HHsearch alignment for GI: 254780374 and conserved domain: PRK12701

>PRK12701 flgH flagellar basal body L-ring protein; Reviewed.
Probab=100.00  E-value=0  Score=465.48  Aligned_cols=227  Identities=28%  Similarity=0.394  Sum_probs=195.7

Q ss_pred             CCHHHHHHHHHH-HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             911799999999-99854336720025687536677776644445644555444444455761215775-5211232236
Q gi|254780374|r    1 MYRYSFIVLCYS-SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH-AALFKDSRAL   78 (238)
Q Consensus         1 M~r~~l~~l~~~-~lL~GCas~~~~~~~~p~~tp~~~~~~~~~~~p~~~~~~~~~~~~~~~gSL~~~~~-~~lf~D~RA~   78 (238)
T Consensus         1 m~r~~~~~~~la~~lL~GC~~~~~~-----------~p~~~p~~aP~~p~~p~p~~~~~~~GSl~~~~~~~~lF~D~RA~   69 (230)
T PRK12701          1 MNRLNIAVSCLATALLFGCEALHPP-----------APGDNPDYAPTYPVTPDPKELRKVSGAIYSSETALPLFETPRAR   69 (230)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCC-----------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             9258999999999997556688999-----------99999886776888889765778997530378876442555336


Q ss_pred             CCCCEEEEEEEECCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHEECEEEEEEEEEEEE
Q ss_conf             76876999997241010000122234565445554333455445566655465555543211000000014899999999
Q gi|254780374|r   79 NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIV  158 (238)
Q Consensus        79 ~VGDIiTV~i~E~~~a~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~G~~~~~~~l~~~isa~V  158 (238)
T Consensus        70 ~VGDilTV~i~E~t~Asks~~t~~~k~~s~~~~~~~~~g~~~~~~~~~~~~~~~~s~~~f~G~G~~~qs~~l~gtIta~V  149 (230)
T PRK12701         70 HPGDILTVFLIEKTDAQKNATTTQRKNDTTKITNKLFLGRPISLGSGYSMDFDLDNQRQFNGEGRSIQNNKLAGSISVTV  149 (230)
T ss_pred             CCCCEEEEEEEECCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEE
T ss_conf             78987999999733433311323254565445653224654324566654446666543556430102214789999999


Q ss_pred             EEECCCCCEEEEEEEEEEEECCEEEEEEEEEECHHHCCCCCEEEHHEEEEEEEEEECEEEECCCCCCCHHHHHHHH-HCC
Q ss_conf             9980797289978877984188799999979847767899738242055439998020331233486668999998-558
Q gi|254780374|r  159 TAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN-LSP  237 (238)
Q Consensus       159 ~~VlpNGnL~I~G~k~i~vn~e~~~i~isGiVRp~DI~~~NtV~S~~iAda~I~y~g~G~~~d~~~~gwl~r~~~~-i~P  237 (238)
T Consensus       150 ~~VLpNGNLvI~GeK~v~vN~e~e~i~lsGiVRP~DI~~~NtV~S~~IAdArI~Y~G~G~l~d~~~~GWltr~f~s~~~P  229 (230)
T PRK12701        150 AKVLANGNMVVQGEKWVRINQGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQINNTNAQGWLSRILWGPLFP  229 (230)
T ss_pred             EEECCCCCEEEEEEEEEEECCCEEEEEEEEEECHHHCCCCCEECCCEEEEEEEEECCEECCCCCCCCCHHHHHHCCCCCC
T ss_conf             99866997999998999987988999999998878879998697102243799982202205342559899975435588


Q ss_pred             C
Q ss_conf             9
Q gi|254780374|r  238 L  238 (238)
Q Consensus       238 l  238 (238)
T Consensus       230 ~  230 (230)
T PRK12701        230 T  230 (230)
T ss_pred             C
T ss_conf             9