGDAHAEQAVEKP 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKV----F 116
                   +               L   + N   +  + L++D+         K     +
Sbjct: 61  KKKKDGPPI------------FEKLDTFVVNLAGNGGNMLQVDMQAELASEEAKKKFTEY 108

Query: 117 LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR----SQGFVSSVIFRTFII 171
           +  +   ++  + + S  +++  +G    K  +++ +        +  V +++F  FII
Sbjct: 109 MPKIRSALILLLSSKSSDELSTPEGKVKLKAQVKKIINESMDAGEEQPVENILFTAFII 167


>gi|296330845|ref|ZP_06873320.1| flagellar basal body-associated protein FliL [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305674363|ref|YP_003866035.1| flagellar basal-body associated protein [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151850|gb|EFG92724.1| flagellar basal body-associated protein FliL [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305412607|gb|ADM37726.1| flagellar basal-body associated protein [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 141

 Score = 54.8 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 39/111 (35%), Gaps = 3/111 (2%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLET 119
              S        +I         ++ I TN  S     L + +           +     
Sbjct: 28  GGKSEEKSEAKKSIDEIVASSVDVEEITTNLKSDNIIRLAIKLETDSDKSKEELEKRDFQ 87

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
           +   +++ +   +  +I G +G   FK++++E++     +G V  V   +F
Sbjct: 88  VKDAVISLLADTNANEIEGDKGKETFKKELKEKLNSYLQEGKVEKVYITSF 138


>gi|123442770|ref|YP_001006747.1| flagellar basal body-associated protein FliL [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122089731|emb|CAL12584.1| flagellar protein FliL [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 156

 Score = 54.8 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 22/171 (12%), Positives = 46/171 (26%), Gaps = 36/171 (21%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
             +  ++V   V+        G     ++                         +S  T 
Sbjct: 9   KRKSSIWVILLVLIAVAATAGGGYSWWIL------------------------NKSKPTT 44

Query: 73  DTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDI----PDKVFLETLHQDIM 125
             +         L     N  +        L + + L   D         +L  +   ++
Sbjct: 45  AKVVPVIPVFMPLDTFTVNLITPDNNLDRVLYIGLTLRLPDDSTRTKLNDYLPEVRSRLL 104

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
             +   S   +   +G +    +I+       VK +    VS V+F  FI+
Sbjct: 105 LLLSRQSADSLANEEGKQRLVGEIKNVLSPPMVKGQPNQVVSDVLFTAFIL 155


>gi|157963958|ref|YP_001503992.1| flagellar basal body-associated protein FliL-like protein
           [Shewanella pealeana ATCC 700345]
 gi|157848958|gb|ABV89457.1| flagellar basal body-associated protein FliL [Shewanella pealeana
           ATCC 700345]
          Length = 133

 Score = 54.8 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/114 (14%), Positives = 40/114 (35%), Gaps = 11/114 (9%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIP----DKVFLETLH 121
           +    +    +         I+TN+ S+ K   ++RL + L+ K        +     L 
Sbjct: 18  TFAADNKPLEEYAYYGFEPEIVTNYISNRKKLGYVRLSVELMVKKPEQLVSLERHDPLLR 77

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
             I+  +   +  ++    G    +    E+V         +  V +++F  ++
Sbjct: 78  AAIVEILGNQTEDKVKSLTGKEEIRRQCYEKVNQLLEQETGEPLVVNLLFTKYL 131


>gi|83649055|ref|YP_437490.1| flagellar basal body-associated protein FliL-like protein [Hahella
           chejuensis KCTC 2396]
 gi|83637098|gb|ABC33065.1| Flagellar basal body-associated protein [Hahella chejuensis KCTC
           2396]
          Length = 142

 Score = 54.8 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 10/115 (8%), Positives = 31/115 (26%), Gaps = 11/115 (9%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKDW------LRLDIALICKDIPDKVFLETLH 121
           S    +        I      + N+D            + + +         +  +  L 
Sbjct: 26  SGAYAEGQDDLVQYIDLKPSFVLNYDGPSSKLKFAKIDVSVRVNTRTAASAVEHHMPALR 85

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFII 171
             ++      + K +    G    + +  + ++           V  ++F  F++
Sbjct: 86  NLLVLMFSRQTEKVMGSNDGREQLRAEALQALQDFLQEESGGKMVEDLLFTNFVV 140


>gi|319764509|ref|YP_004128446.1| flagellar basal body-associated protein flil [Alicycliphilus
           denitrificans BC]
 gi|317119070|gb|ADV01559.1| flagellar basal body-associated protein FliL [Alicycliphilus
           denitrificans BC]
          Length = 191

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 8/99 (8%), Positives = 29/99 (29%), Gaps = 5/99 (5%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIP----DK 114
              +    +                ++ ++ N        + ++ I L   D       K
Sbjct: 41  AGDEEEAPARTAQAASPKTPPTFLPMENMVVNLADPGGDRFAQVGITLELADAKTAELVK 100

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV 153
            ++ ++   ++  +   +  ++   +G      D+   V
Sbjct: 101 TYMPSIRSSVLLLVSQRTTDELLTREGKEKLALDVRREV 139


>gi|238758097|ref|ZP_04619277.1| Flagellar fliL protein [Yersinia aldovae ATCC 35236]
 gi|238703635|gb|EEP96172.1| Flagellar fliL protein [Yersinia aldovae ATCC 35236]
          Length = 156

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 22/171 (12%), Positives = 47/171 (27%), Gaps = 36/171 (21%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
             +  ++V   V+        G     V+                         +S  T 
Sbjct: 9   KRKSSIWVILLVLVAVAASAGGGYSWWVL------------------------NKSKPTT 44

Query: 73  DTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDI----PDKVFLETLHQDIM 125
                       L+    N  +        L + + L   D         +L  +   ++
Sbjct: 45  AKAVPVIPVFMPLETFTVNLITPDNNLDRVLYIGLTLRLPDDTTRAKLNDYLPEVRSRLL 104

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
             +   S   ++  +G +    +I+       VK +    +S V+F  FI+
Sbjct: 105 LLLSRQSADSLSNEEGKQRLVAEIKNVLSPPMVKGQPNQVISDVLFTAFIL 155


>gi|327399028|ref|YP_004339897.1| flagellar basal body-associated protein FliL [Hippea maritima DSM
           10411]
 gi|327181657|gb|AEA33838.1| flagellar basal body-associated protein FliL [Hippea maritima DSM
           10411]
          Length = 191

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/190 (12%), Positives = 57/190 (30%), Gaps = 19/190 (10%)

Query: 1   MSYDDT---TSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI 57
           M+ +      +Q     + K  +   ++   I    G    + +      Q      K  
Sbjct: 1   MAKEKEAPAENQEAPKKKGKGKLLIIIIAVVILAVAGVAVKMFLFNGTKKQTTPNQHKSE 60

Query: 58  LNNFYDNSVRSVHTGDTISLKKLQIFS--LQPIITNFDS-SPKDWLRLDIALICKDIP-- 112
           + +        V   ++  + +  +    + PII N        +L++ + L+       
Sbjct: 61  VTHEQAQEEEPVEPAESTVVSQSHLTPVVIGPIIVNLADVGGDRYLKIKLVLLEAKRAAK 120

Query: 113 ----------DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFV 161
                       +    +   I++ +   +   +  A G    K ++   +        V
Sbjct: 121 KEEKEGEKTGISLEDAVVKDTIISVLSAKTSDDLLSASGKEELKNELISAINQALHMNLV 180

Query: 162 SSVIFRTFII 171
             + F +FII
Sbjct: 181 KRIYFLSFII 190


>gi|254509252|ref|ZP_05121346.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus 16]
 gi|219547806|gb|EED24837.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus 16]
          Length = 135

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 13/111 (11%), Positives = 40/111 (36%), Gaps = 11/111 (9%)

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETLHQDI 124
             +    K         + TNF +  K   ++++ I ++     D    ++    +   +
Sbjct: 23  AEEEGVPKLAYFTLEPDLTTNFYTKGKKLGYIQVRIDIMVAAETDLAIIELHQPLIRDAV 82

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
           +  +   S   IT   G    ++ + E++         +  ++ ++F  ++
Sbjct: 83  IELLGQQSEDTITSLAGREDLRKSLVEQLNSILLPETGKTVIADLLFTKYL 133


>gi|89094449|ref|ZP_01167389.1| flagellar protein [Oceanospirillum sp. MED92]
 gi|89081341|gb|EAR60573.1| flagellar protein [Oceanospirillum sp. MED92]
          Length = 173

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 10/97 (10%), Positives = 33/97 (34%), Gaps = 11/97 (11%)

Query: 86  QPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSIKQITGA 139
              +    S  K   +++L +    +D        + +  +   +     T   + +   
Sbjct: 76  PMFVVTLQSKDKRPHYMQLYVEAKSRDQAVADALTLHMPLIVSRLNNLFSTQDFRTLQSL 135

Query: 140 QGFRYFKEDIEERVKL-----RSQGFVSSVIFRTFII 171
           +G +  +E   + V+        +  V +++F   ++
Sbjct: 136 EGKQALREQSTDLVREIMQEKIGKPGVEAILFTNMVM 172


>gi|268043518|gb|ACY92084.1| flagellar basal body-associated protein [Allochromatium vinosum DSM
           180]
          Length = 97

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 29/90 (32%), Gaps = 5/90 (5%)

Query: 69  VHTGDTISLKKLQIFSLQPIITNF-DSSPKDWLRLDIALICKDIPD----KVFLETLHQD 123
             T        L    L  +  N    +P  +LR+ + +   +          +  L  D
Sbjct: 1   SATPMPPEFAPLVYHKLDGLTVNLSPGAPVRFLRVTLTITTPNQAVITAVDKHMPMLRND 60

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERV 153
           I++ +       +   +G    +E + + +
Sbjct: 61  ILSLLAAQEYAALNTPEGKDTLRESLRQTL 90


>gi|194015067|ref|ZP_03053684.1| flagellar basal body-associated protein FliL [Bacillus pumilus ATCC
           7061]
 gi|194014093|gb|EDW23658.1| flagellar basal body-associated protein FliL [Bacillus pumilus ATCC
           7061]
          Length = 142

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/111 (14%), Positives = 34/111 (30%), Gaps = 4/111 (3%)

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW---LRLDIALICKDIPDKVFLET 119
            +         T          +  IITN  S        L ++          +     
Sbjct: 29  GSEEAKAEKEPTADEVVKASVEIPEIITNLKSEGNAVKLVLNIETDSEKAKEELEKRSFQ 88

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTF 169
           +   ++  +   +  ++ G +G  +FK  ++ +V      G V  V   +F
Sbjct: 89  VKDAVIDILSDTNADELDGKKGREHFKTLVKNKVNNYLQDGKVKEVYITSF 139


>gi|237750657|ref|ZP_04581137.1| predicted protein [Helicobacter bilis ATCC 43879]
 gi|229373747|gb|EEO24138.1| predicted protein [Helicobacter bilis ATCC 43879]
          Length = 184

 Score = 54.4 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/182 (12%), Positives = 53/182 (29%), Gaps = 11/182 (6%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++  +   +  +  +F+   VV   + +    +   +                    
Sbjct: 1   MAEEEKPAAEEKKGKGLIFIIIGVVVAVLILIGVVVFLFMGGDEEGDHGGGNAAPPPQIA 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNF----------DSSPKDWLRLDIALICKD 110
                 +++   +        +   +  I N               K    L +A     
Sbjct: 61  NLTPEQQALLQNEAYKNPVAIMPLEKDFIINLKSPDPENMRVAGFAKFRATLLLADKNAV 120

Query: 111 IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
                 L+ +   I          ++ G+QG +     I   +  + + G V++V+F  F
Sbjct: 121 KEVDAKLDIVGGVIADATSAYLATELQGSQGRQKLANAIVVSLNSVLTDGKVAAVVFPDF 180

Query: 170 II 171
           II
Sbjct: 181 II 182


>gi|121533751|ref|ZP_01665578.1| flagellar basal body-associated protein FliL [Thermosinus
           carboxydivorans Nor1]
 gi|121307742|gb|EAX48657.1| flagellar basal body-associated protein FliL [Thermosinus
           carboxydivorans Nor1]
          Length = 156

 Score = 54.4 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/165 (12%), Positives = 45/165 (27%), Gaps = 20/165 (12%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
           G +  LF+   ++   + +  G    I               K I +   +         
Sbjct: 5   GRKIPLFMIIALIVVGLVLAGGVSYYI-------------ATKVIASQTTEKKQAREPGT 51

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLE-----TLHQDIMAY 127
                   +   L     N     K  + L++    K  P +          +   ++  
Sbjct: 52  FIKLGDPKEGLILNIGGVNSGRYLKIGIILEVKPDKKAPPKEGKNPSPDEIKMLDTVIFV 111

Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +R+  ++           KE I+  V     +  V  V    F++
Sbjct: 112 LRSQKVEDFE-PAKQEALKELIKNEVNKALGEERVLDVYITNFVL 155


>gi|163803400|ref|ZP_02197275.1| flagellar basal body-associated protein [Vibrio sp. AND4]
 gi|159172804|gb|EDP57649.1| flagellar basal body-associated protein [Vibrio sp. AND4]
          Length = 136

 Score = 54.4 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 11/117 (9%), Positives = 37/117 (31%), Gaps = 11/117 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKD----IPDKVFLE 118
           S  S    +  + K         + TNF +      ++++ I ++          +    
Sbjct: 18  SAPSWAESEQTAPKLAYFTLEPDLTTNFYTKGNQLGYVQVRIDIMVMSQQDLAVVEHHQP 77

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +   I+  +   +   I    G    ++ + + +            ++ ++F  ++
Sbjct: 78  LIRDAIIELLGKQTEDTIKSLSGREDLRKTLVKELNETLLPETGKTIIADLLFTKYL 134


>gi|126176139|ref|YP_001052288.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS155]
 gi|304412491|ref|ZP_07394097.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS183]
 gi|307307150|ref|ZP_07586888.1| flagellar basal body-associated protein FliL [Shewanella baltica
           BA175]
 gi|125999344|gb|ABN63419.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS155]
 gi|304349133|gb|EFM13545.1| flagellar basal body-associated protein FliL [Shewanella baltica
           OS183]
 gi|306910389|gb|EFN40820.1| flagellar basal body-associated protein FliL [Shewanella baltica
           BA175]
          Length = 155

 Score = 54.0 bits (128), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 14/161 (8%), Positives = 45/161 (27%), Gaps = 24/161 (14%)

Query: 21  TWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKL 80
              ++   + +     G   +       K  +                    +   +   
Sbjct: 8   LVKIILALLVLISSTAGAFWIGTSSGDWKLAE--------------LFASEPEVEPVPVA 53

Query: 81  QIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK----VFLETLHQDIMAYIRTVSIKQ 135
           + + L+  + +        ++ L+++L   +   K         +   +M      + +Q
Sbjct: 54  KFYPLEKFVISIPGDKYPHYMLLEMSLKSHNPNMKTVLLESDPLIRNAMMKMFSRKTFEQ 113

Query: 136 ITGAQGFRYFKED-IEERVKLRSQGF----VSSVIFRTFII 171
           +         + + +   VK+ S       +  V+F   +I
Sbjct: 114 LNHLDQLDSLQSEALILMVKVLSDNKLPSDIDEVLFTRMVI 154


>gi|259908764|ref|YP_002649120.1| flagellar basal body-associated protein FliL [Erwinia pyrifoliae
           Ep1/96]
 gi|224964386|emb|CAX55895.1| Flagellar FliL protein [Erwinia pyrifoliae Ep1/96]
 gi|283478740|emb|CAY74656.1| Flagellar FliL protein [Erwinia pyrifoliae DSM 12163]
          Length = 160

 Score = 54.0 bits (128), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/178 (12%), Positives = 46/178 (25%), Gaps = 32/178 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   +  + KL +   V+   I                                    
Sbjct: 2   TNSAKAKSGKPKLLILILVILALIACGAAGYIVF--------------------QKMKEP 41

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIPDKVFL----E 118
             +      +       + L     N  +    P   L +   L   D   +  +     
Sbjct: 42  TDTTAAAKRVPPPAPVFYVLDTFTVNLINPDNDPDRVLYIGFTLRLPDEETRSRMSDYLP 101

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
            +   ++  +   +   +   QG +     I+       V+ + Q  V+ V+F  FI+
Sbjct: 102 EIRSRLLLLLSRQTAASLANEQGKQQLVTQIKRVLAPPLVQGQPQQVVTDVLFTAFIL 159


>gi|70733261|ref|YP_263034.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas fluorescens Pf-5]
 gi|68347560|gb|AAY95166.1| flagellar protein FliL, putative [Pseudomonas fluorescens Pf-5]
          Length = 130

 Score = 54.0 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 36/121 (29%), Gaps = 12/121 (9%)

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKV 115
             +  +    +  + K   I    P + N+       L+       L +         K 
Sbjct: 9   PMAAMAEEAKEGEAPKVSYISLNPPFVGNYGLDGGPKLKVYKADVALRVTGDASAQAVKA 68

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +   ++A     +   +   +     +++  ++V+        +  V  ++F   I
Sbjct: 69  NEPLIRNQLVALFAQQTSDTMNNVEAKEKLRQEALKQVQQVMNDETGKPVVEDLLFNNLI 128

Query: 171 I 171
           I
Sbjct: 129 I 129


>gi|213022940|ref|ZP_03337387.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
          Length = 97

 Score = 54.0 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 14/96 (14%), Positives = 33/96 (34%), Gaps = 10/96 (10%)

Query: 85  LQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQ 140
           L     N   +    L + + L  KD         +L  +   ++      +  +++   
Sbjct: 2   LDTFTVNLGDA-DRVLYIGVTLRLKDEATRARLNEYLPEVRSRLLLLFSRQNAAELSTEA 60

Query: 141 GFRYFKEDIEERVKLRS-----QGFVSSVIFRTFII 171
           G +     I+E +         +  V+ V++  FI+
Sbjct: 61  GKQKLIAAIKETLAAPLVAGQPKQVVTDVLYTAFIL 96


>gi|330826725|ref|YP_004390028.1| flagellar basal body-associated protein FliL [Alicycliphilus
           denitrificans K601]
 gi|329312097|gb|AEB86512.1| flagellar basal body-associated protein FliL [Alicycliphilus
           denitrificans K601]
          Length = 191

 Score = 54.0 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 8/99 (8%), Positives = 29/99 (29%), Gaps = 5/99 (5%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIP----DK 114
              +    +                ++ ++ N        + ++ I L   D       K
Sbjct: 41  AGDEEEAPARTAQVASPKTPPTFLPMENMVVNLADPGGDRFAQVGITLELADAKTAELVK 100

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV 153
            ++ ++   ++  +   +  ++   +G      D+   V
Sbjct: 101 TYMPSIRSSVLLLVSQRTTDELLTREGKEKLALDVRREV 139


>gi|213424999|ref|ZP_03357749.1| flagellar basal body-associated protein FliL [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
          Length = 127

 Score = 54.0 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 14/143 (9%), Positives = 34/143 (23%), Gaps = 26/143 (18%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   + ++  +++   V+ T             M                        
Sbjct: 2   TDSAINKKSKRSIWIPLLVLITLAACATAGYSYWRM---------------------QQQ 40

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLH 121
             +    +         F L     N   +    L + + L  KD         +L  + 
Sbjct: 41  PTTNAKAEPAPPPAPVFFVLDTFTVNLGDA-DRVLYIGVTLRLKDEATRARLNEYLPEVR 99

Query: 122 QDIMAYIRTVSIKQITGAQGFRY 144
             ++      +  +++   G   
Sbjct: 100 SRLLLLFSRQNAAELSTEAGKTK 122


>gi|319944168|ref|ZP_08018444.1| flagellar basal body-associated protein FliL [Lautropia mirabilis
           ATCC 51599]
 gi|319742463|gb|EFV94874.1| flagellar basal body-associated protein FliL [Lautropia mirabilis
           ATCC 51599]
          Length = 187

 Score = 54.0 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 11/97 (11%), Positives = 30/97 (30%), Gaps = 5/97 (5%)

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW-----LRLDIALICKDIPDKV 115
              +   +          +    +L+P   N      D      + L +     +   K 
Sbjct: 41  KPPHDPDAEKLALYKPSPEPVFVTLEPFTVNLADEGGDRMAQVAVVLQMQNAYAESELKK 100

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER 152
            +  +   ++  + +   +Q+   +G     E I++R
Sbjct: 101 VMPVVRSKLLKLLSSQKSEQLLTEKGKEALAEAIKQR 137


>gi|311030120|ref|ZP_07708210.1| flagellar basal body-associated protein FliL [Bacillus sp. m3-13]
          Length = 143

 Score = 54.0 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 15/109 (13%), Positives = 36/109 (33%), Gaps = 3/109 (2%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLETLHQD 123
                   TI            + TN  S     L++ +    K            +   
Sbjct: 33  ADESTEEPTIDEIIKYSIDFDEMTTNLQSGGYVRLKMKVQTDSKKATEELLKRDFQVQNI 92

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           ++  I + +     G +G    +E+I++++  +   G +  V   +F++
Sbjct: 93  VIHQIASKTASDFEGGKGLTQLEEEIQQKINEVMQDGEIVKVYTTSFLL 141


>gi|149189849|ref|ZP_01868129.1| LafF [Vibrio shilonii AK1]
 gi|148836335|gb|EDL53292.1| LafF [Vibrio shilonii AK1]
          Length = 162

 Score = 54.0 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 14/164 (8%), Positives = 54/164 (32%), Gaps = 21/164 (12%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           +F+   V    +     +     +            Q     +  +++  S  T D  S 
Sbjct: 9   MFIAMIVTSALVSAATVFGAAWYL-----------KQAGDDRSMIEDTPLSFLTQDNQSS 57

Query: 78  KKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVS 132
           +     SL  ++ +     +  ++ +++A+  +          ++  +   ++      +
Sbjct: 58  QGPSFQSLDKVVLSVRGKKQTHFVMIELAVETRRPDRLQNINDYMPIVRNAMLNLFSQKT 117

Query: 133 IKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
            + + G Q     +++++  V +          +  V+   +++
Sbjct: 118 YEDLHGEQALASLQDEVKNTVMMAFAKTEVIRDIDDVLLTKYVV 161


>gi|84394331|ref|ZP_00993054.1| putative flagellar protein FliL [Vibrio splendidus 12B01]
 gi|84375061|gb|EAP91985.1| putative flagellar protein FliL [Vibrio splendidus 12B01]
          Length = 135

 Score = 54.0 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 10/115 (8%), Positives = 39/115 (33%), Gaps = 11/115 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLETL 120
            S    +  + K         + TNF +  K   ++++ + ++  +       +     +
Sbjct: 19  ASSFAEEESAPKLAYFTLEPDLTTNFYTKGKKLGYIQVRLDIMVANSNDLAAIEHHQPLI 78

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
              ++  +   + + I    G    ++ + E +            ++ ++F  ++
Sbjct: 79  RDAVIELLGKQNEETIKSLSGREDLRKTLVEHLNKVLLPETGKTLIADLLFTKYL 133


>gi|332161336|ref|YP_004297913.1| flagellar basal body-associated protein FliL [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318605257|emb|CBY26755.1| flagellar biosynthesis protein FliL [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665566|gb|ADZ42210.1| flagellar basal body-associated protein FliL [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330861090|emb|CBX71357.1| flagellar fliL protein [Yersinia enterocolitica W22703]
          Length = 156

 Score = 54.0 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 22/171 (12%), Positives = 47/171 (27%), Gaps = 36/171 (21%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
             +  ++V   V+        G     ++                         +S  T 
Sbjct: 9   KRKSSIWVILLVLIAVAATAGGGYSWWIL------------------------NKSKPTT 44

Query: 73  DTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDI----PDKVFLETLHQDIM 125
             +         L+    N  +        L + + L   D         +L  +   ++
Sbjct: 45  AKVVPVIPVFMPLETFTVNLITPDNNLDRVLYIGLTLRLPDDSTRTKLNDYLPEVRSRLL 104

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
             +   S   +   +G +    +I+       VK +    VS V+F  FI+
Sbjct: 105 LLLSRQSADSLANEEGKQRLVGEIKNVLSPPMVKGQPNQVVSDVLFTAFIL 155


>gi|171057709|ref|YP_001790058.1| flagellar basal body-associated protein FliL [Leptothrix cholodnii
           SP-6]
 gi|170775154|gb|ACB33293.1| flagellar basal body-associated protein FliL [Leptothrix cholodnii
           SP-6]
          Length = 200

 Score = 54.0 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 19/160 (11%), Positives = 46/160 (28%), Gaps = 28/160 (17%)

Query: 40  VMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS-PKD 98
            ++   A  + ++      +        +       S       +L P + N      + 
Sbjct: 40  FLMKKNAAAEGDEADADGAHAPAAAHAPAPKPRKHDSAHPPTYVALDPFVVNLADRDSER 99

Query: 99  WLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKED-IEERV 153
           + ++ + L   D       K ++  +   ++  +   +  ++   +G     E+ + E V
Sbjct: 100 YAQIGMTLEVDDPKFAEEMKGYMPAIRNAVLMILAHKTSTELLEREGKEKLAEEVMREAV 159

Query: 154 KLRS-----------QGF-----------VSSVIFRTFII 171
           +               G            V  V F  FII
Sbjct: 160 RPMGIEIDADEPDDTGGKKKRRRAPVYNPVQQVHFSAFII 199


>gi|170729143|ref|YP_001763169.1| flagellar basal body-associated protein FliL-like protein
           [Shewanella woodyi ATCC 51908]
 gi|169814490|gb|ACA89074.1| flagellar basal body-associated protein FliL [Shewanella woodyi
           ATCC 51908]
          Length = 150

 Score = 54.0 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 14/101 (13%), Positives = 39/101 (38%), Gaps = 11/101 (10%)

Query: 81  QIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETLHQDIMAYIRTVSIK 134
                  I+TN+ S+ +   ++R+ + L+ +   D    +     L   I+  + + +  
Sbjct: 48  YYGFEPEIVTNYLSTGRKLGFVRISVELMVRAPEDLVAIEHHDPLLRAAIIEILGSQTAD 107

Query: 135 QITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
           ++    G    + +  E V         +  V +++F  ++
Sbjct: 108 KVKSLTGREEIRRECYEAVNRLIEQETGKPLVVNMLFTKYL 148


>gi|118443258|ref|YP_877987.1| flagellar protein FliL [Clostridium novyi NT]
 gi|118133714|gb|ABK60758.1| flagellar protein FliL [Clostridium novyi NT]
          Length = 162

 Score = 54.0 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 25/182 (13%), Positives = 54/182 (29%), Gaps = 32/182 (17%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  +   +          V   V    I +  G   G ++                   
Sbjct: 1   MAEAE---KKPSKFGSVFKVILVVFLAVILLGGGVFAGYMVASKTN-------------- 43

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFD--SSPKDWLRLDIALICKDI------- 111
                   V          L+ F L   + N     +   +L+ +I++   D+       
Sbjct: 44  ----PRGVVINTVQQETLNLKTFGLDEFLLNLKSDDNSSRYLKTNISIGYADVKENKELE 99

Query: 112 -PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
              K     +   I + +R+   +     +     K++I++++  L   G + +V F   
Sbjct: 100 GELKDKKAIIRDTINSVLRSKKKEDFATNEQVEKIKKEIKDKINPLLQNGQIYNVYFSEI 159

Query: 170 II 171
           II
Sbjct: 160 II 161


>gi|322833202|ref|YP_004213229.1| flagellar basal body-associated protein FliL [Rahnella sp. Y9602]
 gi|321168403|gb|ADW74102.1| flagellar basal body-associated protein FliL [Rahnella sp. Y9602]
          Length = 166

 Score = 54.0 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 20/179 (11%), Positives = 49/179 (27%), Gaps = 28/179 (15%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           D+     R  +  L +   ++              ++                      N
Sbjct: 3   DSALSASRKKKRPLMMILLLLIAIGACGAAGYAWWML----------------HKQQSGN 46

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFD---SSPKDWLRLDIALICKDIP----DKVFL 117
             ++               +L     N     + P   L + + L   D         +L
Sbjct: 47  GTQTTEVKKNEPPAAPIFLALDTFTVNLQTADNDPDRVLYVGLTLRLPDEKNRATLNEYL 106

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
             +   ++  +      ++    G +   +DI++      VK +    ++ V+F  FI+
Sbjct: 107 PEVRSRLLLLLSRQKSTELASEAGKQQLVQDIKQVLDAPLVKGQPPQVINDVLFTAFIL 165


>gi|88801107|ref|ZP_01116653.1| flagellar protein [Reinekea sp. MED297]
 gi|88776136|gb|EAR07365.1| flagellar protein [Reinekea sp. MED297]
          Length = 141

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 13/111 (11%), Positives = 34/111 (30%), Gaps = 10/111 (9%)

Query: 71  TGDTISLKKLQIFSLQPIITNFDSS-PKDWLRLDIALICKDI----PDKVFLETLHQDIM 125
           +    ++    +        N+       +L+  I L  +D           + +   I+
Sbjct: 29  SATPAAVGPSYVDLEPAFTLNYGDPMRTRYLQASITLRVRDQAAALEVTAHSDAIRHIII 88

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
                   ++I  A G     E     ++        +  +  V+F +F++
Sbjct: 89  MLFARQPEEKIRTAAGRDDILEQALRELQDLMLKETGKTLIDRVLFTSFVL 139


>gi|91227495|ref|ZP_01261832.1| hypothetical protein V12G01_09607 [Vibrio alginolyticus 12G01]
 gi|269968651|ref|ZP_06182648.1| flagellar protein FliL, putative [Vibrio alginolyticus 40B]
 gi|91188519|gb|EAS74811.1| hypothetical protein V12G01_09607 [Vibrio alginolyticus 12G01]
 gi|269826738|gb|EEZ81075.1| flagellar protein FliL, putative [Vibrio alginolyticus 40B]
          Length = 136

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 11/117 (9%), Positives = 37/117 (31%), Gaps = 11/117 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLE 118
           +  S    +    K         + TNF +  K   ++++ I ++     D    +    
Sbjct: 18  AAPSWAETEEAGPKLAYFTLEPDLTTNFYTKGKKLGYVQVRIDIMVMSQQDLSVVEHHQP 77

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +   ++  +   +   I    G    ++ +   +            ++ ++F  ++
Sbjct: 78  LIRDAVIELLGKQTEDTIKSLSGREDLRKTLVTTLNETLLPETGKTIIADLLFTKYL 134


>gi|150390474|ref|YP_001320523.1| flagellar basal body-associated protein FliL [Alkaliphilus
           metalliredigens QYMF]
 gi|149950336|gb|ABR48864.1| flagellar basal body-associated protein FliL [Alkaliphilus
           metalliredigens QYMF]
          Length = 138

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 18/161 (11%), Positives = 47/161 (29%), Gaps = 32/161 (19%)

Query: 16  HKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTI 75
            K+ +   +      +  G +    M    +   EE                        
Sbjct: 4   KKVIIYALIALVISAVVFGGVLYFTMFRTPSETPEE------------------------ 39

Query: 76  SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD----KVFLETLHQDIMAYIRTV 131
              K+  ++L    TN  +  + + + +I +   +             L   I+      
Sbjct: 40  --IKVYEYNLGGFTTNLSTV-RSYFKGEIVIETTEKALLGVFVEKNAELRDQIIKVFIGK 96

Query: 132 SIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
               I   +G +  +E++   +  +     ++++ F  +II
Sbjct: 97  ESVDILDPEGQQQLREELIRVISNVTKSDEITNLYFVDYII 137


>gi|310767338|gb|ADP12288.1| flagellar basal body-associated protein FliL [Erwinia sp. Ejp617]
          Length = 160

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 22/178 (12%), Positives = 47/178 (26%), Gaps = 32/178 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   +  + KL +   V+   I                                    
Sbjct: 2   TNSAKAKSGKPKLLILILVILALIACGAAGYIVF--------------------QKMKGP 41

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIPDKVFL----E 118
             +      +       + L     N  +    P   L +   L   D   +  +     
Sbjct: 42  TDTTAAAKRVPPPAPVFYVLDTFTVNLINPDNDPDRVLYIGFTLRLPDEETRSRMSDYLP 101

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
            +   ++  +   +   +   QG +     I++      V+ + Q  V+ V+F  FI+
Sbjct: 102 EIRSRLLLLLSRQTAASLANEQGKQQLVTQIKQVLAPPLVQGQPQQVVTDVLFTAFIL 159


>gi|303326428|ref|ZP_07356871.1| putative flagellar basal body-associated protein [Desulfovibrio sp.
           3_1_syn3]
 gi|302864344|gb|EFL87275.1| putative flagellar basal body-associated protein [Desulfovibrio sp.
           3_1_syn3]
          Length = 224

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 19/155 (12%), Positives = 48/155 (30%), Gaps = 18/155 (11%)

Query: 23  FVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQI 82
             V   + I         +                  +     V  V +  T+  K   +
Sbjct: 79  GAVVGLLLILGAAAWWFFLRTPPP-----------APDTLKPEVIVVPSKPTVKTKPDYV 127

Query: 83  FSLQPIIT--NFDSSPKDWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQI 136
               P +   +   S   +L    + + KD          + +L   +  Y+R+ S + +
Sbjct: 128 KEFAPFLVPRDDGKSKTRFLVCKFSAVSKDAGLGKEMDQKMISLRDAMYYYLRSKSNEYL 187

Query: 137 TGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
              +     K+D+   +    + G +  ++F +++
Sbjct: 188 MDPRNGPAIKQDLASVLNDYLTHGKIEDILFESYL 222


>gi|261249999|ref|ZP_05942576.1| flagellar biosynthesis protein FliL [Vibrio orientalis CIP 102891]
 gi|260939503|gb|EEX95488.1| flagellar biosynthesis protein FliL [Vibrio orientalis CIP 102891]
          Length = 135

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 12/111 (10%), Positives = 39/111 (35%), Gaps = 11/111 (9%)

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETLHQDI 124
             +  + K         + TNF +  K   ++++ I ++     D    ++    +   +
Sbjct: 23  AEEESTPKLAYFTLEPDLTTNFYTKGKKLGYIQVRIDIMVASEADLKIIELHQPLIRDAV 82

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
           +  +   S   IT   G    ++ +  ++            ++ ++F  ++
Sbjct: 83  IELLGKQSEDTITSLAGREDLRKTLVSQLNETLLPETGKTIIADLLFTKYL 133


>gi|170722848|ref|YP_001750536.1| flagellar basal body-associated protein FliL [Pseudomonas putida
           W619]
 gi|169760851|gb|ACA74167.1| flagellar basal body-associated protein FliL [Pseudomonas putida
           W619]
          Length = 165

 Score = 53.6 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/182 (8%), Positives = 52/182 (28%), Gaps = 29/182 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  D         + KL +   +                M                  +
Sbjct: 1   MAKSDAVKDPATKGKLKLILLLVLALLLAVGLSVGATWFFM------------------H 42

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD----IPDKV 115
             +++  +      +    +        + NF+ + +  ++++ I L  ++       KV
Sbjct: 43  KSESAPAADPAAANVKPAAIYEPLAPAFVVNFNQNGRQRYMQVSITLQGRNQADLDALKV 102

Query: 116 FLETLHQDIMAYIRTVSIKQI-TGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTF 169
            +  +  +++          +   + G    ++     V+        +  V  ++F  F
Sbjct: 103 HMPVIRNNLVMMFSGQGFDTLAASSVGQEMLRQKATAVVQEVAQKEVGKPVVDQLLFTNF 162

Query: 170 II 171
           ++
Sbjct: 163 VL 164


>gi|302035576|ref|YP_003795898.1| hypothetical protein NIDE0187 [Candidatus Nitrospira defluvii]
 gi|300603640|emb|CBK39971.1| protein of unknown function, similar to FliL [Candidatus Nitrospira
           defluvii]
          Length = 182

 Score = 53.6 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/179 (10%), Positives = 51/179 (28%), Gaps = 13/179 (7%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGW--LGGIVMLFLFAGQKEEKYQKFIL 58
           ++ D        G    +    F +   + +   +     ++++   AGQ          
Sbjct: 6   LARDRAPESSETGPPLHVTFIRFSMTLRVSLIVLFSIAVILLLVGYLAGQYHPDLLPHTF 65

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLE 118
           +        S             +  +             ++++++AL          ++
Sbjct: 66  SLQTAPPDPSQGQPGVTINLPPVVAPVDD------GQRYYYVQVNLALELDRSGTAGLIQ 119

Query: 119 TLHQDI----MAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFIIA 172
             H  I    M  + T ++  +  +      + DI   +      G V +V    +++ 
Sbjct: 120 ARHDAIDRQVMEILHTYAVSDLRASGQLPALRADIRRAINKLLPKGQVQNVYITNWLMT 178


>gi|152994794|ref|YP_001339629.1| flagellar basal body-associated protein FliL [Marinomonas sp.
           MWYL1]
 gi|150835718|gb|ABR69694.1| flagellar basal body-associated protein FliL [Marinomonas sp.
           MWYL1]
          Length = 140

 Score = 53.6 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 11/100 (11%), Positives = 34/100 (34%), Gaps = 10/100 (10%)

Query: 81  QIFSLQPIITNFDSSPKDWLRLDIALICKDIP-----DKVFLETLHQDIMAYIRTVSIKQ 135
            I      + N          +  ++  +         +  +  +   ++ ++ + + +Q
Sbjct: 39  YIELKPTFVVNHLGDDARLKYIKTSISIRTDESKKDLIEANMPLVRDALVMFLSSRTTEQ 98

Query: 136 ITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
           +TGA      +E+    V    +       V  ++F +F+
Sbjct: 99  VTGAIAREKTREEAAIAVNGALKEETGLEPVKDILFASFV 138


>gi|28899724|ref|NP_799329.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153839845|ref|ZP_01992512.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|260361675|ref|ZP_05774702.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus K5030]
 gi|260879363|ref|ZP_05891718.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AN-5034]
 gi|260897190|ref|ZP_05905686.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus Peru-466]
 gi|28807976|dbj|BAC61213.1| putative flagellar protein FliL [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149746640|gb|EDM57628.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ3810]
 gi|308089320|gb|EFO39015.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus Peru-466]
 gi|308092826|gb|EFO42521.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AN-5034]
 gi|308111288|gb|EFO48828.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus K5030]
 gi|328472449|gb|EGF43315.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           parahaemolyticus 10329]
          Length = 136

 Score = 53.6 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/117 (10%), Positives = 39/117 (33%), Gaps = 11/117 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLE 118
           S  S    +    K         + TNF +  K   ++++ I ++     D    +    
Sbjct: 18  SAPSWAETEETGPKLAYFTLEPDLTTNFYTKGKKLGYVQVRIDIMVMSQQDLAIVEHHQP 77

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +   ++  +   +   I    G    ++ + + +         +  ++ ++F  ++
Sbjct: 78  LIRDAVIELLGKQTEDTIKSLSGREDLRKTLVKELNETLLPETGKTVIADLLFTKYL 134


>gi|330965562|gb|EGH65822.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 135

 Score = 53.6 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 39/121 (32%), Gaps = 12/121 (9%)

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKV 115
               +     +    K   +    P + N+       LR       L +     +   K 
Sbjct: 14  PAMAQEEAKEEGGPPKAAYVSLTPPFVGNYALDGGPKLRVYKADIALRVTGADAEAAVKR 73

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +   +++     ++  ++ A+     +++  ++V+        +  V  ++F  FI
Sbjct: 74  NDALIRNQLVSLFTQQTVDSMSSAEAKENIRQEALKQVQRVMNDEEGKPVVEDLLFNNFI 133

Query: 171 I 171
           +
Sbjct: 134 V 134


>gi|119714994|ref|YP_921959.1| flagellar basal body-associated protein FliL [Nocardioides sp.
           JS614]
 gi|119535655|gb|ABL80272.1| flagellar basal body-associated protein FliL [Nocardioides sp.
           JS614]
          Length = 154

 Score = 53.6 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/104 (18%), Positives = 38/104 (36%), Gaps = 3/104 (2%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALI-CKDIPDKVFLETLHQDIMA 126
                     K   I  L+    N       +L++ IAL   +  P++V         + 
Sbjct: 51  KPSGAAEEGPKPGAILPLESTQINLA--SGHYLKIGIALQLVEGAPEEVDGSKALDATIE 108

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFI 170
                +I+++   +  +  KED+E  ++   +  V  V F  F+
Sbjct: 109 LFSGRTIEEVANPRDRKELKEDLEATLEKSYEDEVMGVYFTEFV 152


>gi|269961505|ref|ZP_06175868.1| flagellar protein FliL, putative [Vibrio harveyi 1DA3]
 gi|269833734|gb|EEZ87830.1| flagellar protein FliL, putative [Vibrio harveyi 1DA3]
          Length = 136

 Score = 53.6 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 10/117 (8%), Positives = 37/117 (31%), Gaps = 11/117 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLE 118
           S  S    +  + K         + TNF +      ++++ I ++          +    
Sbjct: 18  SAPSWAESEEAAPKLAYFTLEPDLTTNFYTKGNKLGYVQVRIDIMVMSQQDLAVVEHHQP 77

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +   ++  +   +   I    G    ++ + + +            ++ ++F  ++
Sbjct: 78  LIRDAVIELLGKQTEDTIKSLSGREDLRKTLVKELNETLLPETGKTIIADLLFTKYL 134


>gi|295399819|ref|ZP_06809800.1| flagellar basal body-associated protein FliL [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312111669|ref|YP_003989985.1| flagellar basal body-associated protein FliL [Geobacillus sp.
           Y4.1MC1]
 gi|294978222|gb|EFG53819.1| flagellar basal body-associated protein FliL [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311216770|gb|ADP75374.1| flagellar basal body-associated protein FliL [Geobacillus sp.
           Y4.1MC1]
          Length = 142

 Score = 53.6 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/108 (12%), Positives = 35/108 (32%), Gaps = 3/108 (2%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLETLHQDI 124
               +  +          +  I TN        +   I    K      +     +   I
Sbjct: 34  EKEQSTPSADEIVESSIDIPEITTNLADGRYVKISFKIQTNSKKGKEEAEKRDFQIKNII 93

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +  +  +  +   G +G   F+E +++++  +   G V  V   +F++
Sbjct: 94  IEELSEMKAENFKGKEGMTSFEERLKQQINQIMQDGKVEQVYITSFVL 141


>gi|153835508|ref|ZP_01988175.1| flagellar basal body-associated protein FliL [Vibrio harveyi HY01]
 gi|156972622|ref|YP_001443529.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           harveyi ATCC BAA-1116]
 gi|148867921|gb|EDL67133.1| flagellar basal body-associated protein FliL [Vibrio harveyi HY01]
 gi|156524216|gb|ABU69302.1| hypothetical protein VIBHAR_00274 [Vibrio harveyi ATCC BAA-1116]
          Length = 136

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 10/117 (8%), Positives = 38/117 (32%), Gaps = 11/117 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLE 118
           S  S    +  + K         + TNF +      ++++ + ++     D    +    
Sbjct: 18  SAPSWAESEEAAPKLAYFTLEPDLTTNFYTKGNKLGYVQVRMDIMVMSQQDLAVIEHHQP 77

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +   ++  +   +   I    G    ++ + + +            ++ ++F  ++
Sbjct: 78  LIRDAVIELLGKQTEDTIKSLSGREDLRKTLVKELNETLLPETGKTIIADLLFTKYL 134


>gi|269965697|ref|ZP_06179810.1| polar flagellar protein FliL [Vibrio alginolyticus 40B]
 gi|269829765|gb|EEZ84001.1| polar flagellar protein FliL [Vibrio alginolyticus 40B]
          Length = 109

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 9/111 (8%), Positives = 28/111 (25%), Gaps = 16/111 (14%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +          + KL +    V   +           ++      + E  Q+  +  
Sbjct: 1   MAEEQLQGADAPKGKSKLLIIIIAVVVLLLGGG--AAAFFLMGSDEPAQAESSQQAQVKA 58

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKD 110
                +               +   Q  + N     +   +++   L+ + 
Sbjct: 59  SDAAPIA-------------YVNLPQAFVFNVTGDSRDRLVQIKAQLMVRS 96


>gi|260899143|ref|ZP_05907538.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ4037]
 gi|308107502|gb|EFO45042.1| flagellar basal body-associated protein FliL [Vibrio
           parahaemolyticus AQ4037]
          Length = 136

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/117 (10%), Positives = 39/117 (33%), Gaps = 11/117 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLE 118
           S  S    +    K         + TNF +  K   ++++ I ++     D    +    
Sbjct: 18  SAPSWAETEETGPKLAYFTIEPDLTTNFYTKGKKLGYVQVRIDIMVMSQQDLAIVEHHQP 77

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            +   ++  +   +   I    G    ++ + + +         +  ++ ++F  ++
Sbjct: 78  LIRDAVIELLGKQTEDTIKSLSGREDLRKTLVKELNETLLPETGKTVIADLLFTKYL 134


>gi|237798002|ref|ZP_04586463.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331020853|gb|EGI00910.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 135

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/118 (11%), Positives = 39/118 (33%), Gaps = 12/118 (10%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLE 118
            +     +    K   +    P + N+       LR       L +     +   K    
Sbjct: 17  AQEEAKEEGGPPKAAYVSLTPPFVGNYALDGGPKLRVYKADISLRVTGADAEAAVKRNDA 76

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
            +   +++     ++  ++ A+     +++  ++V+        +  V  ++F  FI+
Sbjct: 77  LIRNQLVSLFTQQTVDSMSSAEAKENIRQEALKQVQRVMNDEEGKPVVEDLLFNNFIV 134


>gi|312963762|ref|ZP_07778233.1| flagellar basal body-associated protein FliL [Pseudomonas
           fluorescens WH6]
 gi|311281797|gb|EFQ60407.1| flagellar basal body-associated protein FliL [Pseudomonas
           fluorescens WH6]
          Length = 135

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 39/121 (32%), Gaps = 12/121 (9%)

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKV 115
             + ++    +  + K   I    P + N+       L+       L +         K 
Sbjct: 14  PMAAQAEEAKEGEAPKVSYISLSPPFVGNYGLDGTAKLKVFKADIALRVTGEEAAKLVKA 73

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +   ++A     + + ++  +G    +++  ++ +        +  V  ++F   I
Sbjct: 74  NDPLIRNQLVALFTQQTNEAMSTVEGKEKLRQEALKQTQQLMNDETGKPVVEDLLFNNLI 133

Query: 171 I 171
           I
Sbjct: 134 I 134


>gi|319649556|ref|ZP_08003712.1| flagellar basal body-associated protein FliL [Bacillus sp.
           2_A_57_CT2]
 gi|317398718|gb|EFV79400.1| flagellar basal body-associated protein FliL [Bacillus sp.
           2_A_57_CT2]
          Length = 144

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/107 (15%), Positives = 33/107 (30%), Gaps = 3/107 (2%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLETLHQ 122
           S        TI         +  I  N  S     +   I    K      +     +  
Sbjct: 34  SGEDETKEPTIDDVLEASVDIPQITANLASDDYIRISFKIQTENKKAKEELQKRDFQVKN 93

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRT 168
            I+  +  +  + I G +G    +ED++ ++  L  +G +  V    
Sbjct: 94  LIIQELSEMKAEDIQGKEGQIKLQEDLKTKINGLMQEGKIVQVYITE 140


>gi|59713053|ref|YP_205829.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           fischeri ES114]
 gi|197336425|ref|YP_002157232.1| flagellar basal body-associated protein FliL [Vibrio fischeri MJ11]
 gi|59481154|gb|AAW86941.1| flagellar basal body-associated protein FliL2 [Vibrio fischeri
           ES114]
 gi|197317915|gb|ACH67362.1| flagellar basal body-associated protein FliL [Vibrio fischeri MJ11]
          Length = 136

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 10/115 (8%), Positives = 41/115 (35%), Gaps = 11/115 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLETL 120
            ++H  + ++ +         + TNF ++ K   ++++ + ++  D       +     +
Sbjct: 20  PAIHAEEEVAPQMGYFTLAPDLTTNFVTTGKKLGYIQIRVDILVADNRDLPQLERHNPQI 79

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
              ++  +     ++I    G    +++    +         +     ++F  +I
Sbjct: 80  RNALVEVLGQQPEQRIKSLAGREEIRKECLTAINELLLAETGKTLAVDLLFTKYI 134


>gi|117918584|ref|YP_867776.1| flagellar basal body-associated protein FliL-like protein
           [Shewanella sp. ANA-3]
 gi|117610916|gb|ABK46370.1| flagellar basal body-associated protein FliL [Shewanella sp. ANA-3]
          Length = 136

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/118 (13%), Positives = 46/118 (38%), Gaps = 11/118 (9%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFL 117
           ++  +     T +           I+TN+ S+ K   ++++ + L+ K+  D    +   
Sbjct: 17  SAYAADEKEATPAGDYAYYGFEPEIVTNYISNRKKLGFVKISVELMVKNPDDLVIVERHD 76

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
             L   I+  +   + ++I    G    + +  + V         +  V +++F +++
Sbjct: 77  PLLRAAIIEVLGNQAEEKIKSLTGREEIRRECFDTVNNLLTKEAGKPLVVNLLFTSYL 134


>gi|262392918|ref|YP_003284772.1| flagellar biosynthesis protein FliL [Vibrio sp. Ex25]
 gi|262336512|gb|ACY50307.1| flagellar biosynthesis protein FliL [Vibrio sp. Ex25]
          Length = 136

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 11/117 (9%), Positives = 36/117 (30%), Gaps = 11/117 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLE 118
           +  S         K         + TNF +  K   ++++ I ++     D    +    
Sbjct: 18  AAPSWAETQEAGPKLAYFTLEPDLTTNFYTKGKKLGYVQVRIDIMVMSQQDLSIVEHHQP 77

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            +   ++  +   +   I    G    ++ +   +            ++ ++F  ++
Sbjct: 78  LIRDAVIELLGKQTEDTIKSLSGREDLRKTLVTTLNETLLPETGKTIIADLLFTKYL 134


>gi|327482772|gb|AEA86082.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas stutzeri DSM 4166]
          Length = 128

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 11/122 (9%), Positives = 40/122 (32%), Gaps = 10/122 (8%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDK---- 114
                   +    ++ + + L       ++ N+ S  +  + + D+AL       +    
Sbjct: 6   AVAGAVQANESADESAAPQTLYYALTPAMVGNYASGERLKYFKADVALRISSKEVEDRVK 65

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTF 169
                +   ++      + + +   +     +++  ++V+   +       V  ++F   
Sbjct: 66  HHEPLIRHQLVMLFSEQTDETLGSVEAKELLRQEALKQVREVLEQEEGKPLVDDLLFNNL 125

Query: 170 II 171
           II
Sbjct: 126 II 127


>gi|238764405|ref|ZP_04625355.1| hypothetical protein ykris0001_37730 [Yersinia kristensenii ATCC
           33638]
 gi|238697431|gb|EEP90198.1| hypothetical protein ykris0001_37730 [Yersinia kristensenii ATCC
           33638]
          Length = 156

 Score = 52.9 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/171 (12%), Positives = 47/171 (27%), Gaps = 36/171 (21%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
             +  ++V   V+        G     ++                         +S  T 
Sbjct: 9   KRKSSIWVILLVLIAVAATAGGGYSWWIL------------------------NKSKPTI 44

Query: 73  DTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDI----PDKVFLETLHQDIM 125
              +        L+    N  +        L + + L   D         +L  +   ++
Sbjct: 45  AKAAPVIPVFMPLETFTVNLITPDNNLDRVLYIGLTLRLPDDSTRAKLNDYLPEVRSRLL 104

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
             +   S   +   +G +    +I+       VK +    VS V+F  FI+
Sbjct: 105 LLLSRQSADSLANEEGKQRLVGEIKNVLSPPMVKGQPNQVVSDVLFTAFIL 155


>gi|167622037|ref|YP_001672331.1| flagellar basal body-associated protein FliL-like protein
           [Shewanella halifaxensis HAW-EB4]
 gi|167352059|gb|ABZ74672.1| flagellar basal body-associated protein FliL [Shewanella
           halifaxensis HAW-EB4]
          Length = 133

 Score = 52.9 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/115 (14%), Positives = 40/115 (34%), Gaps = 11/115 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIP----DKVFLETL 120
            +V        +         I+TN+ S+ K   ++RL + L+ K        +     L
Sbjct: 17  GAVAADKKPLEEYAYYGFEPEIVTNYISNRKKLGYVRLSVELMVKKPEQLVSLERHDPLL 76

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
              I+  +   +  ++    G    +    E+V    +       V +++F  ++
Sbjct: 77  RAAIVEILGNQTEAKVKSLTGKEEIRRQCYEKVNQLLEQETGKPLVVNLLFTKYL 131


>gi|239826623|ref|YP_002949247.1| flagellar basal body-associated protein FliL [Geobacillus sp.
           WCH70]
 gi|239806916|gb|ACS23981.1| flagellar basal body-associated protein FliL [Geobacillus sp.
           WCH70]
          Length = 141

 Score = 52.9 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/109 (12%), Positives = 36/109 (33%), Gaps = 3/109 (2%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLETLHQD 123
               H+  +          +  I TN        +   I    ++           +   
Sbjct: 32  EEKDHSAPSADEIVACSIDIPEITTNLADGRYVKVSFKIQANSEEGKEEAAKRDFQIKNI 91

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           I+  +  +  +   G +G    +E +++++  +  +G V  V   +FI+
Sbjct: 92  IIEELSEMKAENFKGKKGMTDLEERLKQQINQIMQEGTVEQVYITSFIL 140


>gi|49076838|gb|AAT49606.1| PA5233 [synthetic construct]
          Length = 140

 Score = 52.9 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 10/118 (8%), Positives = 34/118 (28%), Gaps = 11/118 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW------LRLDIALICKDIPDKVFLE 118
           +       +     K     L P +     S          + L +A        +    
Sbjct: 20  ASAEEAAPEGEGANKPVYVDLTPALVGNYGSGPRLQYYKADIALQVADKDAATKVEHHEP 79

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
            +   ++      + + +   +     +++  ++V+   +       V+ ++F   I+
Sbjct: 80  LIRNQLIMLFAQQTDQSLGTVEAKESLRQEALKQVQQTLEQEEGKPLVTDLLFNNLIV 137


>gi|114762167|ref|ZP_01441635.1| hypothetical protein 1100011001331_R2601_14550 [Pelagibaca
           bermudensis HTCC2601]
 gi|114545191|gb|EAU48194.1| hypothetical protein R2601_14550 [Roseovarius sp. HTCC2601]
          Length = 171

 Score = 52.9 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/167 (9%), Positives = 35/167 (20%), Gaps = 14/167 (8%)

Query: 15  QHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDT 74
           +  L +   V+ T  GI  G             +          +        S    + 
Sbjct: 2   KKLLPILLAVIGTAAGIGAGLFLAPAPTAHDTAESASAGDVHDTSAHDGAGDHSDADDEE 61

Query: 75  ISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALIC---KDIPDKVFLETLHQDIMAYIR 129
                  +      +     + +    + L ++L                L    +  + 
Sbjct: 62  GEGGNEYVRLSNQFVVPVVGNDRVESLVVLSLSLEVGPGDTEAVFAQEPKLRDVFLRVL- 120

Query: 130 TVSIKQITGAQG-------FRYFKEDIEERVKLRSQGFVSSVIFRTF 169
                 I G  G           +  + E  +      V  V+    
Sbjct: 121 -FDHANIGGFAGNFTEQHRMDRLRRALWEAARNVMGKIVVDVLITEI 166


>gi|308050009|ref|YP_003913575.1| flagellar basal body-associated protein FliL [Ferrimonas balearica
           DSM 9799]
 gi|307632199|gb|ADN76501.1| flagellar basal body-associated protein FliL [Ferrimonas balearica
           DSM 9799]
          Length = 151

 Score = 52.9 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 12/171 (7%), Positives = 46/171 (26%), Gaps = 33/171 (19%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVH 70
            +G+  K      V+   +     W           G +  ++ +               
Sbjct: 3   SQGSNRKQLTRSLVILAAVAGGSYWA----------GTQTAQWWQQDDQRTA-------- 44

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIP----DKVFLETLHQDIM 125
                         L   + +      + +++L++A+  +              +   +M
Sbjct: 45  -----MTPAAHFHKLDRFVISIPGEQYQHYVQLELAIKSESAEFSDVLTQAEPLVRNGLM 99

Query: 126 AYIRTVSIKQITGAQGFRYFKED----IEERVKLRS-QGFVSSVIFRTFII 171
                   ++++  Q     + +    + + ++       +  V+F   ++
Sbjct: 100 HLFSKKHYEELSQLQDLNGLQNEVKVLLADTLQRNGYPNQIDEVLFTRLVV 150


>gi|15600426|ref|NP_253920.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas aeruginosa PAO1]
 gi|107104335|ref|ZP_01368253.1| hypothetical protein PaerPA_01005410 [Pseudomonas aeruginosa PACS2]
 gi|116053380|ref|YP_793705.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894335|ref|YP_002443205.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas aeruginosa LESB58]
 gi|254238070|ref|ZP_04931393.1| hypothetical protein PACG_04186 [Pseudomonas aeruginosa C3719]
 gi|254243885|ref|ZP_04937207.1| hypothetical protein PA2G_04714 [Pseudomonas aeruginosa 2192]
 gi|296392091|ref|ZP_06881566.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas aeruginosa PAb1]
 gi|313110302|ref|ZP_07796194.1| putative flagellar protein FliL [Pseudomonas aeruginosa 39016]
 gi|9951542|gb|AAG08618.1|AE004936_1 hypothetical protein PA5233 [Pseudomonas aeruginosa PAO1]
 gi|115588601|gb|ABJ14616.1| putative flagellar protein FliL [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170001|gb|EAZ55512.1| hypothetical protein PACG_04186 [Pseudomonas aeruginosa C3719]
 gi|126197263|gb|EAZ61326.1| hypothetical protein PA2G_04714 [Pseudomonas aeruginosa 2192]
 gi|218774564|emb|CAW30381.1| putative flagellar protein FliL [Pseudomonas aeruginosa LESB58]
 gi|310882696|gb|EFQ41290.1| putative flagellar protein FliL [Pseudomonas aeruginosa 39016]
          Length = 139

 Score = 52.9 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 10/118 (8%), Positives = 34/118 (28%), Gaps = 11/118 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW------LRLDIALICKDIPDKVFLE 118
           +       +     K     L P +     S          + L +A        +    
Sbjct: 20  ASAEEAAPEGEGANKPVYVDLTPALVGNYGSGPRLQYYKADIALQVADKDAATKVEHHEP 79

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
            +   ++      + + +   +     +++  ++V+   +       V+ ++F   I+
Sbjct: 80  LIRNQLIMLFAQQTDQSLGTVEAKESLRQEALKQVQQTLEQEEGKPLVTDLLFNNLIV 137


>gi|330874062|gb|EGH08211.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 135

 Score = 52.9 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 39/121 (32%), Gaps = 12/121 (9%)

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKV 115
               +     +    K   +    P + N+       LR       L +     +   K 
Sbjct: 14  PAMGQEEAKEEGGPPKAAYVSLTPPFVGNYALDGGPKLRVYKADIALRVTGADAEAAVKR 73

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +   +++     ++  ++ A+     +++  ++V+        +  V  ++F  FI
Sbjct: 74  NDALIRNQLVSLFTQQTVDSMSSAEAKENIRQEALKQVQRVMNDEEGKPIVEDLLFNNFI 133

Query: 171 I 171
           +
Sbjct: 134 V 134


>gi|148981496|ref|ZP_01816436.1| hypothetical protein VSWAT3_00070 [Vibrionales bacterium SWAT-3]
 gi|145960851|gb|EDK26183.1| hypothetical protein VSWAT3_00070 [Vibrionales bacterium SWAT-3]
          Length = 135

 Score = 52.9 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 11/115 (9%), Positives = 39/115 (33%), Gaps = 11/115 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETL 120
            S    +    K         + TNF +  K   ++++ + ++  +  D    +     +
Sbjct: 19  ASSFAEEESEPKLAYFTLEPDLTTNFYTKGKKLGYIQVRLDIMVANSKDLATIEHHQPLI 78

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
              ++  +   + + I    G    ++ + E +            ++ ++F  ++
Sbjct: 79  RDAVIELLGKQNEETIKSLSGREDLRKTLVEHLNKILLPETGKTLIADLLFTKYL 133


>gi|229593258|ref|YP_002875377.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas fluorescens SBW25]
 gi|229365124|emb|CAY53353.1| putative flagellar protein [Pseudomonas fluorescens SBW25]
          Length = 135

 Score = 52.9 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 39/121 (32%), Gaps = 12/121 (9%)

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKV 115
             + ++    +  + K   I    P + N+       L+       L +         K 
Sbjct: 14  PMAAQAEEAKEGEAPKVSYISLSPPFVGNYGLDGTAKLKVFKADIALRVTGTEAAALVKA 73

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +   ++A     + + ++  +G    +++  ++ +        +  V  ++F   I
Sbjct: 74  NDPLIRNQLVALFTQQTNEAMSTVEGKEKLRQEALKQTQQVMNDETGKPVVEDLLFNNLI 133

Query: 171 I 171
           I
Sbjct: 134 I 134


>gi|152985058|ref|YP_001351292.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas aeruginosa PA7]
 gi|150960216|gb|ABR82241.1| hypothetical protein PSPA7_5976 [Pseudomonas aeruginosa PA7]
          Length = 139

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 11/134 (8%), Positives = 36/134 (26%), Gaps = 11/134 (8%)

Query: 49  KEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDW------LRL 102
                    L+ F   +       +     K     L P +                + L
Sbjct: 4   PIALSLALCLSLFLPFATAEEAAPEGEGANKPVYVDLTPALVGNYGGGPRLQYYKADIAL 63

Query: 103 DIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-- 160
            +A        +     +   ++      + + +   +     +++  ++V+   +    
Sbjct: 64  QVADKDAATKVEHHEPLIRNQLIMLFAQQTDQTLGTVEAKENLRQEALKQVRQTLEQEEG 123

Query: 161 ---VSSVIFRTFII 171
              V+ ++F   I+
Sbjct: 124 KPLVTDLLFNNLIV 137


>gi|150388447|ref|YP_001318496.1| flagellar basal body-associated protein FliL [Alkaliphilus
           metalliredigens QYMF]
 gi|149948309|gb|ABR46837.1| flagellar basal body-associated protein FliL [Alkaliphilus
           metalliredigens QYMF]
          Length = 138

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/161 (9%), Positives = 44/161 (27%), Gaps = 32/161 (19%)

Query: 16  HKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTI 75
            K+ +   +      +  G +    +         E                        
Sbjct: 4   KKVIIYALIALVLSTVVFGGILYFTIFRTPDEMPAE------------------------ 39

Query: 76  SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD----KVFLETLHQDIMAYIRTV 131
              K+  ++L    TN  +  + + + ++ +   +             L   I+      
Sbjct: 40  --VKVYEYNLGGFSTNLSTV-RSYFKGEMVIETTEKALLSVFVEKNAELRDQIIKVFIGK 96

Query: 132 SIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
               I    G +  +E++   +  +     ++++ F  +II
Sbjct: 97  ESVDILDPDGQQQLREELIRVISNVTKSDKITNLYFVDYII 137


>gi|238798577|ref|ZP_04642054.1| Flagellar fliL protein [Yersinia mollaretii ATCC 43969]
 gi|238717597|gb|EEQ09436.1| Flagellar fliL protein [Yersinia mollaretii ATCC 43969]
          Length = 166

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/183 (13%), Positives = 54/183 (29%), Gaps = 40/183 (21%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS +   ++     +  ++V   V+        G     ++                   
Sbjct: 11  MSENTFPAK----RKSSIWVILLVLVAVAASAGGGYSWWLL------------------- 47

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDIPDKV-- 115
                 +S  T   +         L+    N  +        L + + L   D   +   
Sbjct: 48  -----NKSKPTTAKVVPVIPVFMPLETFTVNLITPDNNLDRVLYIGLTLRLPDDATRAKL 102

Query: 116 --FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRT 168
             +L  +   ++  +   S   ++  +G +    +I+       VK +    VS V+F  
Sbjct: 103 NDYLPEVRSRLLLLLSRQSADSLSNEEGKQRLVGEIKNVLSPPMVKGQPNQVVSDVLFTA 162

Query: 169 FII 171
           FI+
Sbjct: 163 FIL 165


>gi|325288784|ref|YP_004264965.1| flagellar basal body-associated protein FliL [Syntrophobotulus
           glycolicus DSM 8271]
 gi|324964185|gb|ADY54964.1| flagellar basal body-associated protein FliL [Syntrophobotulus
           glycolicus DSM 8271]
          Length = 145

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/105 (12%), Positives = 31/105 (29%), Gaps = 2/105 (1%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSP--KDWLRLDIALICKDIPDKVFLETLHQDI 124
            S         KK  +  L+    N D     +  L ++          +     L    
Sbjct: 36  PSNEKVVLADNKKGPLVELEEFTVNLDGGGILRAELTVETVDEKSKKVLEEEKAFLRDKA 95

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTF 169
           +  +    I  ++   G    +  +   +   S   +  V+F+++
Sbjct: 96  LTVLAAQKITDVSTELGREKLRNTLLMELNSISNSKIRDVLFKSY 140


>gi|323492932|ref|ZP_08098072.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           brasiliensis LMG 20546]
 gi|323312825|gb|EGA65949.1| flagellar basal body-associated protein FliL-like protein [Vibrio
           brasiliensis LMG 20546]
          Length = 135

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/111 (11%), Positives = 41/111 (36%), Gaps = 11/111 (9%)

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETLHQDI 124
             +  + K         + TNF +  K   ++++ I ++     D    ++    +   +
Sbjct: 23  AEEEGAPKLAYFTLEPDLTTNFFTKGKKLGYIQVRIDIMVASEADLSVIELHQPLIRDAV 82

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
           +  +   S + IT   G    ++ + E++            ++ ++F  ++
Sbjct: 83  IELLGKQSEETITSLAGREDLRKTLVEQLNATLLPETGKTIIADLLFTKYL 133


>gi|295319969|gb|ADG00347.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           F str. 230613]
          Length = 139

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/139 (11%), Positives = 45/139 (32%), Gaps = 7/139 (5%)

Query: 39  IVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS-SPK 97
           ++                   N  ++   +        +   + +SL  ++ N      K
Sbjct: 1   MLFAKNKKNANSANQMPVNNTNVINSQQTNDGMYQQQVVVSSKTYSLDEVLVNLADEDGK 60

Query: 98  DWLRLDIALICK----DIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV 153
            +++  I +  +        +     L   ++  +R+     I   +     K +I  ++
Sbjct: 61  RFIKAKIFIGYEEKKLSKELETKKPILRDAVIGVLRSKKAADIN-PKNIDKIKVEIINKI 119

Query: 154 K-LRSQGFVSSVIFRTFII 171
             +  +G +SS+ F   I+
Sbjct: 120 SPMLEKGRISSIYFDDLIV 138


>gi|295111383|emb|CBL28133.1| Flagellar basal body-associated protein [Synergistetes bacterium
           SGP1]
          Length = 151

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 43/121 (35%), Gaps = 13/121 (10%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLE----- 118
            S            +   I ++    +N   + +  +   ++L   +  +++        
Sbjct: 30  ASGEGGAAKAREVAEPGPIVTIGEFTSNLAGAGRHVVSFTVSLELVNKKEEIAAAVQNMG 89

Query: 119 ---TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +  +I+   +  +   +  A+G   F+ DI+  +         +  ++ V+F +F+
Sbjct: 90  WLVRIKNEILLIAKDKTYDDLNSAEGTVQFQGDIKRVLNSILPNVGGEAPIAQVLFESFV 149

Query: 171 I 171
           +
Sbjct: 150 L 150


>gi|330900025|gb|EGH31444.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. japonica str. M301072PT]
 gi|330938767|gb|EGH42301.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 135

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/118 (11%), Positives = 39/118 (33%), Gaps = 12/118 (10%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLE 118
            +     +    K   +    P + N+       LR       L +     +   K    
Sbjct: 17  AQEEAKEEGGPPKAAYVSLTPPFVGNYALDGGPKLRVYKADISLRVTGADAEAAVKRNDA 76

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
            +   +++     ++  ++ A+     +++  ++V+        +  V  ++F  FI+
Sbjct: 77  LIRNQLVSLFTQQTVDTMSSAEAKENIRQEALKQVQRVMNDEEGKPIVEDLLFNNFIV 134


>gi|225159022|ref|ZP_03725332.1| flagellar basal body-associated protein FliL [Opitutaceae bacterium
           TAV2]
 gi|224802401|gb|EEG20663.1| flagellar basal body-associated protein FliL [Opitutaceae bacterium
           TAV2]
          Length = 185

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/175 (8%), Positives = 46/175 (26%), Gaps = 5/175 (2%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           +     S +  G +  L      +   +      L  +  + +   ++        + + 
Sbjct: 10  AARAPDSDHKGGPRLPLKAWLRAILAILLTPVATLAVVQFVVVPQLRENLLVAAGKIPSP 69

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDI----ALICKDIPDKVFL 117
                 +  T +  +           ++    S    +L++      A            
Sbjct: 70  PPPRPLAGDTVNATASDAGSFKFEDVVVNLAGSMGTRYLKVSFIATGADKTLAAEFAQRK 129

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFV-SSVIFRTFII 171
             L    +  + ++S+  +  A      +E +           +   V F  F++
Sbjct: 130 AQLLDVTINVLSSLSLADLEEAGARNLLRERLVSSYNQTLGRRLAEQVYFTDFVV 184


>gi|239817143|ref|YP_002946053.1| flagellar basal body-associated protein FliL [Variovorax paradoxus
           S110]
 gi|239803720|gb|ACS20787.1| flagellar basal body-associated protein FliL [Variovorax paradoxus
           S110]
          Length = 165

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 36/100 (36%), Gaps = 10/100 (10%)

Query: 82  IFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKVF----LETLHQDIMAYIRTVSIKQI 136
             +L+P+  N  S  +  +L + +AL   D   K      +  +   ++  +     + +
Sbjct: 65  FVTLEPLTVNVQSEGRGRFLHVGVALKVHDEQAKARIVEFMPEIRSRVLLLLSNRPPESL 124

Query: 137 TGAQGFRYFKEDIEERVKL-----RSQGFVSSVIFRTFII 171
                     E+I   +            ++SV F TF++
Sbjct: 125 VTTADKARLAEEIRVELSRPLGAGLPPQEIASVSFNTFVV 164


>gi|85710791|ref|ZP_01041852.1| flagellar basal body-associated protein [Idiomarina baltica OS145]
 gi|85695195|gb|EAQ33132.1| flagellar basal body-associated protein [Idiomarina baltica OS145]
          Length = 135

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/113 (15%), Positives = 36/113 (31%), Gaps = 13/113 (11%)

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPKDW----LRLDIALICKDI----PDKVFLETLHQ 122
                +           IITNF    +++    +R+ + ++  +       +     L  
Sbjct: 21  ASAARAQDVAYYGFEPDIITNFIKDKEEYRLGFIRVAVEVMVDNPQNVSVVEHHAPLLRD 80

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
             +  + T S +QI    G    +    E+ +           +  VIF  +I
Sbjct: 81  AFIQILSTASEQQIRTMTGRDQLRLKCFEQAQRLMAKETGSTVIKQVIFTKYI 133


>gi|323703178|ref|ZP_08114831.1| flagellar basal body-associated protein FliL [Desulfotomaculum
           nigrificans DSM 574]
 gi|323531837|gb|EGB21723.1| flagellar basal body-associated protein FliL [Desulfotomaculum
           nigrificans DSM 574]
          Length = 151

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 35/98 (35%), Gaps = 10/98 (10%)

Query: 83  FSLQPIITNFDSSPK-DWLRLDIALICKDIPDKVFLET--------LHQDIMAYIRTVSI 133
           FS+  ++ N       +++RL   L  +D      L          L   I+  IRT  I
Sbjct: 52  FSIGSLLVNLADPGGANFMRLTPVLEYEDNKQNKKLAEELTKKKYVLQDAIIRVIRTKKI 111

Query: 134 KQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFI 170
             +   Q       +++  V     +G +  V F  ++
Sbjct: 112 ADVQPPQSIDKIAVELKNEVNKNLHEGQIYRVYFTEYL 149


>gi|302186801|ref|ZP_07263474.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. syringae 642]
          Length = 135

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/118 (11%), Positives = 39/118 (33%), Gaps = 12/118 (10%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLE 118
            +     +    K   +    P + N+       LR       L +     +   K    
Sbjct: 17  AQEEAKEEGGPPKAAYVSLTPPFVGNYALDGGPKLRVYKADIALRVTGSDAEAAVKRNDA 76

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
            +   +++     ++  ++ A+     +++  ++V+        +  V  ++F  FI+
Sbjct: 77  LIRNQLVSLFTQQTVDSMSSAEAKENIRQEALKQVQRVMNDEEGKPIVEDLLFNNFIV 134


>gi|331016124|gb|EGH96180.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 135

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/118 (11%), Positives = 39/118 (33%), Gaps = 12/118 (10%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLE 118
            +     +    K   +    P + N+       LR       L +     +   K    
Sbjct: 17  AQEEAKEEGGPPKAAYVSLTPPFVGNYALDGGPKLRVYKADIALRVTGADAEAAVKRNDA 76

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
            +   +++     ++  I+ A+     +++  ++V+        +  V  ++F  FI+
Sbjct: 77  LIRNQLVSLFTQQTVDSISSAEAKENIRQEALKQVQRVMNDEEGKPIVEDLLFNNFIV 134


>gi|119776754|ref|YP_929494.1| flagellar basal body-associated protein FliL-like protein
           [Shewanella amazonensis SB2B]
 gi|119769254|gb|ABM01825.1| flagellar protein FliL, putative [Shewanella amazonensis SB2B]
          Length = 133

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/117 (13%), Positives = 43/117 (36%), Gaps = 11/117 (9%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLE 118
            + +    +    +         I+TN+ S+ K   ++R+ + L+ K+  D    +    
Sbjct: 15  GMPAWAEEEKKLEEYAYYGFEPEIVTNYISNRKKLGFVRISVELMVKNPDDLIQIERHDP 74

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
            L   I+  +     ++I    G    + +    V    +G      + +++F  ++
Sbjct: 75  LLRAAIIEILGNQPEEKIKSLTGREEIRRECYAAVNRLIEGETGKALIVNLLFTRYL 131


>gi|26991885|ref|NP_747310.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas putida KT2440]
 gi|24987006|gb|AAN70774.1|AE016721_7 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 153

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/108 (13%), Positives = 38/108 (35%), Gaps = 12/108 (11%)

Query: 76  SLKKLQIFSLQPIITNFDSSPKDWLRL---DIALICKDIP----DKVFLETLHQDIMAYI 128
             K   I    P + N+       LR+   D+AL           K     +   ++A  
Sbjct: 45  VPKVAYISLSPPFVGNYALDGSPRLRVYKADVALRVTGDEAAKTVKHHEPLIRNQLVALF 104

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
              ++  ++  +   + +++  ++V+   +       V  ++F   I+
Sbjct: 105 TQQTVDSMSNVEAKEHLRQEALKQVQQVLEAEEGKPIVEDLLFNNLIV 152


>gi|325274681|ref|ZP_08140729.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas sp. TJI-51]
 gi|324100188|gb|EGB97986.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas sp. TJI-51]
          Length = 134

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 12/118 (10%), Positives = 36/118 (30%), Gaps = 12/118 (10%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLE 118
                     + K   I    P + N+       LR       L +         +    
Sbjct: 16  AAMAEEAKEGAPKVAYITLSPPFVGNYALDGGPRLRVYKADVALRVTGDEAAKAVQHHEP 75

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
            +   ++A     ++  ++  +   + +++  ++V+        +  V  ++F   I+
Sbjct: 76  LIRNQLVALFTQQTVDSMSNVEAKEHLRQEALKQVQQVMEAEEGKPIVEDLLFNNLIV 133


>gi|262276389|ref|ZP_06054198.1| flagellar biosynthesis protein FliL [Grimontia hollisae CIP 101886]
 gi|262220197|gb|EEY71513.1| flagellar biosynthesis protein FliL [Grimontia hollisae CIP 101886]
          Length = 164

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 61/181 (33%), Gaps = 28/181 (15%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ +D  +                     G     +  IV   L  G     +   + ++
Sbjct: 1   MADEDIEAGGG------------------GGKKKLIIIIVAALLLLGGGGGAFFFLMGSD 42

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALICKDIPDKVFL-- 117
                   +   + +SL+ + +   QP + N      +  +++ + L+ +   ++     
Sbjct: 43  SAAQDDIVLEEPEPVSLQAIYVTLPQPFVFNVTGDSQQRLVQVKVQLMVRGDQNETLAKQ 102

Query: 118 --ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
               +   ++      +++Q+   QG    ++   + V+     +  +  V  V+F  F+
Sbjct: 103 NLPLVEHSLLTTFGAATVEQLRTPQGQVEVRKQAVDTVQAAMEKITGKPVVERVLFTGFV 162

Query: 171 I 171
           +
Sbjct: 163 M 163


>gi|148550318|ref|YP_001270420.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas putida F1]
 gi|148514376|gb|ABQ81236.1| flagellar basal body-associated protein FliL [Pseudomonas putida
           F1]
          Length = 148

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/108 (13%), Positives = 38/108 (35%), Gaps = 12/108 (11%)

Query: 76  SLKKLQIFSLQPIITNFDSSPKDWLRL---DIALICKDIP----DKVFLETLHQDIMAYI 128
             K   I    P + N+       LR+   D+AL           K     +   ++A  
Sbjct: 40  VPKVAYISLSPPFVGNYALDGSPRLRVYKADVALRVTGDEAAKTVKHHEPLIRNQLVALF 99

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
              ++  ++  +   + +++  ++V+   +       V  ++F   I+
Sbjct: 100 TQQTVDSMSNVEAKEHLRQEALKQVQQVLEAEEGKPIVEDLLFNNLIV 147


>gi|66043583|ref|YP_233424.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. syringae B728a]
 gi|63254290|gb|AAY35386.1| Flagellar basal body-associated protein FliL [Pseudomonas syringae
           pv. syringae B728a]
 gi|330971829|gb|EGH71895.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 135

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/118 (11%), Positives = 39/118 (33%), Gaps = 12/118 (10%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLE 118
            +     +    K   +    P + N+       LR       L +     +   K    
Sbjct: 17  AQEEAKEEGGPPKAAYVSLTPPFVGNYALDGGPKLRVYKADIALRVTGADAEAAVKRNDA 76

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
            +   +++     ++  ++ A+     +++  ++V+        +  V  ++F  FI+
Sbjct: 77  LIRNQLVSLFTQQTVDSMSSAEAKENIRQEALKQVQRVMNDEEGKPIVEDLLFNNFIV 134


>gi|28872342|ref|NP_794961.1| flagellar protein FliL [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213971851|ref|ZP_03399953.1| flagellar protein FliL [Pseudomonas syringae pv. tomato T1]
 gi|257481858|ref|ZP_05635899.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289625068|ref|ZP_06458022.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289650224|ref|ZP_06481567.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298485172|ref|ZP_07003266.1| Flagellar biosynthesis protein fliL [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|301383388|ref|ZP_07231806.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. tomato Max13]
 gi|302064081|ref|ZP_07255622.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. tomato K40]
 gi|302134951|ref|ZP_07260941.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28855597|gb|AAO58656.1| flagellar protein FliL, putative [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213923397|gb|EEB56990.1| flagellar protein FliL [Pseudomonas syringae pv. tomato T1]
 gi|298160284|gb|EFI01311.1| Flagellar biosynthesis protein fliL [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330870346|gb|EGH05055.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330886081|gb|EGH19982.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. mori str. 301020]
 gi|330987957|gb|EGH86060.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331009493|gb|EGH89549.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 135

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/118 (11%), Positives = 39/118 (33%), Gaps = 12/118 (10%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLE 118
            +     +    K   +    P + N+       LR       L +     +   K    
Sbjct: 17  AQEEAKEEGGPPKAAYVSLTPPFVGNYALDGGPKLRVYKADIALRVTGADAEAAVKRNDA 76

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
            +   +++     ++  ++ A+     +++  ++V+        +  V  ++F  FI+
Sbjct: 77  LIRNQLVSLFTQQTVDSMSSAEAKENIRQEALKQVQRVMNDEEGKPIVEDLLFNNFIV 134


>gi|310816844|ref|YP_003964808.1| flagellar basal body-associated protein FliL [Ketogulonicigenium
           vulgare Y25]
 gi|308755579|gb|ADO43508.1| flagellar basal body-associated protein FliL [Ketogulonicigenium
           vulgare Y25]
          Length = 143

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/160 (14%), Positives = 50/160 (31%), Gaps = 23/160 (14%)

Query: 17  KLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTIS 76
            L +    V    G   G+L     L    G        F                    
Sbjct: 1   MLSMIVAGVLGLAGAAGGYLAVAQGLVRLPGGDVPVEAAFSA------------------ 42

Query: 77  LKKLQIFSLQPIITNFDSSP-KDWLRLDIALIC---KDIPDKVFLETLHQDIMAYIRTVS 132
            + +   +++P+I N  ++    +LR    L          +  +  +   +  Y+R V+
Sbjct: 43  PEPVSFIAMEPLIVNLPTASAGRYLRFTAQLEVPAASAPEVERVMPRITDVLNGYLRAVT 102

Query: 133 IKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
              +  A G    +  +  RV+    +G V +++    ++
Sbjct: 103 PADLADASGLMRMRGMMLRRVQAVAGEGNVRNILVMELVV 142


>gi|260774821|ref|ZP_05883723.1| flagellar biosynthesis protein FliL [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609246|gb|EEX35401.1| flagellar biosynthesis protein FliL [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 135

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/111 (11%), Positives = 41/111 (36%), Gaps = 11/111 (9%)

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDIPD----KVFLETLHQDI 124
             +    K         + TNF +  K   ++++ I ++  +  D    ++    +   +
Sbjct: 23  AEEGGEPKLAYFTLEPDLTTNFYTKGKQLGYIQVRIDIMVANETDLAIIELHQPLIRDAV 82

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
           +  +   S   IT   G    ++++ E++            ++ ++F  ++
Sbjct: 83  IELLGKQSSDTITSLAGREDLRKNLVEQLNSILLPETGRTIIADLLFTKYL 133


>gi|120597320|ref|YP_961894.1| flagellar basal body-associated protein FliL [Shewanella sp.
           W3-18-1]
 gi|146294535|ref|YP_001184959.1| flagellar basal body-associated protein FliL [Shewanella
           putrefaciens CN-32]
 gi|120557413|gb|ABM23340.1| flagellar basal body-associated protein FliL [Shewanella sp.
           W3-18-1]
 gi|145566225|gb|ABP77160.1| flagellar basal body-associated protein FliL [Shewanella
           putrefaciens CN-32]
          Length = 155

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 12/113 (10%), Positives = 37/113 (32%), Gaps = 10/113 (8%)

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKVF----LETLHQD 123
               +   +   + + L+  + +        ++ L+++L   +   K         +   
Sbjct: 42  ASEPEVEPVPVAKFYPLEKFVISIPGDKYPHYMLLEMSLKSYNPDMKTVLVEADPLIRNA 101

Query: 124 IMAYIRTVSIKQITGAQGFRYFKED-IEERVKLRSQGF----VSSVIFRTFII 171
           +M      + +Q+         + + +   VK+ S       +  V+F   +I
Sbjct: 102 MMKMFSRKTFEQLNHLDQLDGLQAEALILMVKVLSDNKLPSDIDEVLFTRMVI 154


>gi|71734895|ref|YP_272603.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71555448|gb|AAZ34659.1| flagellar protein FliL, putative [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320322153|gb|EFW78249.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331807|gb|EFW87745.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330872729|gb|EGH06878.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 135

 Score = 51.7 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 13/118 (11%), Positives = 39/118 (33%), Gaps = 12/118 (10%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLE 118
            +     +    K   +    P + N+       LR       L +     +   K    
Sbjct: 17  AQEEAKEEGGPPKAAYVSLTPPFVGNYALDGGPKLRVYKADIALRVTGADAEAAVKRNDA 76

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
            +   +++     ++  ++ A+     +++  ++V+        +  V  ++F  FI+
Sbjct: 77  LIRNQLVSLFTQQTVDSMSSAEAKENIRQEALKQVQRVMTDEEGKPIVEDLLFNNFIV 134


>gi|313501187|gb|ADR62553.1| Flagellar basal body-associated protein FliL-like protein
           [Pseudomonas putida BIRD-1]
          Length = 134

 Score = 51.7 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/108 (13%), Positives = 38/108 (35%), Gaps = 12/108 (11%)

Query: 76  SLKKLQIFSLQPIITNFDSSPKDWLRL---DIALICKDIP----DKVFLETLHQDIMAYI 128
             K   I    P + N+       LR+   D+AL           K     +   ++A  
Sbjct: 26  VPKVAYISLSPPFVGNYALDGSPRLRVYKADVALRVTGDEAAKTVKHHEPLIRNQLVALF 85

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
              ++  ++  +   + +++  ++V+   +       V  ++F   I+
Sbjct: 86  TQQTVDSMSNVEAKEHLRQEALKQVQQVLEAEEGKPIVEDLLFNNLIV 133


>gi|224438010|ref|ZP_03658949.1| flagellar basal body-associated protein FliL [Helicobacter cinaedi
           CCUG 18818]
 gi|313144456|ref|ZP_07806649.1| flagellar basal body protein FliL [Helicobacter cinaedi CCUG 18818]
 gi|313129487|gb|EFR47104.1| flagellar basal body protein FliL [Helicobacter cinaedi CCUG 18818]
          Length = 196

 Score = 51.7 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 25/179 (13%), Positives = 58/179 (32%), Gaps = 25/179 (13%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+ ++  +    G + K     FVV   + +    +G +V + +    + EK Q+     
Sbjct: 1   MAEEEK-AAPQSGGEKKSKAILFVVIGIVVVLLILVGIVVFMLMGGDDEGEKKQENTPQV 59

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQ--------------PIITNF-DSSPKDWLRLDIA 105
               +  S      I    + + S+               P   N    + K +L+  + 
Sbjct: 60  KTQATQPSQKAAQIIVGNTISVRSVDKLQPGLIYPAEGPIPFTVNLMTQTGKRYLKTSMQ 119

Query: 106 LICKDIPDKVF---------LETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL 155
                   K           +  +   +   + + SI+ +   +G    K++I +R+  
Sbjct: 120 FELDKDEAKAMATKAELDNKMPMIKDVVNEILSSKSIEDVATTKGKSRVKDEIVKRINE 178


>gi|90407074|ref|ZP_01215263.1| flagellar basal body-associated protein [Psychromonas sp. CNPT3]
 gi|90311796|gb|EAS39892.1| flagellar basal body-associated protein [Psychromonas sp. CNPT3]
          Length = 136

 Score = 51.3 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 12/118 (10%), Positives = 33/118 (27%), Gaps = 11/118 (9%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALIC----KDIPDKVFL 117
           +          +            IITN+    K   ++R+ + L+          +   
Sbjct: 17  SPAILADEEGEVKNDYQYFLLEPDIITNYIKIGKRIGFVRISVDLMVNSQSDYELLERHE 76

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
             +   I++     +  ++         ++   E V            +  +IF  ++
Sbjct: 77  PLIRDRIISIFGEQNEDKVKSISERELIRKHCLEDVNNLLFAETGTKPIKELIFTKYL 134


>gi|167036257|ref|YP_001671488.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas putida GB-1]
 gi|166862745|gb|ABZ01153.1| flagellar basal body-associated protein FliL [Pseudomonas putida
           GB-1]
          Length = 134

 Score = 51.3 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 12/107 (11%), Positives = 35/107 (32%), Gaps = 12/107 (11%)

Query: 77  LKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLETLHQDIMAYIR 129
            K   I    P + N+       LR       L +         +     +   ++A   
Sbjct: 27  PKVAYISLSPPFVGNYALDGGPRLRVYKADVALRVTGDEAAKAVQHHEPLIRNQLVALFT 86

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
             ++  ++  +   + +++  ++V+   +       V  ++F   I+
Sbjct: 87  QQTVDSMSNVEAKEHLRQEALKQVQQVLEAEEGKPIVEDLLFNNLIV 133


>gi|163749854|ref|ZP_02157099.1| flagellar basal body-associated protein [Shewanella benthica KT99]
 gi|161330368|gb|EDQ01347.1| flagellar basal body-associated protein [Shewanella benthica KT99]
          Length = 153

 Score = 51.3 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/113 (18%), Positives = 44/113 (38%), Gaps = 11/113 (9%)

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETLHQ 122
           V+  D I            +ITN+ SS K   ++R+ I L+ KD  D    +     L  
Sbjct: 39  VYAEDEIIDNYAYYGFEPDLITNYISSGKKLGFVRISIELMVKDPEDLIALEHHDPLLRA 98

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-----LRSQGFVSSVIFRTFI 170
            I+  + + +  ++    G    + +  + V         +  V +++F  ++
Sbjct: 99  AILEIMGSQTAYKVKSLTGREEIRRECYDTVNRLMEQEVGRPIVVNLLFTKYL 151


>gi|157377560|ref|YP_001476160.1| flagellar basal body-associated protein FliL-like protein
           [Shewanella sediminis HAW-EB3]
 gi|157319934|gb|ABV39032.1| flagellar basal body-associated protein FliL [Shewanella sediminis
           HAW-EB3]
          Length = 137

 Score = 51.3 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 17/115 (14%), Positives = 42/115 (36%), Gaps = 11/115 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETL 120
            +      I            +ITN+ S+ K   ++R+ I L+ KD  D    +     L
Sbjct: 21  GAYAEDGDIVDNYAYYGFEPDLITNYISTGKKMGFVRIGIELMVKDPDDLIALEHHDPLL 80

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
              I+  + + +  ++    G    + +  + V         +  + +++F  ++
Sbjct: 81  RAAILEIMGSQTADKVKSLTGREEIRRECYDTVNRLIERETGKAIIVNLLFTKYL 135


>gi|289674534|ref|ZP_06495424.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. syringae FF5]
          Length = 135

 Score = 51.3 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 13/118 (11%), Positives = 40/118 (33%), Gaps = 12/118 (10%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLE 118
            +     +  + K   +    P + N+       LR       L +     +   K    
Sbjct: 17  AQEEAKEEGGAPKAAYVSLTPPFVGNYALDGGPKLRVYKADISLRVTGADAEAAVKRNDA 76

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
            +   +++     ++  ++ A+     +++  ++V+        +  V  ++F  FI+
Sbjct: 77  LIRNQLVSLFTQQTVDTMSSAEAKENIRQEALKQVQRVMNDEEGKPIVEDLLFNNFIV 134


>gi|170724189|ref|YP_001751877.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas putida W619]
 gi|169762192|gb|ACA75508.1| flagellar basal body-associated protein FliL [Pseudomonas putida
           W619]
          Length = 134

 Score = 51.3 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 13/107 (12%), Positives = 32/107 (29%), Gaps = 12/107 (11%)

Query: 77  LKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLETLHQDIMAYIR 129
            K   I    P + N+       LR       L +         K     +   ++A   
Sbjct: 27  PKVSYISLSPPFVGNYALDGGPRLRVFKADVALRVTGEEAAKAVKHHEPLIRNQLVALFT 86

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
              +  ++        +++  ++V+        +  V  ++F   I+
Sbjct: 87  QQGVDNLSNVDAKEKLRQEALKQVQQVMEAEEGKPIVEDLLFNNLIV 133


>gi|330977243|gb|EGH77199.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 135

 Score = 51.3 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 13/118 (11%), Positives = 40/118 (33%), Gaps = 12/118 (10%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLE 118
            +     +  + K   +    P + N+       LR       L +     +   K    
Sbjct: 17  AQEEAKEEGGAPKAAYVSLTPPFVGNYALDGGPKLRVYKADISLRVTGADAEAAVKRNDA 76

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
            +   +++     ++  ++ A+     +++  ++V+        +  V  ++F  FI+
Sbjct: 77  LIRNQLVSLFTQQTVDTMSSAEAKENIRQEALKQVQRVMNDEEGKPIVEDLLFNNFIV 134


>gi|330951216|gb|EGH51476.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas syringae Cit 7]
          Length = 135

 Score = 50.9 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 13/118 (11%), Positives = 40/118 (33%), Gaps = 12/118 (10%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLE 118
            +     +  + K   +    P + N+       LR       L +     +   K    
Sbjct: 17  AQEEAKEEGGAPKAAYVSLTPPFVGNYALDGGPKLRVYKADISLRVTGADAEAAVKRNDA 76

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
            +   +++     ++  ++ A+     +++  ++V+        +  V  ++F  FI+
Sbjct: 77  LIRNQLVSLFTQQTVDSMSSAEAKENIRQEALKQVQRVMNDEEGKPIVEDLLFNNFIV 134


>gi|238751774|ref|ZP_04613262.1| hypothetical protein yrohd0001_35480 [Yersinia rohdei ATCC 43380]
 gi|238710045|gb|EEQ02275.1| hypothetical protein yrohd0001_35480 [Yersinia rohdei ATCC 43380]
          Length = 141

 Score = 50.9 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/164 (12%), Positives = 43/164 (26%), Gaps = 36/164 (21%)

Query: 20  VTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKK 79
           +   V+        G     ++                         +S       +   
Sbjct: 1   MILLVLIAVAASAGGGYSWWIL------------------------HKSKPAVAKATPVA 36

Query: 80  LQIFSLQPIITNFDSSP---KDWLRLDIALICKDI----PDKVFLETLHQDIMAYIRTVS 132
                L+    N  +        L + + L   D         +L  +   ++  +   S
Sbjct: 37  PVFMPLETFTVNLITPDNNLDRVLYIGLTLRLPDEFTRVELNNYLPEVRSRLLLLLSRQS 96

Query: 133 IKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
              ++   G +    +I+       VK +    VS V+F  FI+
Sbjct: 97  ADSLSNEAGKQRLVAEIKNVLSPPMVKGQPNQVVSDVLFTAFIL 140


>gi|312172111|emb|CBX80368.1| Flagellar FliL protein [Erwinia amylovora ATCC BAA-2158]
          Length = 160

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 23/178 (12%), Positives = 46/178 (25%), Gaps = 32/178 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   +  + KL +   V+   I                                    
Sbjct: 2   TNSAKAKSGKPKLLILILVILALIACGAAGYIVF--------------------QKMKAP 41

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIP----DKVFLE 118
                    +       ++L     N  +    P   L +   L   D         +L 
Sbjct: 42  TDPAAAAKLLPPPMPVFYALDTFTVNLINPDNDPDRVLYVGFTLRLPDEETRLRISDYLP 101

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
            +   ++  +   +   +   QG +     I+       V+ + Q  V+ V+F  FI+
Sbjct: 102 EVRSRLLLLLSRQTAASLGNEQGKQQLVTQIKRVLAPPLVQGQPQQVVTDVLFTAFIL 159


>gi|209696296|ref|YP_002264227.1| flagellar basal body-associated protein FliL-like protein
           [Aliivibrio salmonicida LFI1238]
 gi|208010250|emb|CAQ80581.1| putative flagellar basal body-associated protein FliL [Aliivibrio
           salmonicida LFI1238]
          Length = 136

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 13/116 (11%), Positives = 37/116 (31%), Gaps = 11/116 (9%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKD----IPDKVFLET 119
             +V   D  + K         + TNF ++ K   ++++ I ++  D       +     
Sbjct: 19  APAVLAADETTPKMGYFTLAPDLTTNFVTTGKKLGYIQVRIDIMVADNREVPLLEHHNPQ 78

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
           +   ++         +I    G    +++    +         +     ++F  +I
Sbjct: 79  IRNVLVEVFGQQPENRIKSLAGREEIRKECLTAINELLLAETGKTLAVDLLFTKYI 134


>gi|15895421|ref|NP_348770.1| flagellar protein FliL [Clostridium acetobutylicum ATCC 824]
 gi|15025144|gb|AAK80110.1|AE007715_15 Flagellar protein FliL [Clostridium acetobutylicum ATCC 824]
          Length = 171

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 16/142 (11%), Positives = 35/142 (24%), Gaps = 4/142 (2%)

Query: 31  IFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIIT 90
           I        V                      +    +    + ++       +    +T
Sbjct: 31  IAAALAYFFVFSKKSPTSTNTTATNAATTTEANVEENTYSFEEILTNLADTDGAKYIKVT 90

Query: 91  NFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIE 150
                     +L   L       K     +   I+  +R+          G    K++I+
Sbjct: 91  VAVGYSSKNSKLKEELEDTKEDIKT--PIMRDIIVNVLRSKKAADF-TPTGIDQMKKEIK 147

Query: 151 ERVK-LRSQGFVSSVIFRTFII 171
           E +      G + +V F   +I
Sbjct: 148 EGINPHLKNGQIDNVYFSNLVI 169


>gi|332669205|ref|YP_004452213.1| flagellar basal body-associated protein FliL [Cellulomonas fimi
           ATCC 484]
 gi|332338243|gb|AEE44826.1| flagellar basal body-associated protein FliL [Cellulomonas fimi
           ATCC 484]
          Length = 170

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 11/82 (13%), Positives = 28/82 (34%), Gaps = 1/82 (1%)

Query: 90  TNFDSSPKDWLRLDIALICKDIPDKVFLE-TLHQDIMAYIRTVSIKQITGAQGFRYFKED 148
            + + +   +LRL +AL       +           +A     SI +++          +
Sbjct: 87  ISLNLADGHYLRLGLALQVTADAHESPDPSKALDAAIALFSGRSIAEVSDPAVREQLTSE 146

Query: 149 IEERVKLRSQGFVSSVIFRTFI 170
           +   ++   +G V  V    ++
Sbjct: 147 LAHHLEELYEGEVMDVYLTNYV 168


>gi|209545594|ref|YP_002277823.1| flagellar basal body-associated protein FliL [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533271|gb|ACI53208.1| flagellar basal body-associated protein FliL [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 190

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 47/125 (37%), Gaps = 8/125 (6%)

Query: 54  QKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDI 111
           ++  +    +  V S  +     L    I  + PII+N DS      ++++   +     
Sbjct: 66  ERGGVAQKVEKDVASRESAADSVLHPPIILGIPPIISNLDSGDGRPVYVKITAKVEISGA 125

Query: 112 PDKV----FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIF 166
            D+      +  +      Y+     + I G  G    +E I  R+++  +   V+++  
Sbjct: 126 SDEASLQDRIPEIQDVFQTYLHETRPQDIRGN-GIYRLREAIMRRLRVDMAPLKVTNLYL 184

Query: 167 RTFII 171
             F++
Sbjct: 185 VDFLV 189


>gi|88858447|ref|ZP_01133089.1| flagellar basal body-associated protein [Pseudoalteromonas tunicata
           D2]
 gi|88820064|gb|EAR29877.1| flagellar basal body-associated protein [Pseudoalteromonas tunicata
           D2]
          Length = 131

 Score = 50.9 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 14/103 (13%), Positives = 35/103 (33%), Gaps = 12/103 (11%)

Query: 80  LQIFSLQPIITNFDSSPKD---WLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVS 132
                   +ITN+  +      ++R+ + L+ +D       +     L   I+  +    
Sbjct: 27  GYYGFEPDVITNYIGASNKKMGYVRVTVELMLQDMANLAVVEHHDPLLRDAIVEILSKEP 86

Query: 133 IKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
             +I    G    ++   E VK   +       +  ++F  ++
Sbjct: 87  EDKIKSLTGREEIRKKCVEAVKKLLKEETGNEIIRDILFTKYL 129


>gi|239908030|ref|YP_002954771.1| putative flagellar FliL protein [Desulfovibrio magneticus RS-1]
 gi|239797896|dbj|BAH76885.1| putative flagellar FliL protein [Desulfovibrio magneticus RS-1]
          Length = 133

 Score = 50.9 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 11/104 (10%), Positives = 33/104 (31%), Gaps = 4/104 (3%)

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKVFLE--TLHQDIMAYI 128
           G    + +    +      N D +     LRL   ++  D           + + I+ ++
Sbjct: 25  GQGEPVVRGGTVTYPSFDVNIDDNGGLGRLRLGFEVLFTDELGAKAAATLQVRESILLFL 84

Query: 129 RTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           R  S  ++   +G    +  +   +           + +  +++
Sbjct: 85  RGKSAAELLAPKGRDMLRAQLLAHINAAIGSPKAVKLFYLDYVV 128


>gi|77461665|ref|YP_351172.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas fluorescens Pf0-1]
 gi|77385668|gb|ABA77181.1| putative flagellar protein [Pseudomonas fluorescens Pf0-1]
          Length = 146

 Score = 50.6 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 36/121 (29%), Gaps = 12/121 (9%)

Query: 63  DNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKV 115
             +  +    +  + K   I    P + N+       L+       L +         K 
Sbjct: 25  PVAALAEEAKEGEAPKVNYITLSPPFVGNYGLDGTPKLKVYKADVALRVTGEEATKLVKA 84

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
               +   ++A     +   +   +G    +++  ++ +        +  V  ++F   I
Sbjct: 85  NEPLIRNQLVALFTQQTTDAMGSIEGKEKLRQEALKQTQQVMNDETGKPVVEDLLFNNLI 144

Query: 171 I 171
           I
Sbjct: 145 I 145


>gi|157373193|ref|YP_001471793.1| flagellar basal body-associated protein FliL [Shewanella sediminis
           HAW-EB3]
 gi|157315567|gb|ABV34665.1| flagellar basal body-associated protein FliL [Shewanella sediminis
           HAW-EB3]
          Length = 152

 Score = 50.6 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 11/121 (9%), Positives = 31/121 (25%), Gaps = 10/121 (8%)

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD----KV 115
              + +              + + L   + +        +L L++AL           K 
Sbjct: 31  QSPSIIGGPFVTQEKESNTAKFYPLDRFVISVPGDKYPHYLLLEMALKSSSPNVSRTLKE 90

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFI 170
               +   +M         Q+  +      +++    +            +  V+F   +
Sbjct: 91  ADPLVRNSLMKMFSRKHFNQLNDSHQLEALQKEALVLLSGVLSDNHYSIELEDVLFTRMV 150

Query: 171 I 171
           I
Sbjct: 151 I 151


>gi|162147487|ref|YP_001601948.1| flagellar fliL protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786064|emb|CAP55646.1| putative flagellar fliL protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 190

 Score = 50.6 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 47/125 (37%), Gaps = 8/125 (6%)

Query: 54  QKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDI 111
           ++  +    +  V S  +     L    I  + PII+N DS      ++++   +     
Sbjct: 66  ERGGVAQKVEKDVASRESAADSVLHPPIILGIPPIISNLDSGDGRPVYVKITAKVEISGA 125

Query: 112 PDKV----FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIF 166
            D+      +  +      Y+     + I G  G    +E I  R+++  +   V+++  
Sbjct: 126 SDEASLQDRIPEIQDVFQTYLHETRPQDIRGN-GIYRLREAIMRRLRVDMAPLKVTNLYL 184

Query: 167 RTFII 171
             F++
Sbjct: 185 VDFLV 189


>gi|24216273|ref|NP_713754.1| flagellar basal body-associated protein FliL [Leptospira
           interrogans serovar Lai str. 56601]
 gi|24197539|gb|AAN50772.1| flagellar basal body-associated protein FliL [Leptospira
           interrogans serovar Lai str. 56601]
          Length = 172

 Score = 50.6 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 12/106 (11%), Positives = 35/106 (33%), Gaps = 8/106 (7%)

Query: 74  TISLKKLQIFSLQPIITNFDSSPK-DWLRLDIAL------ICKDIPDKVFLETLHQDIMA 126
              +        +    +     +  ++++ +A                  E +   I  
Sbjct: 66  KPPIPLENYNFTEEFRIDTLDKGETHFVKMKLAFGIAKEDQTLSAELAERNEQMRDLIKL 125

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            +      ++   +    F+E+I+ +V  + ++G +  V F  FI+
Sbjct: 126 IVGRKFKDELINIEDQLDFREEIKAQVNHILTEGKIQEVYFTEFIV 171


>gi|260222424|emb|CBA31974.1| hypothetical protein Csp_D29800 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 118

 Score = 50.6 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 40/116 (34%), Gaps = 26/116 (22%)

Query: 82  IFSLQPIITNFDSSPKDWL-RLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQI 136
              +  ++ N      + + ++ I L   D       K +L T+   ++  I   +  ++
Sbjct: 2   YLPMDSMVVNLADPGGERVAQIGITLEVIDAKASDSVKAYLPTIRSSVLMLISQRTADEL 61

Query: 137 TGAQGFRYFKEDIEERVKLRSQGF---------------------VSSVIFRTFII 171
             A+G     EDI +   +   G                      V+ V+F +FI+
Sbjct: 62  LKAEGKEKLVEDILKAASVPFGGGEEEEESTSKKKKKKVVHVEYPVTGVLFSSFIV 117


>gi|325509567|gb|ADZ21203.1| Flagellar protein FliL [Clostridium acetobutylicum EA 2018]
          Length = 173

 Score = 50.6 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 16/142 (11%), Positives = 35/142 (24%), Gaps = 4/142 (2%)

Query: 31  IFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIIT 90
           I        V                      +    +    + ++       +    +T
Sbjct: 33  IAAALAYFFVFSKKSPTSTNTTATNAATTTEANVEENTYSFEEILTNLADTDGAKYIKVT 92

Query: 91  NFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIE 150
                     +L   L       K     +   I+  +R+          G    K++I+
Sbjct: 93  VAVGYSSKNSKLKEELEDTKEDIKT--PIMRDIIVNVLRSKKAADF-TPTGIDQMKKEIK 149

Query: 151 ERVK-LRSQGFVSSVIFRTFII 171
           E +      G + +V F   +I
Sbjct: 150 EGINPHLKNGQIDNVYFSNLVI 171


>gi|163797868|ref|ZP_02191812.1| hypothetical protein BAL199_20090 [alpha proteobacterium BAL199]
 gi|159176830|gb|EDP61398.1| hypothetical protein BAL199_20090 [alpha proteobacterium BAL199]
          Length = 161

 Score = 50.6 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 10/119 (8%), Positives = 34/119 (28%), Gaps = 7/119 (5%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKD------WLRLDIALICKDIPD 113
              +       +    S      + L   + N  ++          L ++++        
Sbjct: 42  AVEEKKDLGAPSTSKPSPIGAVTYVLSEFVVNVRTNRTYPVFLLLSLAVEMSSEAVRPKM 101

Query: 114 KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
                 +   ++ Y+  ++   + G  G +  ++   + V+       V +V      +
Sbjct: 102 VAQEPRIRDAMIVYLSGLTPSDLNGYDGIQRVRDQSWQIVQKFVDPKDVVNVQIMKLTV 160


>gi|292487986|ref|YP_003530863.1| flagellar FliL protein [Erwinia amylovora CFBP1430]
 gi|292899206|ref|YP_003538575.1| flagellar protein [Erwinia amylovora ATCC 49946]
 gi|291199054|emb|CBJ46165.1| flagellar protein [Erwinia amylovora ATCC 49946]
 gi|291553410|emb|CBA20455.1| Flagellar FliL protein [Erwinia amylovora CFBP1430]
          Length = 160

 Score = 50.6 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 23/178 (12%), Positives = 47/178 (26%), Gaps = 32/178 (17%)

Query: 6   TTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNS 65
           T S   +  + KL +   V+   I                                    
Sbjct: 2   TNSAKAKSGKPKLLILILVILALIACGAAGYIVF--------------------QKMKAP 41

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIP----DKVFLE 118
                    +       ++L     N  +    P   L +   L   D         +L 
Sbjct: 42  TDPAAAAKLLPPPMPVFYALDTFTVNLINPDNDPDRVLYVGFTLRLPDEETRLRISDYLP 101

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
            +   ++  +   +   +   QG +     I++      V+ + Q  V+ V+F  FI+
Sbjct: 102 EVRSRLLLLLSRQTAASLGNEQGKQQLVTQIKQVLAPPLVQGQPQQVVTDVLFTAFIL 159


>gi|71907475|ref|YP_285062.1| flagellar basal body-associated protein FliL [Dechloromonas
           aromatica RCB]
 gi|71847096|gb|AAZ46592.1| Flagellar basal body-associated protein FliL [Dechloromonas
           aromatica RCB]
          Length = 134

 Score = 50.2 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 11/95 (11%), Positives = 29/95 (30%), Gaps = 8/95 (8%)

Query: 85  LQPIITNFDSSPKDWLRLDIALICKDIP----DKVFLETLHQDIMAYIRTVSIKQITGAQ 140
            +P+I   +   +++L+  +                   +   I+  +       +   +
Sbjct: 39  PEPMIFTVNLGRENYLQFGLVFETASPEAAHLLAANKPRIQHKIILMLSDKESTNLRTLE 98

Query: 141 GFRYFKEDIEERVKLRSQG----FVSSVIFRTFII 171
           G +    +I E             +  V+F  F+I
Sbjct: 99  GKKALIAEIIELANQVIDEDEKTGIKEVLFTKFLI 133


>gi|330721396|gb|EGG99461.1| Flagellar biosynthesis protein FliL [gamma proteobacterium
           IMCC2047]
          Length = 93

 Score = 50.2 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 31/92 (33%), Gaps = 9/92 (9%)

Query: 89  ITNFDSSPKDWLRLDIALICKD----IPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRY 144
           +T      + +L++++ +  KD       K     +   +        +  +  AQG   
Sbjct: 1   MTVMSGGKQRYLQINVTIKTKDRGVLKLLKAHEPVVKSSLNNLFSAQDLNHMQSAQGRMD 60

Query: 145 FKEDIEERVKLRSQGF-----VSSVIFRTFII 171
             E+    V+           V  V+F  F++
Sbjct: 61  LNEEALAVVQTFITSKNEALKVDKVLFTDFVM 92


>gi|302343751|ref|YP_003808280.1| flagellar basal body-associated protein FliL [Desulfarculus baarsii
           DSM 2075]
 gi|301640364|gb|ADK85686.1| flagellar basal body-associated protein FliL [Desulfarculus baarsii
           DSM 2075]
          Length = 252

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/160 (11%), Positives = 43/160 (26%), Gaps = 8/160 (5%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
              +L +    +   + I  G                E    +++     +    +  G 
Sbjct: 99  KLKRLLLAVGSLVLVVAIAGGTGFWFSRQEAQKLPDAESLPPWMVRQAMPSVEDELMLGL 158

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSI 133
              +  L       I+       +  + L+                +   I   +R    
Sbjct: 159 EPFIVPLLDTKQGQIL-------RVVVTLESMDGLSKSSLIEKNLDVRDVIYRALRDRPA 211

Query: 134 KQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
            ++  A   R  +  I+  +     + +V  V F  F+I+
Sbjct: 212 SELQKANQNRLLQAQIKAELNHALGREWVHKVYFSQFLIS 251


>gi|327441045|dbj|BAK17410.1| flagellar basal body-associated protein [Solibacillus silvestris
           StLB046]
          Length = 141

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/108 (16%), Positives = 39/108 (36%), Gaps = 3/108 (2%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDI--ALICKDIPDKVFLETLHQDI 124
           +    G TI         +  I TN        + L I  +              +   +
Sbjct: 33  KEKPDGPTIDEIIESSVEIPEITTNLADGSFVRITLKIQGSDKKAGEELFKRDFQVKNIV 92

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +  +  +  + + G QG   F++ I+ +V  L  +G V+ V   ++++
Sbjct: 93  IQELSEMEEEALEGKQGKITFQDAIKSQVNELMQEGEVTQVYITSYVL 140


>gi|256833229|ref|YP_003161956.1| flagellar basal body-associated protein FliL [Jonesia denitrificans
           DSM 20603]
 gi|256686760|gb|ACV09653.1| flagellar basal body-associated protein FliL [Jonesia denitrificans
           DSM 20603]
          Length = 171

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 8/106 (7%), Positives = 25/106 (23%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDI 124
           +       +       ++++++ +  N        +   +  I     D           
Sbjct: 64  APSGEDDAEPEGPIAGEVYTIESMNINLAEGRYLRVGFGLQFIEGADVDHFDPAKARNAA 123

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFI 170
           +      S   I         +      +    +G V  V    ++
Sbjct: 124 IEVYSGQSFSDIMDPVTREALRVQYAGHLDELYEGEVMDVYLTDYV 169


>gi|187933446|ref|YP_001886054.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           B str. Eklund 17B]
 gi|187721599|gb|ACD22820.1| flagellar basal body-associated protein FliL [Clostridium botulinum
           B str. Eklund 17B]
          Length = 151

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/181 (8%), Positives = 53/181 (29%), Gaps = 41/181 (22%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           MS +++++   + ++ K+     V+++ I +   W      + +F   K  +        
Sbjct: 1   MSNENSSN---KKSKTKVIFLILVIFSVIILTSIWYLHSNNMIIFKESKIHE-------- 49

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPD------ 113
                                   L       + + K  + +  +++             
Sbjct: 50  --------------------VYVDLGEFTVGLNDTSKNRYFKGKLSVGYNKKDSIAKKQL 89

Query: 114 --KVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-FVSSVIFRTFI 170
             +  L  +   +  Y R             +  K+++ + +    Q   +  + F  ++
Sbjct: 90  AKENKLPVIKDIVNNYFRNRDYDFFNDLNNEKKIKQELLDVINKNLQDFKIIDIRFSQYL 149

Query: 171 I 171
           +
Sbjct: 150 L 150


>gi|183598648|ref|ZP_02960141.1| hypothetical protein PROSTU_02054 [Providencia stuartii ATCC 25827]
 gi|188020833|gb|EDU58873.1| hypothetical protein PROSTU_02054 [Providencia stuartii ATCC 25827]
          Length = 160

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/165 (13%), Positives = 46/165 (27%), Gaps = 32/165 (19%)

Query: 19  FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLK 78
            +  F +    G   G                              +        +  L 
Sbjct: 15  LLVLFALLAIAGAGFGGYTWW--------------------TTQQTANSVNEEEKSPKLS 54

Query: 79  KLQIFSLQPIITNFDS---SPKDWLRLDIALICKDIPDKVFL----ETLHQDIMAYIRTV 131
           +     L+P   N      SP   L ++I L   +   +  L      +   ++  +   
Sbjct: 55  QPIFMDLEPFTVNLPGLNESPDRVLYINITLRLANEKSRKQLHDFLPEVRSRLLLLLSEQ 114

Query: 132 SIKQITGAQGFRYFKEDIEERVK-LRSQG----FVSSVIFRTFII 171
             K ++   G     + I++ +      G     ++ V+F TFI+
Sbjct: 115 KPKALSTHDGKLQLMQAIKKTLSPTVIPGENDQEITDVLFTTFIL 159


>gi|261821167|ref|YP_003259273.1| flagellar basal body-associated protein FliL [Pectobacterium
           wasabiae WPP163]
 gi|261605180|gb|ACX87666.1| flagellar basal body-associated protein FliL [Pectobacterium
           wasabiae WPP163]
          Length = 161

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/183 (10%), Positives = 47/183 (25%), Gaps = 35/183 (19%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  D   Q   G +  +++   ++              ++                   
Sbjct: 1   MAMSDM--QVRPGRKRSVWLILLIIVALASTAAAGTAWWLLS------------------ 40

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS---SPKDWLRLDIALICKDIPDKVFL 117
                  +    +     +     L     N  +    P   L +   L   D   +   
Sbjct: 41  ---QKNAATAEQEAPPPPEPVFMPLDTFTVNLVNADNDPDRVLYVGFTLRLPDEATRTRF 97

Query: 118 ----ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGF----VSSVIFRT 168
                 +   ++  +       +   QG +   E I++ +      G     V+ V+F  
Sbjct: 98  TNYLPEVRSRLLLLLSRQDAIALANEQGKQKLIEQIKQVLSPPLVPGQPNQVVTDVLFTA 157

Query: 169 FII 171
           FI+
Sbjct: 158 FIL 160


>gi|134300238|ref|YP_001113734.1| flagellar basal body-associated protein FliL [Desulfotomaculum
           reducens MI-1]
 gi|134052938|gb|ABO50909.1| flagellar basal body-associated protein FliL [Desulfotomaculum
           reducens MI-1]
          Length = 119

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/113 (15%), Positives = 39/113 (34%), Gaps = 10/113 (8%)

Query: 68  SVHTGDTISLKKLQIFSLQPIITNFDSSPKD-WLRLDIALICK--------DIPDKVFLE 118
           +   G     +KL  +S+  ++ N   S  + ++RL   L  +                 
Sbjct: 5   ANAKGTGPDPEKLVTYSMGSLLVNLADSGGNSFMRLTPVLEYEQNKENKKLGEELTKNKV 64

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
            L   I+  IR   +K +   +      E+++  +      G +  V F  ++
Sbjct: 65  ILQDCIIRVIRKKKLKDVQPPESIDKVAEELKTEINSQLRHGKILRVYFSEYL 117


>gi|104784230|ref|YP_610728.1| flagellar basal body-associated protein FliL-like protein
           [Pseudomonas entomophila L48]
 gi|95113217|emb|CAK17945.1| Putative flagellar basal body-associated protein FliL [Pseudomonas
           entomophila L48]
          Length = 128

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/118 (11%), Positives = 33/118 (27%), Gaps = 12/118 (10%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDKVFLE 118
                       K   I    P + N+       LR       L +         K    
Sbjct: 10  AAMAEEAKEGEPKVSYITLSPPFVGNYALDGGPKLRVYKADVALRVTGDAAATAVKHHEP 69

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFII 171
            +   ++A      +  ++  +     +++  ++V+        +  V  ++F   I+
Sbjct: 70  LIRNQLVALFTQQGVDNMSNVEAKEKLRQEALKQVQQVMESEEGKPIVEDLLFNNLIV 127


>gi|332981444|ref|YP_004462885.1| flagellar basal body-associated protein FliL [Mahella australiensis
           50-1 BON]
 gi|332699122|gb|AEE96063.1| flagellar basal body-associated protein FliL [Mahella australiensis
           50-1 BON]
          Length = 143

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 16/166 (9%), Positives = 50/166 (30%), Gaps = 30/166 (18%)

Query: 11  IRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVH 70
            + N+  L+    VV     I   ++              +   + I     +  + +V 
Sbjct: 2   AKNNKSLLWTAMIVVLVAAVIIAYYMA----------SSNDASGQNIAEKKTEIFMPTVK 51

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----IPDKVFLETLHQDIMA 126
            G                      + + +L++ + +   +             ++  I++
Sbjct: 52  DGS---------------FVTNLKNSRHFLKVTMVIEVANSAILDEFTSKDYMVNDIIVS 96

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIFRTFII 171
            + + + ++          K +I   +  +  +G   ++ F  F+I
Sbjct: 97  VLSSKTDEESAEDGFQSKLKNEIISALNKKFGEGAAVNIYFNEFVI 142


>gi|294636876|ref|ZP_06715206.1| flagellar basal body-associated protein FliL [Edwardsiella tarda
           ATCC 23685]
 gi|291089906|gb|EFE22467.1| flagellar basal body-associated protein FliL [Edwardsiella tarda
           ATCC 23685]
          Length = 159

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/115 (14%), Positives = 36/115 (31%), Gaps = 12/115 (10%)

Query: 69  VHTGDTISLKKLQIFSLQPIITNF---DSSPKDWLRLDIALICKDIPDKVFL----ETLH 121
            H             +L P   N    D      L + I L   +   +  L      + 
Sbjct: 44  SHVAKQAPAPLPVFMALDPFTVNLLGNDDDSDRVLYVGITLRLPNELTRKRLNDYLPEVR 103

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEER-----VKLRSQGFVSSVIFRTFII 171
             ++  +       +   QG +   ++I+       +  ++   V+ V+F  FI+
Sbjct: 104 SRLLLLLSRQQASALATEQGKKALMDEIKATLRAPVINGQAGQVVNDVMFTAFIL 158


>gi|197285495|ref|YP_002151367.1| flagellar basal body-associated protein FliL [Proteus mirabilis
           HI4320]
 gi|227355986|ref|ZP_03840378.1| flagellar protein FliL [Proteus mirabilis ATCC 29906]
 gi|194682982|emb|CAR43411.1| flagellar protein FliL [Proteus mirabilis HI4320]
 gi|227163974|gb|EEI48876.1| flagellar protein FliL [Proteus mirabilis ATCC 29906]
          Length = 160

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/120 (17%), Positives = 39/120 (32%), Gaps = 12/120 (10%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDIPDKVFL--- 117
               +  T     +      SL+P   N           L + I L   D   +  L   
Sbjct: 40  AKSGTTGTSQQKVIPAPVFMSLEPFTINLIDEEEHLDRVLYIGITLRLHDENTRKRLHDY 99

Query: 118 -ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGF----VSSVIFRTFII 171
              +   ++  +      +I    G +    +I+E ++     G     +S V+F TFI+
Sbjct: 100 LPEVRSRLLLLLSRQHANKIATDAGKQQLMTEIKETLRPTLVPGESEQILSDVLFTTFIL 159


>gi|253573529|ref|ZP_04850872.1| flagellar basal body-associated protein FliL [Paenibacillus sp.
           oral taxon 786 str. D14]
 gi|251847057|gb|EES75062.1| flagellar basal body-associated protein FliL [Paenibacillus sp.
           oral taxon 786 str. D14]
          Length = 157

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/160 (12%), Positives = 43/160 (26%), Gaps = 18/160 (11%)

Query: 19  FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLK 78
            +T  +  T I +    L   +       +                      T       
Sbjct: 8   LITILLAITLIVLAAFLLVNQMNKPEPGTEVNAAVDSVAAPKKLSADELVQVTS------ 61

Query: 79  KLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQ-----DIMAYIRTVSI 133
                ++  I TN    P   + +D A        K   + +        I+  +     
Sbjct: 62  -----TIDDIKTNLSD-PDYVVVIDFAFQLDSAASKETFDKIKDYKIKPIIIKTLADTKP 115

Query: 134 KQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFIIA 172
           +++TGA G       +   +     +G +  +    FI++
Sbjct: 116 EELTGALGKDNLSSKLLNLINKSLPEGKLIQIDITDFIMS 155


>gi|150021177|ref|YP_001306531.1| flagellar basal body-associated protein FliL [Thermosipho
           melanesiensis BI429]
 gi|149793698|gb|ABR31146.1| flagellar basal body-associated protein FliL [Thermosipho
           melanesiensis BI429]
          Length = 173

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 13/172 (7%), Positives = 41/172 (23%), Gaps = 16/172 (9%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M  ++      +  +  + +   ++   +      +G ++ L      + ++ ++     
Sbjct: 1   MPEEEIQEAQPKKKKGIMGLLMPILIPLVVSLAVSVGVVMFLGNNTQPQTKQSEQATTAA 60

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120
                   +                         S    L   +             + +
Sbjct: 61  AIP-----IKAVVIQPGTYQTFMLKGGKEVAVIDS----LSFKVGSDQCRSLIAEKNDEI 111

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-------QGFVSSVI 165
              +M    +    +I    G    K+ I+  V   +       +  V  V 
Sbjct: 112 MDALMLIFLSKERTEINTPAGIELLKKQIKNAVNEITGFVGEKEKQGVIDVY 163


>gi|288960147|ref|YP_003450487.1| flagellar basal body-associated protein [Azospirillum sp. B510]
 gi|288912455|dbj|BAI73943.1| flagellar basal body-associated protein [Azospirillum sp. B510]
          Length = 167

 Score = 47.9 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/181 (9%), Positives = 43/181 (23%), Gaps = 25/181 (13%)

Query: 1   MSYDDTTSQYIRGNQHKL----FVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKF 56
           M     +++   G +             +      F G   G ++L   A          
Sbjct: 1   MGKASISAEPDHGGRMSFDRTGNQIILALLGLTLAFAGASAGSLLLLRPAPAHGAYAPPR 60

Query: 57  ILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-----DWLRLDIALICKDI 111
           I                          +L  +    +   +       + L+        
Sbjct: 61  IEAQQAA---------------PAVYAALPTLTVTLNDGGRLQELRVRVVLEFDPATPLE 105

Query: 112 PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFI 170
                L  +   I   +      ++ GA+G  Y K+ +            +  V+ +  +
Sbjct: 106 TVTPHLPRIADAISRRLLEADPAELRGAEGPLYVKDALRYVANKTMRPLKLRQVLIQDML 165

Query: 171 I 171
           +
Sbjct: 166 L 166


>gi|257866388|ref|ZP_05646041.1| predicted protein [Enterococcus casseliflavus EC30]
 gi|257871299|ref|ZP_05650952.1| predicted protein [Enterococcus gallinarum EG2]
 gi|257873096|ref|ZP_05652749.1| predicted protein [Enterococcus casseliflavus EC10]
 gi|257876001|ref|ZP_05655654.1| predicted protein [Enterococcus casseliflavus EC20]
 gi|257800346|gb|EEV29374.1| predicted protein [Enterococcus casseliflavus EC30]
 gi|257805463|gb|EEV34285.1| predicted protein [Enterococcus gallinarum EG2]
 gi|257807260|gb|EEV36082.1| predicted protein [Enterococcus casseliflavus EC10]
 gi|257810167|gb|EEV38987.1| predicted protein [Enterococcus casseliflavus EC20]
          Length = 170

 Score = 47.9 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/156 (11%), Positives = 46/156 (29%), Gaps = 8/156 (5%)

Query: 18  LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISL 77
           L +   +    I +  G +GG ++   F         +             + + + I  
Sbjct: 20  LSMVVLLPILLIVVVGGSIGGTLVTNHFL------TGEKTAAAETAKDSSKISSDEAIVA 73

Query: 78  KKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQ-I 136
               + +L           K  L + +A   K       +  +   ++  +R       +
Sbjct: 74  LDEFLVNLAKEDNQEQQYMKVNLSILVADEEKSAEATKNVAVIRDSVVNLLRQQKASGIL 133

Query: 137 TGAQGFRYFKEDIEERVKLRSQGFV-SSVIFRTFII 171
           + A+     K+ ++E +       +   V     +I
Sbjct: 134 SSAESVPNLKKALKETINQEYGSEIAKDVYVTDLVI 169


>gi|262273583|ref|ZP_06051397.1| flagellar biosynthesis protein FliL [Grimontia hollisae CIP 101886]
 gi|262222561|gb|EEY73872.1| flagellar biosynthesis protein FliL [Grimontia hollisae CIP 101886]
          Length = 140

 Score = 47.9 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 13/115 (11%), Positives = 40/115 (34%), Gaps = 11/115 (9%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETL 120
            S+ + +    +         I TNF +  +   ++ + + L+  D       +     +
Sbjct: 24  PSMASEEGNDTQFSYFTLEPEITTNFITEGRKLGFINVRVDLMVDDPSLLQMLEYHQPLI 83

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRS-----QGFVSSVIFRTFI 170
              I+  +   +  +I    G    ++   ++V         Q  ++ ++F  ++
Sbjct: 84  RDAIIEMLSQENEVRIKSLSGRESIRKACLDKVNAMLLAETNQKVLTDLLFTKYL 138


>gi|268589966|ref|ZP_06124187.1| flagellar basal body-associated protein FliL [Providencia rettgeri
           DSM 1131]
 gi|291314683|gb|EFE55136.1| flagellar basal body-associated protein FliL [Providencia rettgeri
           DSM 1131]
          Length = 159

 Score = 47.9 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/124 (14%), Positives = 43/124 (34%), Gaps = 12/124 (9%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSS---PKDWLRLDIALICKDIPDKV- 115
                +  +       ++ +     L+P   N   +   P   L + + L   +   +  
Sbjct: 35  TTQQGTQTASEEEKRPNMPQPIFMELEPFTVNLAGAANAPDRVLYIHVTLRLANEKSRKQ 94

Query: 116 ---FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFR 167
              +L  +   ++  +     K I   +G     +DI++ +        +   +S V+F 
Sbjct: 95  LHEYLPEVRSRLLLLLSEQKAKNIETHEGKLQLMKDIKQTLTPTLIPGDTDQDISDVLFT 154

Query: 168 TFII 171
           TFI+
Sbjct: 155 TFIL 158


>gi|330812496|ref|YP_004356958.1| flagellar basal body-associated protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327380604|gb|AEA71954.1| putative flagellar basal body-associated protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 138

 Score = 47.5 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 13/122 (10%), Positives = 35/122 (28%), Gaps = 12/122 (9%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLR-------LDIALICKDIPDK 114
              +       +  + K   I    P + N+       LR       L +         K
Sbjct: 16  AAMAEEGKEAKEGEAPKVSYITLSPPFVGNYGLDGSAKLRVYKADVALRVTGDAAAAAVK 75

Query: 115 VFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTF 169
                +   ++A     + + +   +     +++  ++ +        +  V  ++F   
Sbjct: 76  ANEPLIRNQLVALFAQQTTEAMNNLEAKEKLRQEALKQTQQVMNDETGKPMVDDLLFNNL 135

Query: 170 II 171
           II
Sbjct: 136 II 137


>gi|149191753|ref|ZP_01869992.1| hypothetical protein VSAK1_12452 [Vibrio shilonii AK1]
 gi|148834395|gb|EDL51393.1| hypothetical protein VSAK1_12452 [Vibrio shilonii AK1]
          Length = 135

 Score = 47.5 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 12/111 (10%), Positives = 39/111 (35%), Gaps = 11/111 (9%)

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPKD--WLRLDIALICKDIPD----KVFLETLHQDI 124
           + D+ +           + TNF +  K   ++++ I ++  D  D    +     +   +
Sbjct: 23  SADSTAPSLAYFTLEPELTTNFYTEGKRLGYVQVRIDVMVADASDLVIIEHHQPLIRDAV 82

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEE-----RVKLRSQGFVSSVIFRTFI 170
           +  +   +   I    G    +  + E      +    +  ++ ++F  ++
Sbjct: 83  VELLGRQNADVIKSLAGREEIRHALVENLNNLLLAETGKAVIADLLFTKYL 133


>gi|212637800|ref|YP_002314325.1| flagellar basal body-associated protein FliL [Shewanella
           piezotolerans WP3]
 gi|212559284|gb|ACJ31738.1| Flagellar basal body-associated protein FliL [Shewanella
           piezotolerans WP3]
          Length = 151

 Score = 47.5 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 10/111 (9%), Positives = 35/111 (31%), Gaps = 10/111 (9%)

Query: 71  TGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDIPDKVF----LETLHQDIM 125
           +     +   + + L   + +        +L L++A   +    +         +   +M
Sbjct: 40  SPSEDEIVTAKFYPLDKFVISVPGDDYPHYLLLEMAFKSRSKNVESTIKQADPVIRNSLM 99

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-----FVSSVIFRTFII 171
                    ++  +Q F   +++  + + +          +  V+F   +I
Sbjct: 100 KMFAKKHFNELNDSQQFESLQKEAHQLLTVVLAENEFSIELDDVLFTRMVI 150


>gi|332534494|ref|ZP_08410331.1| flagellar biosynthesis protein FliL [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036062|gb|EGI72539.1| flagellar biosynthesis protein FliL [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 132

 Score = 47.1 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 16/110 (14%), Positives = 35/110 (31%), Gaps = 12/110 (10%)

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKD---WLRLDIALICKD----IPDKVFLETLHQDIM 125
                          IITN+  +      ++R+ I L+  D       +     L   ++
Sbjct: 21  ARAESTVGYFGFEPDIITNYIGASSKKMGYVRVTIDLMLTDTSDIAVVEHHTPLLRDALV 80

Query: 126 AYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
             +     ++I    G    +    E++K        Q  +  V+F  ++
Sbjct: 81  EILSKEPEEKIKSLTGREEIRAKCAEKLKSLLKEETGQEIIREVLFTKYL 130


>gi|119468534|ref|ZP_01611625.1| hypothetical protein ATW7_10823 [Alteromonadales bacterium TW-7]
 gi|119448042|gb|EAW29307.1| hypothetical protein ATW7_10823 [Alteromonadales bacterium TW-7]
          Length = 132

 Score = 47.1 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 16/111 (14%), Positives = 35/111 (31%), Gaps = 12/111 (10%)

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPKD---WLRLDIALICKDIPD----KVFLETLHQDI 124
                           IITN+  +      ++R+ + L+  +  D    +     L   I
Sbjct: 20  SARAESTVGYFGFEPDIITNYIGASSKKMGYVRVTVDLMLSNNSDIAIVEHHTPLLRDAI 79

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFRTFI 170
           +        ++I    G    +    E++K        Q  +  V+F  ++
Sbjct: 80  VEIFSKEPEEKIKSLTGREEIRAKCIEKLKSLLKEETGQEIIREVLFTKYL 130


>gi|206896105|ref|YP_002246695.1| flagellar basal body-associated protein FliL [Coprothermobacter
           proteolyticus DSM 5265]
 gi|206738722|gb|ACI17800.1| flagellar basal body-associated protein FliL [Coprothermobacter
           proteolyticus DSM 5265]
          Length = 148

 Score = 47.1 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/113 (15%), Positives = 40/113 (35%), Gaps = 9/113 (7%)

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI----PDKVFL 117
                         S  +  +  L    TN  S+PK  +++ + L   D       +   
Sbjct: 27  APVVKDMGSNTAAQSKPEPVLQPLGKFTTNL-SNPKYIIQVTVNLEFYDKKALSEIQKMD 85

Query: 118 E---TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFV-SSVIF 166
                +  +++ Y +T+  +  +  +G    +++  +R+       V S V+F
Sbjct: 86  PSFLVIQDELLKYFKTLKPEDFSTDKGLSQIQDNFVKRINNLYGKTVLSDVLF 138


>gi|119385375|ref|YP_916431.1| flagellar basal body-associated protein FliL [Paracoccus
           denitrificans PD1222]
 gi|119375142|gb|ABL70735.1| flagellar basal body-associated protein FliL [Paracoccus
           denitrificans PD1222]
          Length = 160

 Score = 46.7 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 8/107 (7%), Positives = 27/107 (25%), Gaps = 4/107 (3%)

Query: 67  RSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD---IPDKVFLETLHQD 123
                    +   L    +  I+          L + + +          +  +  L   
Sbjct: 51  AKEQVAQAEAAPSLAFVDIPQIVLTLAGPRARTLVMTVKIETDQGHRAEVEHLIPRLLDS 110

Query: 124 IMAYIRTVSIKQITGAQGFRYFKEDIEER-VKLRSQGFVSSVIFRTF 169
              ++  +              ++++  R V +  +   + V+   F
Sbjct: 111 FNGFLADIDGTAFEKRGILDIVRDELATRAVFVLGREAFTDVLITEF 157


>gi|288959251|ref|YP_003449592.1| hypothetical protein AZL_024100 [Azospirillum sp. B510]
 gi|288911559|dbj|BAI73048.1| hypothetical protein AZL_024100 [Azospirillum sp. B510]
          Length = 174

 Score = 46.7 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/166 (14%), Positives = 51/166 (30%), Gaps = 26/166 (15%)

Query: 9   QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRS 68
               G+  +L +   VV   + +     GG + L     Q+                   
Sbjct: 31  PPQPGSPARLLII--VVIALLTLAGLAYGGGMALDRMLDQR------------------- 69

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDK--VFLETLHQDIMA 126
               +     K Q+  L  +    D S    +++ + L  K   D+   + E +   +  
Sbjct: 70  --RIEARMGPKPQLARLPALEVPLDGSRAVEMQVSLVLAPKVEADRILRYQERIADRLFQ 127

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
            +     + +TG+    + K  I+E V      G    +     ++
Sbjct: 128 TVSQAGAENLTGSGSADFLKARIKEAVNREAGTGLFRDIYIERMVV 173


>gi|297584046|ref|YP_003699826.1| flagellar basal body-associated protein FliL [Bacillus
           selenitireducens MLS10]
 gi|297142503|gb|ADH99260.1| flagellar basal body-associated protein FliL [Bacillus
           selenitireducens MLS10]
          Length = 143

 Score = 46.3 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/157 (13%), Positives = 39/157 (24%), Gaps = 26/157 (16%)

Query: 12  RGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHT 71
           +     + +   V  T IG+    L                                   
Sbjct: 3   KNRLVNIMLIILVGMTLIGVLALVLYTQFF-----------------------QAADPDA 39

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD--IPDKVFLETLHQDIMAYIR 129
             TI          + I TN  S+     +  I    +      +     +   I+  + 
Sbjct: 40  EPTIDEVIELSIETEEITTNLLSNHVIRAQFVIQTDNRHARNELEKRNFQVENIIIRELS 99

Query: 130 TVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVI 165
            +      G++G R  +E I   +  +   G V  V 
Sbjct: 100 DMREADFQGSEGIRNLEEQIRYEINQIMQDGHVVQVY 136


>gi|325109024|ref|YP_004270092.1| flagellar basal body-associated protein FliL [Planctomyces
           brasiliensis DSM 5305]
 gi|324969292|gb|ADY60070.1| flagellar basal body-associated protein FliL [Planctomyces
           brasiliensis DSM 5305]
          Length = 182

 Score = 46.3 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 49/169 (28%), Gaps = 10/169 (5%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           +  S    G+   L          I +    L   +          +     IL+    +
Sbjct: 15  EDQSPPSSGSGFWLKFAAVAGLLVIVMVVQILTLYMFFGQSGEANLDPNDPAILDAESLD 74

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIAL---ICKDIPDKVFLETLH 121
                 T  T      Q  S   +    +      L +++        +   K     + 
Sbjct: 75  D-----TSTTEIDISPQFNSTNSLSQQGEIHVSFNLHVEVPTNLAESFNEAKKNHKNKIR 129

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
           Q ++  IR   I+++         K  I E +  + +Q FV+ VI   +
Sbjct: 130 QSVITIIRNAGIEELNDP-YLSVIKRQIREDINKILNQSFVTGVIITDY 177


>gi|87120337|ref|ZP_01076232.1| flagellar protein FliL, putative [Marinomonas sp. MED121]
 gi|86164440|gb|EAQ65710.1| flagellar protein FliL, putative [Marinomonas sp. MED121]
          Length = 134

 Score = 46.3 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/116 (12%), Positives = 39/116 (33%), Gaps = 11/116 (9%)

Query: 66  VRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI------PDKVFLET 119
             S    +  S   + I      I N+ +       +  ++  +          +  +  
Sbjct: 17  ASSAFAENDSSELPVYIELRPDFIVNYTTDNNRLKYIKASITIRATGAQNAGIIESNMPI 76

Query: 120 LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
           +   ++ Y+  +  +Q+TGA      ++     +  + +       V  V+F +F+
Sbjct: 77  VRDGLVIYLSELRAEQVTGAIAREESRKGAAIFLNEKLKEETGIEPVKDVLFSSFV 132


>gi|226313059|ref|YP_002772953.1| flagellar FliL protein [Brevibacillus brevis NBRC 100599]
 gi|226096007|dbj|BAH44449.1| flagellar FliL protein [Brevibacillus brevis NBRC 100599]
          Length = 151

 Score = 46.3 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/121 (11%), Positives = 39/121 (32%), Gaps = 3/121 (2%)

Query: 53  YQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIP 112
                  +  +  V+ +  G+              ++TN          +          
Sbjct: 33  SPAAQTASTEEQEVKPLTAGEIKEFSVDTGEITTNLLTNNYMI--VRFSITADSSAAKTE 90

Query: 113 DKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
            +  L  ++Q I+  +  ++ + I G +G    +  I   +  L  +G +  V+    ++
Sbjct: 91  LEQRLPQVNQVIIKTLAGLTPEDIKGTEGVNKLEAKIMNEISSLMQEGKIVQVVTTKRVL 150

Query: 172 A 172
           +
Sbjct: 151 S 151


>gi|304438435|ref|ZP_07398375.1| flagellar basal body-associated protein FliL [Selenomonas sp. oral
           taxon 149 str. 67H29BP]
 gi|304368518|gb|EFM22203.1| flagellar basal body-associated protein FliL [Selenomonas sp. oral
           taxon 149 str. 67H29BP]
          Length = 173

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/184 (11%), Positives = 52/184 (28%), Gaps = 25/184 (13%)

Query: 1   MSYD--DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFIL 58
           M+ +  +  ++  +     L +   VV   +       G    +F  A            
Sbjct: 1   MAEEKEEQVAEQPKQKSPMLMMIVVVVVAVLVAVAAAGGISYYIFSQAESPSHAEDGGSS 60

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP-KDWLRLDIALIC--------- 108
              +D  V                     I+ N        +L+  I +           
Sbjct: 61  KASHDPGVFYKLGDPKE-----------GILVNVGGGRAGKYLKAGIVMELNPGKSDVVK 109

Query: 109 KDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFR 167
               + V    +    M ++R   +++    +     K+ +++ +     QG V  V   
Sbjct: 110 DGKVNPVAETKILDTTMQFLRAAPLEEFDATK-QDALKKQLKDALNDRLGQGSVYDVYIT 168

Query: 168 TFII 171
           +F++
Sbjct: 169 SFLL 172


>gi|312879598|ref|ZP_07739398.1| flagellar basal body-associated protein FliL [Aminomonas
           paucivorans DSM 12260]
 gi|310782889|gb|EFQ23287.1| flagellar basal body-associated protein FliL [Aminomonas
           paucivorans DSM 12260]
          Length = 148

 Score = 45.5 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/170 (14%), Positives = 47/170 (27%), Gaps = 35/170 (20%)

Query: 13  GNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTG 72
           G +  +F+   VV   +GI  G   G                                  
Sbjct: 2   GKKTVIFLILGVVVLLLGIGGGVFVGFKFFSGGEK------------------------T 37

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLE------TLHQDIMA 126
               L       L     N        L+L I L  ++      L        L  +++ 
Sbjct: 38  AQKVLPPGPSVPLGSFTINLADPEPHILQLGITLELENDKASELLAQAGWISRLKNEVLL 97

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFII 171
            ++    + +  A+G +   +D+  R+            +  V+F  F++
Sbjct: 98  TVKDRRFEDLKHAEGVQALAQDLRGRMNALLPQVKGVVPIRQVLFEEFML 147


>gi|307718610|ref|YP_003874142.1| flagellar protein [Spirochaeta thermophila DSM 6192]
 gi|306532335|gb|ADN01869.1| flagellar protein [Spirochaeta thermophila DSM 6192]
 gi|315186377|gb|EFU20137.1| flagellar basal body-associated protein FliL [Spirochaeta
           thermophila DSM 6578]
          Length = 180

 Score = 45.5 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/72 (15%), Positives = 27/72 (37%), Gaps = 2/72 (2%)

Query: 99  WLRLDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRS 157
           +L   +               L   I  +  +   +++   Q     KE+++ ++  + +
Sbjct: 105 YLGYKVNDKALQTELNERRPYLRDLIRRFFSSKRAEELR-PQYEEMIKEELKAKINDVLT 163

Query: 158 QGFVSSVIFRTF 169
            G V  ++F TF
Sbjct: 164 SGMVQDIVFDTF 175


>gi|288960061|ref|YP_003450401.1| hypothetical protein AZL_a03260 [Azospirillum sp. B510]
 gi|288912369|dbj|BAI73857.1| hypothetical protein AZL_a03260 [Azospirillum sp. B510]
          Length = 135

 Score = 45.5 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 14/112 (12%), Positives = 37/112 (33%), Gaps = 5/112 (4%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALI----CKDIPDKVFLETL 120
           + R             +  +L  +      S    + + + L           + ++  +
Sbjct: 23  ASRGRSPASQAQGPDKKYAALPMMTFTLGGSDARLVDVKVLLEIDPTVDGKVAEPYVPRI 82

Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQG-FVSSVIFRTFII 171
              +   +R +  +Q+TGA G +  K  I   +    +G  V  ++    ++
Sbjct: 83  TDRLSDQMRQLDPQQLTGADGAKLMKSTIAGVLDRELRGVRVREILLDRMVV 134


>gi|220903604|ref|YP_002478916.1| flagellar basal body-associated protein FliL [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219867903|gb|ACL48238.1| flagellar basal body-associated protein FliL [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 221

 Score = 45.5 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 33/123 (26%), Gaps = 6/123 (4%)

Query: 54  QKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK-DWLRLDIALICKDI- 111
                       V  V +          +  L P +          +L    + I K   
Sbjct: 97  TAPPPPPEIKPEVIVVPSQPVDVPPADYVKELAPFVVPRQVDGTARFLVCKFSTISKSPS 156

Query: 112 ---PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFR 167
                   + +L   +  Y+   S   +         K D+   +    S G +  V+F 
Sbjct: 157 VSGEMDHKMISLRDALFFYLSGKSDDYLLNPGNAVTIKRDLTSILNDYLSSGRIDDVLFE 216

Query: 168 TFI 170
           +++
Sbjct: 217 SYL 219


>gi|226327726|ref|ZP_03803244.1| hypothetical protein PROPEN_01599 [Proteus penneri ATCC 35198]
 gi|225203430|gb|EEG85784.1| hypothetical protein PROPEN_01599 [Proteus penneri ATCC 35198]
          Length = 160

 Score = 45.5 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 38/120 (31%), Gaps = 12/120 (10%)

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSP---KDWLRLDIALICKDIPDKVFL--- 117
               S  T     +      SL+P   N           L + I L   +   +  L   
Sbjct: 40  AKSGSAGTSQQKVIPAPVFMSLEPFTVNLIDDEEHLDRVLYIGITLRLHNEDTRKRLHDY 99

Query: 118 -ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGF----VSSVIFRTFII 171
              +   ++  +      ++    G      D++E ++     G     +S V+F TFI+
Sbjct: 100 LPEVRSRLLLLLSRQQANKLATDNGKLQLMTDVKETLRPTLVPGESEQILSDVLFTTFIL 159


>gi|212709506|ref|ZP_03317634.1| hypothetical protein PROVALCAL_00548 [Providencia alcalifaciens DSM
           30120]
 gi|212687844|gb|EEB47372.1| hypothetical protein PROVALCAL_00548 [Providencia alcalifaciens DSM
           30120]
          Length = 161

 Score = 45.5 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 42/124 (33%), Gaps = 12/124 (9%)

Query: 60  NFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS---SPKDWLRLDIALICKDIPDKV- 115
              +    +       ++ +     L+P   N      +    L + I L   +   +  
Sbjct: 37  TKQEALDTTNGEEKRPNMPQPIFMELEPFTVNLPGLNNAADRVLYIHITLRLANEKSRKQ 96

Query: 116 ---FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-----SQGFVSSVIFR 167
              +L  +   ++  +     K ++  +G     +DI+  +        +   +S V+F 
Sbjct: 97  LHEYLPEVRSRLLLLLSEQQAKNMSTHEGKLQLMKDIKGTLTPTLIPGDTDQDISDVLFT 156

Query: 168 TFII 171
           TFI+
Sbjct: 157 TFIL 160


>gi|260771648|ref|ZP_05880568.1| flagellar biosynthesis protein FliL [Vibrio metschnikovii CIP
           69.14]
 gi|260613425|gb|EEX38624.1| flagellar biosynthesis protein FliL [Vibrio metschnikovii CIP
           69.14]
          Length = 75

 Score = 44.8 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 6/72 (8%), Positives = 23/72 (31%), Gaps = 5/72 (6%)

Query: 104 IALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF--- 160
           +A        ++    +   ++  +   +   I    G    ++ + E +          
Sbjct: 2   VANSADLPLIELHQPLIRDAVIEQLGKQTEDSIRSLAGRENLRKTLVEDLNNILLPETGR 61

Query: 161 --VSSVIFRTFI 170
             ++ ++F  +I
Sbjct: 62  TLIADLLFTKYI 73


>gi|294500929|ref|YP_003564629.1| flagellar basal body-associated protein FliL [Bacillus megaterium
           QM B1551]
 gi|294350866|gb|ADE71195.1| flagellar basal body-associated protein FliL [Bacillus megaterium
           QM B1551]
          Length = 143

 Score = 44.8 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/110 (17%), Positives = 39/110 (35%), Gaps = 3/110 (2%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLETLHQ 122
              S   G +I         +  I TN  S+    +   I +  K      +     +  
Sbjct: 33  GQASTEKGPSIDDVIKASVDVTDIKTNLKSNNYISISFKIQMDSKKAAAELQKRDFQVRD 92

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
            I+  +  +S +   G QG    + DI +++ +L   G V  +   + ++
Sbjct: 93  IIIKRLSDMSAQDFEGTQGLSTLETDIAKQIDQLMENGHVVKIYTTSKVL 142


>gi|226225728|ref|YP_002759834.1| flagellar FliL protein [Gemmatimonas aurantiaca T-27]
 gi|226088919|dbj|BAH37364.1| flagellar FliL protein [Gemmatimonas aurantiaca T-27]
          Length = 189

 Score = 44.4 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/185 (11%), Positives = 53/185 (28%), Gaps = 18/185 (9%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWL------GGIVMLFLFAGQKEEKYQKFIL 58
           +        ++ KL +   +V   + +  G             +          +     
Sbjct: 4   EQPQAEAAPSKPKLPILIGMVAVGLAVGGGTGAALLGPMVAKKMGKTTPIVAAAHADSGA 63

Query: 59  NNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNF-------DSSPKDWLRLDIALI---- 107
                    +   G+    +  +  +   ++           S    +L L +A+     
Sbjct: 64  EGAEGEHGEAAAGGEHGGAEGKEAGAAASVLLLENLVLNPAGSGGSRFLLLSVAIEAGKA 123

Query: 108 CKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLR-SQGFVSSVIF 166
                 K     L   I+  + T ++ ++T       FK +++  V  R  +  V  + F
Sbjct: 124 TALEQFKARDAELRDIILTALGTKTVDELTDISKREIFKTELQAAVDGRFGKQTVKRLYF 183

Query: 167 RTFII 171
             F++
Sbjct: 184 PQFVV 188


>gi|283782104|ref|YP_003372859.1| flagellar basal body-associated protein FliL [Pirellula staleyi DSM
           6068]
 gi|283440557|gb|ADB18999.1| flagellar basal body-associated protein FliL [Pirellula staleyi DSM
           6068]
          Length = 166

 Score = 44.4 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 30/164 (18%), Positives = 45/164 (27%), Gaps = 15/164 (9%)

Query: 17  KLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTIS 76
           K  +   VV   I   C     ++         E    K         S  S  T  T  
Sbjct: 2   KSMLVMIVVCVVILTECAVAYVLI---PSPEALEAAATKSSEEAEKAASDASTTTDGTTP 58

Query: 77  LKKLQIFSLQPIITNFDSSPKDW-LRLDIALICKDIPDKVFLE---------TLHQDIMA 126
                   L            +  LR++  LI     +K              L   I+ 
Sbjct: 59  TAAEMEVDLGKFNVVVHQPGANLTLRINFHLIGTVPSEKHEEFGKLLTHNQHRLRDQIIY 118

Query: 127 YIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTF 169
            IR  +I  +T   G    K  I  +   L     +++V+F  F
Sbjct: 119 EIRNSAIADLTDP-GLGLIKRRILAKSNDLLGAPMLTTVVFSDF 161


>gi|120601212|ref|YP_965612.1| flagellar basal body-associated protein FliL [Desulfovibrio
           vulgaris DP4]
 gi|120561441|gb|ABM27185.1| flagellar basal body-associated protein FliL [Desulfovibrio
           vulgaris DP4]
          Length = 235

 Score = 44.4 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/177 (11%), Positives = 49/177 (27%), Gaps = 17/177 (9%)

Query: 2   SYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNF 61
           + ++  ++       KL +    V   +G   G     V+                    
Sbjct: 68  APEEKPAKKSLFADRKLLIMLVAVVLLLGGGGGATWWFVLRTP----------PEKAAGP 117

Query: 62  YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWLRLDIALICKDI----PDKV 115
               V S      +      + SL+P             +L    A    D       + 
Sbjct: 118 KTVVVPSEPAPAEVPKASTPVVSLEPFWVEQRDMDGQIRFLVCKFAAPATDPKLIHEIQG 177

Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
               +   +  Y++  S+  +T        K+D+   +    S G +  ++   +++
Sbjct: 178 KKVVIRDAVYYYLKNKSLVFLTDGANAETLKKDLLTIINGYLSLGKLEDLLIENYLV 234


>gi|291286753|ref|YP_003503569.1| flagellar basal body-associated protein FliL [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290883913|gb|ADD67613.1| flagellar basal body-associated protein FliL [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 161

 Score = 44.4 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/162 (10%), Positives = 44/162 (27%), Gaps = 18/162 (11%)

Query: 14  NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73
            +  +FV   ++   I       GG +   +    K+                   +   
Sbjct: 11  KRTIIFVASIIILAVIAYLIYVYGGSLKFLVSGKAKQTNA-------------FEDYDVV 57

Query: 74  TISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKD----IPDKVFLETLHQDIMAYIR 129
                 +     + +IT+     + + R D+ +  +D           + +   I   + 
Sbjct: 58  KRYGSGIYNVEFRDLITSAGGMERHYYRYDLTVQAEDQPSADKMIDTRKQVITLINGVMS 117

Query: 130 TVSIKQITGAQGFRYFKEDIEERVKLRSQG-FVSSVIFRTFI 170
                ++         K+ I+  +        V  + F  F+
Sbjct: 118 NFETSEMNTEAERNRVKKIIQSEITGHYPNIKVKDIYFTNFL 159


>gi|295706275|ref|YP_003599350.1| flagellar basal body-associated protein FliL [Bacillus megaterium
           DSM 319]
 gi|294803934|gb|ADF41000.1| flagellar basal body-associated protein FliL [Bacillus megaterium
           DSM 319]
          Length = 143

 Score = 44.0 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/110 (17%), Positives = 39/110 (35%), Gaps = 3/110 (2%)

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK--DIPDKVFLETLHQ 122
              S   G +I         +  I TN  S+    +   I +  K      +     +  
Sbjct: 33  EQASTEKGPSIDDVIKASVDVTDIKTNLKSNNYISISFKIQMDSKKAAAELQKRDFQVRD 92

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERV-KLRSQGFVSSVIFRTFII 171
            I+  +  +S +   G QG    + DI +++ +L   G V  +   + ++
Sbjct: 93  IIIKRLSDMSAQDFEGTQGLSALETDIAKQIDQLMENGHVVKIYTTSKVL 142


>gi|323698083|ref|ZP_08109995.1| flagellar basal body-associated protein FliL [Desulfovibrio sp.
           ND132]
 gi|323458015|gb|EGB13880.1| flagellar basal body-associated protein FliL [Desulfovibrio
           desulfuricans ND132]
          Length = 232

 Score = 44.0 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/174 (9%), Positives = 55/174 (31%), Gaps = 9/174 (5%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDN 64
           +T      G + +L +   +   F+ +  G +  +V+L +       + +          
Sbjct: 60  ETPLLTEDGGKPRLGLVALLKNKFVLMGLGVI--LVLLAVIVILLLREPETPPPPPPPVE 117

Query: 65  SVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPD------KVFLE 118
                            I  L P +            L+++++     +      K    
Sbjct: 118 ETAIPQPEPEAPETPQIIVKLDPFLIEQVDEAGKIRFLEVSILLSTEDEGLARQFKQETY 177

Query: 119 TLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL-RSQGFVSSVIFRTFII 171
            +   +  Y++   ++ ++  +     K+++   +      G   +++F  +++
Sbjct: 178 AVRNALYYYLKNKDLEFLSDKENSEKLKKELLVIINQYMGFGQFDTLMFEQYLV 231


>gi|167464157|ref|ZP_02329246.1| FliL [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322382383|ref|ZP_08056290.1| FliL-like protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321153736|gb|EFX46111.1| FliL-like protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 94

 Score = 44.0 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 15/93 (16%), Positives = 38/93 (40%), Gaps = 6/93 (6%)

Query: 85  LQPIITNFDSSPKDWLRLDIALICKDIPDKVFLE-----TLHQDIMAYIRTVSIKQITGA 139
           +   +T   +SP  ++++  A        K  LE      +   I+  +  ++ +Q+ G+
Sbjct: 1   MVKDVTTNLASPGTFVKVSFAFEMDSKKAKADLENLLDSRVKGTIIRTLSDMTAEQVQGS 60

Query: 140 QGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
           +G     + +E+ +     +G V  V     ++
Sbjct: 61  KGQDNLTKTLEKLINDQIKEGKVRQVSITDIVV 93


>gi|239996985|ref|ZP_04717509.1| flagellar basal body-associated protein FliL-like protein
           [Alteromonas macleodii ATCC 27126]
          Length = 137

 Score = 44.0 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 14/113 (12%), Positives = 35/113 (30%), Gaps = 12/113 (10%)

Query: 70  HTGDTISLKKLQIFSLQPIITNFDSSPK---DWLRLDIALICKD----IPDKVFLETLHQ 122
                       +     I+TN+ S       ++R+ + L+  D       +  +  L  
Sbjct: 21  TAVAQDKANYAYLGLEPEIVTNYISDSAQKLGYVRVSVELMIHDVNQLEIAEHHMPLLRS 80

Query: 123 DIMAYIRTVSIKQITGAQGFRYFKEDIEERV-----KLRSQGFVSSVIFRTFI 170
             +        +++    G    +  I + +     +      V +VIF  ++
Sbjct: 81  TAIEIFGQQPAEKVKSLTGREDIRRAILKALQEHMKQETGGEVVKNVIFTKYL 133


>gi|315125870|ref|YP_004067873.1| flagellar basal body-associated protein FliL-like protein
           [Pseudoalteromonas sp. SM9913]
 gi|315014384|gb|ADT67722.1| flagellar basal body-associated protein FliL-like protein
           [Pseudoalteromonas sp. SM9913]
          Length = 132

 Score = 43.6 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 12/111 (10%), Positives = 32/111 (28%), Gaps = 12/111 (10%)

Query: 72  GDTISLKKLQIFSLQPIITNFDSSPKD---WLRLDIALICKD----IPDKVFLETLHQDI 124
                           IITN+         ++R+ + L+          +     L   +
Sbjct: 20  SARAESTVGYFGFEPDIITNYIGPSSKKMGYVRVTVDLMLNKTSDIAIVEHHTPLLRDAL 79

Query: 125 MAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGF-----VSSVIFRTFI 170
           +  +      +I    G    +    E++K   +       +  ++F  ++
Sbjct: 80  VEILSKEPENKIKSLTGREQIRLKSAEKLKSLLKEETGHEIIRDLLFTKYL 130


>gi|328948404|ref|YP_004365741.1| flagellar basal body-associated protein FliL [Treponema
           succinifaciens DSM 2489]
 gi|328448728|gb|AEB14444.1| flagellar basal body-associated protein FliL [Treponema
           succinifaciens DSM 2489]
          Length = 184

 Score = 43.6 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/172 (12%), Positives = 48/172 (27%), Gaps = 14/172 (8%)

Query: 4   DDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYD 63
           DD  ++   G +  +   +  +  FI I         ++F+                   
Sbjct: 12  DDIGAEVSTGKKSGIKGAFPQLLKFILIGVAA-----VIFIVTIVVVTTAILNKGGKTPS 66

Query: 64  NSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDI------PDKVFL 117
            S+                 SL  I T+        + + IAL  K              
Sbjct: 67  QSIPISEEYTVKRESYDWYTSLDQIRTSTSDPVPASVSVTIALGYKKEDKAASTEITERR 126

Query: 118 ETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK--LRSQGFVSSVIFR 167
             +   +  +    +++ +   Q     ++ I +++   + S   +  V F 
Sbjct: 127 IEIIDFLRRFFSEQTVEDLR-PQNEEVLRQQIRDQINDDILSNSRIRDVRFT 177


>gi|78355432|ref|YP_386881.1| flagellar basal body-associated protein [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|78217837|gb|ABB37186.1| flagellar basal body-associated protein, putative [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 250

 Score = 43.6 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 15/136 (11%), Positives = 37/136 (27%), Gaps = 7/136 (5%)

Query: 43  FLFAGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPK--DWL 100
                  E++ Q  +       +       +    K   + + +P             +L
Sbjct: 114 PSGEPPAEKQAQPVVKKKIVRKAGELPPPKEEEPAKPEYVVAWEPFWVEQTDQQGNIRFL 173

Query: 101 RLDIALICKDI----PDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKL- 155
               A + +              L   I  Y+R  S+  +T        K D+   +   
Sbjct: 174 VCKFAAVTESERLSWEIGTKKVVLRDAIFYYLRNKSLLFLTEKTNVETLKSDLLAVINQY 233

Query: 156 RSQGFVSSVIFRTFII 171
              G +  ++   +++
Sbjct: 234 LDNGQLQDLLIENYLV 249


>gi|237750656|ref|ZP_04581136.1| predicted protein [Helicobacter bilis ATCC 43879]
 gi|229373746|gb|EEO24137.1| predicted protein [Helicobacter bilis ATCC 43879]
          Length = 137

 Score = 43.6 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 11/100 (11%), Positives = 29/100 (29%), Gaps = 1/100 (1%)

Query: 73  DTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLHQDIMAYIRTVS 132
                  + +    P         K    + ++           +E +   ++  +    
Sbjct: 36  PIEKEFVMMLKPSNPDDLRTAGYAKFNATIIMSDKAAAKELDAKIEIVRSVVVDTVSGFM 95

Query: 133 IKQITGAQGFRYFKEDIEERVK-LRSQGFVSSVIFRTFII 171
              + GAQG +     +   V  + +   +   +F  F+I
Sbjct: 96  KTDLQGAQGKQKLAATLTASVNAVLTDSSIVGFVFPDFVI 135


>gi|227328352|ref|ZP_03832376.1| flagellar basal body-associated protein FliL [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 159

 Score = 43.6 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 18/175 (10%), Positives = 44/175 (25%), Gaps = 33/175 (18%)

Query: 9   QYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRS 68
           Q   G +  +++   ++              ++                          +
Sbjct: 5   QVRPGRKRSIWLILLIIVALAATGAAGAAWWLLS---------------------QKNAA 43

Query: 69  VHTGDTISLKKLQIFSLQPIITNFDS---SPKDWLRLDIALICKDIPDKVFL----ETLH 121
               +     +     L     N  +    P   L +   L   D   +         + 
Sbjct: 44  TAEQEAPPPPEPVFMPLDTFTVNLVNADNDPDRVLYVGFTLRLPDEATRTRFTNYLPEVR 103

Query: 122 QDIMAYIRTVSIKQITGAQGFRYFKEDIEERVK-LRSQGF----VSSVIFRTFII 171
             ++  +       +   QG +   E I++ +      G     V+ V+F  FI+
Sbjct: 104 SRLLLLLSRQDAIALANEQGKQKLIEQIKQVLSPPLVPGQPNQVVTDVLFTAFIL 158


>gi|50120653|ref|YP_049820.1| flagellar basal body-associated protein FliL [Pectobacterium
           atrosepticum SCRI1043]
 gi|49611179|emb|CAG74625.1| flagellar protein [Pectobacterium atrosepticum SCRI1043]
          Length = 161

 Score = 43.2 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 20/183 (10%), Positives = 48/183 (26%), Gaps = 35/183 (19%)

Query: 1   MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60
           M+  D   Q   G +  +++   ++              ++                   
Sbjct: 1   MAMSDM--QVRPGRKRSIWLILLIIVALAATGAAGTAWWLL------------------- 39

Query: 61  FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDS---SPKDWLRLDIALICKDIPDKVFL 117
             +    +    +     +