RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780373|ref|YP_003064786.1| flagellar basal body-associated protein FliL [Candidatus Liberibacter asiaticus str. psy62] (172 letters) >gnl|CDD|181469 PRK08561, rps15p, 30S ribosomal protein S15P; Reviewed. Length = 151 Score = 27.9 bits (63), Expect = 1.3 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 143 RYFKEDIEER-VKLRSQGFVSSVI 165 Y E+IEE V+L QG+ S+I Sbjct: 27 DYSPEEIEELVVELAKQGYSPSMI 50 >gnl|CDD|181003 PRK07500, rpoH2, RNA polymerase factor sigma-32; Reviewed. Length = 289 Score = 26.5 bits (59), Expect = 3.2 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 7/45 (15%) Query: 102 LDIALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFK 146 +A KD D+ + LH+ I A++R V I+ A FR F Sbjct: 27 HALAYRWKDHRDE---DALHRIISAHMRLV----ISMAGKFRRFG 64 >gnl|CDD|181494 PRK08594, PRK08594, enoyl-(acyl carrier protein) reductase; Provisional. Length = 257 Score = 26.6 bits (59), Expect = 3.3 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Query: 128 IRTVSIKQITGAQGFRYFKEDIEERVKLR 156 IRT+S K G GF ++IEER LR Sbjct: 194 IRTLSAK---GVGGFNSILKEIEERAPLR 219 >gnl|CDD|147962 pfam06087, Tyr-DNA_phospho, Tyrosyl-DNA phosphodiesterase. Covalent intermediates between topoisomerase I and DNA can become dead-end complexes that lead to cell death. Tyrosyl-DNA phosphodiesterase can hydrolyse the bond between topoisomerase I and DNA. Length = 433 Score = 26.6 bits (59), Expect = 3.6 Identities = 9/27 (33%), Positives = 13/27 (48%) Query: 54 QKFILNNFYDNSVRSVHTGDTISLKKL 80 K +L YD R DTI+L+ + Sbjct: 2 FKLVLTPIYDLKARVQENPDTITLEDI 28 >gnl|CDD|150247 pfam09508, Lact_bio_phlase, Lacto-N-biose phosphorylase. The gene which codes for this protein in gut-bacteria is located in a novel putative operon for galactose metabolism. The protein appears to be a carbohydrate-processing phosphorolytic enzyme (EC:2.4.1.211), unlike either glycoside hydrolases or glycoside lyase. Intestinal colonisation by bifidobacteria is important for human health, especially in pediatrics, because colonisation seems to prevent infection by some pathogenic bacteria that cause diarrhoea or other illnesses. The operon seems to be involved in intestinal colonisation by bifidobacteria mediated by metabolism of mucin sugars. In addition, it may also resolve the question of the nature of the bifidus factor in human milk as the lacto-N-biose structure found in milk oligosaccharides. Length = 716 Score = 26.6 bits (59), Expect = 3.7 Identities = 7/19 (36%), Positives = 12/19 (63%) Query: 44 LFAGQKEEKYQKFILNNFY 62 L+A +EE+ K+ +N Y Sbjct: 650 LWAAHQEEEMHKWYSSNVY 668 >gnl|CDD|152144 pfam11708, Slu7, Pre-mRNA splicing Prp18-interacting factor. The spliceosome, an assembly of snRNAs (U1, U2, U4/U6, and U5) and proteins, catalyses the excision of introns from pre-mRNAs in two successive trans-esterification reactions. Step 2 depends upon integral spliceosome constituents such as U5 snRNA and Prp8 and non-spliceosomal proteins Prp16, Slu7, Prp18, and Prp22. ATP hydrolysis by the DEAH-box enzyme Prp16 promotes a conformational change in the spliceosome that leads to protection of the 3'ss from targeted RNase H cleavage. This change, which probably reflects binding of the 3'ss PyAG in the catalytic centre of the spliceosome, requires the ordered recruitment of Slu7, Prp18, and Prp22 to the spliceosome. There is a close functional relationship between Prp8, Prp18, and Slu7, and Prp18 interacts with Slu7, so that together they recruit Prp22 to the spliceosome. Most members of the family carry a zinc-finger of the CCHC-type upstream of this domain. Length = 236 Score = 25.5 bits (56), Expect = 6.7 Identities = 8/22 (36%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Query: 63 DNSVRSVHTGDTISLKKLQIFS 84 DN VR +G+ + ++LQ F+ Sbjct: 119 DNFVRL--SGEALEFEELQKFA 138 >gnl|CDD|179246 PRK01209, cobD, cobalamin biosynthesis protein; Provisional. Length = 312 Score = 25.5 bits (57), Expect = 7.1 Identities = 3/32 (9%), Positives = 13/32 (40%) Query: 18 LFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQK 49 + W ++ ++ G +++L+ + Sbjct: 65 GLLAWLLLALAARLWLGVALEVLLLYTALAGR 96 >gnl|CDD|182113 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional. Length = 1019 Score = 25.3 bits (56), Expect = 7.3 Identities = 25/109 (22%), Positives = 34/109 (31%), Gaps = 25/109 (22%) Query: 22 WFVVYTFIGIFCGWLGGIVMLFLF--------AGQKEEKYQKFILNNFYDNSVRSVHTGD 73 WF ++ F L F+F G K K Q+FI + D S D Sbjct: 126 WFALHLLEKEF--QLSDSGKSFIFNMSVGYDLEGIKSPKMQQFI-DGMMDAS-------D 175 Query: 74 TISLKKLQIF-SLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETLH 121 T IF + + R + I I V L T+H Sbjct: 176 T------PIFAECRETLNKLLDDFAFLAREGLERIPPSICPSVTLSTMH 218 >gnl|CDD|149487 pfam08440, Poty_PP, Potyviridae polyprotein. This domain is found in polyproteins of the viral Potyviridae taxon. Length = 274 Score = 25.2 bits (56), Expect = 7.8 Identities = 10/36 (27%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 104 IALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGA 139 I KD+PDK++ E L + ++ Y +++ A Sbjct: 107 IPFYVKDVPDKLY-EKLWEAVLKYKPDAGFGRLSSA 141 >gnl|CDD|183107 PRK11376, hlyE, hemolysin E; Provisional. Length = 303 Score = 25.4 bits (55), Expect = 8.4 Identities = 18/71 (25%), Positives = 30/71 (42%) Query: 14 NQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNNFYDNSVRSVHTGD 73 +Q K F VY + G+ L ++LF +K+ QK IL D+ + ++ Sbjct: 72 SQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVLDDGITKLNEAQ 131 Query: 74 TISLKKLQIFS 84 L Q F+ Sbjct: 132 KSLLVSSQSFN 142 >gnl|CDD|173403 PTZ00111, PTZ00111, DNA replication licensing factor MCM4; Provisional. Length = 915 Score = 25.3 bits (55), Expect = 8.9 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Query: 47 GQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITN 91 G+ K + I N YD+ + SV TGD +++ + I + PI T+ Sbjct: 338 GEIYMKDNEVINLNLYDDLIDSVKTGDRVTV--VGILKVTPIRTS 380 >gnl|CDD|178121 PLN02505, PLN02505, omega-6 fatty acid desaturase. Length = 381 Score = 25.0 bits (55), Expect = 9.5 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Query: 87 PIITNFDSSPKDWLRLDIALICKD--IPDKVF 116 P + ++DSS DWLR +A + +D I +KVF Sbjct: 277 PALPHYDSSEWDWLRGALATVDRDYGILNKVF 308 >gnl|CDD|179764 PRK04172, pheS, phenylalanyl-tRNA synthetase subunit alpha; Provisional. Length = 489 Score = 25.2 bits (56), Expect = 9.9 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 136 ITGAQGFRY-FKEDIEERVKLRSQGFVSSV 164 TG++G+ Y + EDI +R+ LR+ S Sbjct: 311 DTGSRGWGYKWDEDIAKRLVLRTHTTALSA 340 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.328 0.143 0.433 Gapped Lambda K H 0.267 0.0760 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,839,084 Number of extensions: 172034 Number of successful extensions: 506 Number of sequences better than 10.0: 1 Number of HSP's gapped: 506 Number of HSP's successfully gapped: 29 Length of query: 172 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 85 Effective length of database: 4,114,577 Effective search space: 349739045 Effective search space used: 349739045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 54 (24.5 bits)