RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780373|ref|YP_003064786.1| flagellar basal
body-associated protein FliL [Candidatus Liberibacter asiaticus str.
psy62]
         (172 letters)



>d2g0da1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC
           {Lactococcus lactis [TaxId: 1358]}
          Length = 409

 Score = 26.8 bits (58), Expect = 1.0
 Identities = 12/61 (19%), Positives = 24/61 (39%), Gaps = 3/61 (4%)

Query: 27  TFIGIFCGWLGGIVMLFLFAGQKEEKYQKFI--LNNFYDNSVRSVHTGDTISLKKLQIFS 84
               ++ G   GI +  L   + +EKY+  +  LN + +  VR    G  +       + 
Sbjct: 77  LTGSLYSGA-AGIALSILHLREDDEKYKNLLDSLNRYIEYFVREKIEGFNLENITPPDYD 135

Query: 85  L 85
           +
Sbjct: 136 V 136


>d1ihma_ b.121.4.3 (A:) Calicivirus capsid protein {Norwalk virus
          [TaxId: 11983]}
          Length = 492

 Score = 25.2 bits (55), Expect = 3.0
 Identities = 5/16 (31%), Positives = 10/16 (62%)

Query: 32 FCGWLGGIVMLFLFAG 47
          + GW+G + +  + AG
Sbjct: 72 YNGWVGNMRVRIMLAG 87


>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol
          esterase) {Cow (Bos taurus) [TaxId: 9913]}
          Length = 579

 Score = 25.0 bits (53), Expect = 3.7
 Identities = 8/26 (30%), Positives = 11/26 (42%)

Query: 6  TTSQYIRGNQHKLFVTWFVVYTFIGI 31
          T   ++ G   KL +    V  F GI
Sbjct: 8  TEGGFVEGVNKKLSLFGDSVDIFKGI 33


>d1q90d_ f.32.1.1 (D:) Subunit IV of the cytochrome b6f complex
           {Chlamydomonas reinhardtii [TaxId: 3055]}
          Length = 156

 Score = 24.0 bits (52), Expect = 7.1
 Identities = 3/34 (8%), Positives = 15/34 (44%)

Query: 5   DTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGG 38
           ++ +++    +  +    F++ T + ++ G    
Sbjct: 112 ESINKFQNPYRRPIATILFLLGTLVAVWLGIGST 145


>d1ev13_ b.121.4.1 (3:) Human enterovirus B coat proteins {Human
           echovirus 1 [TaxId: 46633]}
          Length = 239

 Score = 24.0 bits (52), Expect = 7.5
 Identities = 6/16 (37%), Positives = 9/16 (56%)

Query: 32  FCGWLGGIVMLFLFAG 47
           +  W G I + F+F G
Sbjct: 108 YAHWSGSIKITFVFCG 123


>d1pvc3_ b.121.4.1 (3:) Poliovirus coat proteins {Poliovirus type 3,
           strain Sabin [TaxId: 12086]}
          Length = 235

 Score = 23.6 bits (51), Expect = 8.9
 Identities = 6/16 (37%), Positives = 8/16 (50%)

Query: 32  FCGWLGGIVMLFLFAG 47
           +  W G +   FLF G
Sbjct: 107 YTHWAGSLKFTFLFCG 122


>d1d4m3_ b.121.4.1 (3:) Human enterovirus B coat proteins {Human
           coxsackievirus A9 [TaxId: 12067]}
          Length = 238

 Score = 23.6 bits (51), Expect = 9.1
 Identities = 5/17 (29%), Positives = 9/17 (52%)

Query: 32  FCGWLGGIVMLFLFAGQ 48
           +  W G + + F+F G 
Sbjct: 107 YAHWSGSMKLTFVFCGS 123


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.328    0.143    0.433 

Gapped
Lambda     K      H
   0.267   0.0471    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 659,226
Number of extensions: 29271
Number of successful extensions: 97
Number of sequences better than 10.0: 1
Number of HSP's gapped: 96
Number of HSP's successfully gapped: 14
Length of query: 172
Length of database: 2,407,596
Length adjustment: 79
Effective length of query: 93
Effective length of database: 1,322,926
Effective search space: 123032118
Effective search space used: 123032118
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 50 (23.7 bits)