RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780373|ref|YP_003064786.1| flagellar basal body-associated protein FliL [Candidatus Liberibacter asiaticus str. psy62] (172 letters) >gnl|CDD|146406 pfam03748, FliL, Flagellar basal body-associated protein FliL. This FliL protein controls the rotational direction of the flagella during chemotaxis. FliL is a cytoplasmic membrane protein associated with the basal body. Length = 145 Score = 48.0 bits (115), Expect = 1e-06 Identities = 22/100 (22%), Positives = 43/100 (43%), Gaps = 6/100 (6%) Query: 78 KKLQIFSLQPIITNFDSSPKD-WLRLDIALICKDIPDKVFLET----LHQDIMAYIRTVS 132 L+P + N +L++ IAL +D LE + I+ + + + Sbjct: 45 APAAYVPLEPFVVNLADDGGTRYLKISIALEVRDPKAAEELEKHMPLIRDAILMLLSSKT 104 Query: 133 IKQITGAQGFRYFKEDIEERVKLRSQ-GFVSSVIFRTFII 171 + ++ +G KE++ ER+ G V V+F +F+I Sbjct: 105 AEDLSTPEGKEKLKEELLERINEVLLEGEVEDVLFTSFVI 144 >gnl|CDD|37688 KOG2477, KOG2477, KOG2477, Uncharacterized conserved protein [Function unknown]. Length = 628 Score = 27.7 bits (61), Expect = 1.8 Identities = 12/42 (28%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Query: 113 DKVFLET---LHQDIMAYIRTVSIKQITGAQGFRYFKEDIEE 151 D +F E L + I + + Q G+ YFK+ I E Sbjct: 484 DVIFYENAPSLQRRPHTAIECIPVPQEIGSMAPAYFKKAISE 525 >gnl|CDD|147705 pfam05698, Trigger_C, Bacterial trigger factor protein (TF) C-terminus. In the E. coli cytosol, a fraction of the newly synthesized proteins requires the activity of molecular chaperones for folding to the native state. The major chaperones implicated in this folding process are the ribosome-associated Trigger Factor (TF), and the DnaK and GroEL chaperones with their respective co-chaperones. Trigger Factor is an ATP-independent chaperone and displays chaperone and peptidyl-prolyl-cis-trans-isomerase (PPIase) activities in vitro. It is composed of at least three domains, an N-terminal domain which mediates association with the large ribosomal subunit, a central substrate binding and PPIase domain with homology to FKBP proteins, and a C-terminal domain of unknown function. The positioning of TF at the peptide exit channel, together with its ability to interact with nascent chains as short as 57 residues renders TF a prime candidate for being the first chaperone that binds to the nascent polypeptide chains. This family represents the C-terminal region of the protein. Length = 162 Score = 26.1 bits (58), Expect = 5.1 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Query: 116 FLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFR 167 FL+ L + +S+ + + FKE+ E+RVKL G + I + Sbjct: 57 FLQQLQGQGLDLEEYLSLSGSSEEELREEFKEEAEKRVKL---GLILEEIAK 105 >gnl|CDD|36367 KOG1152, KOG1152, KOG1152, Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms]. Length = 772 Score = 25.8 bits (56), Expect = 6.9 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Query: 50 EEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSL 85 E++Y F LN+ DN +V +G S KL+I SL Sbjct: 234 EQRY--FTLNSLSDNIPCAVCSGVLESESKLKIHSL 267 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.328 0.143 0.433 Gapped Lambda K H 0.267 0.0724 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,167,666 Number of extensions: 111860 Number of successful extensions: 475 Number of sequences better than 10.0: 1 Number of HSP's gapped: 474 Number of HSP's successfully gapped: 28 Length of query: 172 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 85 Effective length of database: 4,383,754 Effective search space: 372619090 Effective search space used: 372619090 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 54 (24.6 bits)