RPSBLAST alignment of GI: 254780373 and protein with PDBid: 1qzv

>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154
 Score = 40.0 bits (92), Expect = 3e-04
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 11/34 (32%)

Query: 76  SLKKLQIFSLQPIITNFDSSPKDWLRLDIALICK 109
           +LKKLQ  SL+ +  + DS+P        AL  K
Sbjct: 21  ALKKLQA-SLK-LYAD-DSAP--------ALAIK 43