BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780373|ref|YP_003064786.1| flagellar basal body-associated protein FliL [Candidatus Liberibacter asiaticus str. psy62] (172 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780373|ref|YP_003064786.1| flagellar basal body-associated protein FliL [Candidatus Liberibacter asiaticus str. psy62] Length = 172 Score = 353 bits (905), Expect = 1e-99, Method: Compositional matrix adjust. Identities = 172/172 (100%), Positives = 172/172 (100%) Query: 1 MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60 MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN Sbjct: 1 MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLFAGQKEEKYQKFILNN 60 Query: 61 FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120 FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL Sbjct: 61 FYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALICKDIPDKVFLETL 120 Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA 172 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA Sbjct: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSSVIFRTFIIA 172 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 26.9 bits (58), Expect = 0.22, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 10/55 (18%) Query: 48 QKEEKYQKFILNNFYDNSVR---------SVHTGDTISLKKLQIFSLQPIITNFD 93 Q+EEK+ L++F DN R S HT ++ SL + +I ++ +++N D Sbjct: 1168 QREEKFHS-ALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLD 1221 >gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Score = 25.4 bits (54), Expect = 0.52, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 15/29 (51%) Query: 121 HQDIMAYIRTVSIKQITGAQGFRYFKEDI 149 H+D + I +I TGA+G R E I Sbjct: 350 HEDALREIARCAIAHKTGARGLRSILEKI 378 >gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter asiaticus str. psy62] Length = 750 Score = 21.6 bits (44), Expect = 9.1, Method: Compositional matrix adjust. Identities = 14/46 (30%), Positives = 21/46 (45%) Query: 62 YDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDIALI 107 Y N RS+H + S ++ S Q I +S D+ L+I I Sbjct: 469 YANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTI 514 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.328 0.143 0.433 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 112,859 Number of Sequences: 1233 Number of extensions: 4460 Number of successful extensions: 13 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 5 length of query: 172 length of database: 328,796 effective HSP length: 68 effective length of query: 104 effective length of database: 244,952 effective search space: 25475008 effective search space used: 25475008 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 35 (18.1 bits)