BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780374|ref|YP_003064787.1| flagellar basal body L-ring
protein [Candidatus Liberibacter asiaticus str. psy62]
         (238 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780374|ref|YP_003064787.1| flagellar basal body L-ring protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040051|gb|ACT56847.1| flagellar basal body L-ring protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 238

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 238/238 (100%), Positives = 238/238 (100%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS
Sbjct: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG
Sbjct: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
           QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE
Sbjct: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL
Sbjct: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238


>gi|315121843|ref|YP_004062332.1| flagellar basal body L-ring protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495245|gb|ADR51844.1| flagellar basal body L-ring protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 239

 Score =  364 bits (934), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 181/239 (75%), Positives = 206/239 (86%), Gaps = 1/239 (0%)

Query: 1   MYRYSFIVLCYSSLLFGCH-SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           MYRYS I+LC   LL GCH    SEITG PQMSP+GSSL+++ R+   GIDFKN  +TKK
Sbjct: 1   MYRYSVIILCNILLLAGCHLGRFSEITGSPQMSPIGSSLNQHRRILLSGIDFKNPRATKK 60

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           SYSLWRDS++ LFKDSRALNVGDILTVDI+IDDQAVFDN+TGRSR+NSLH+KLSGGFS+F
Sbjct: 61  SYSLWRDSNSTLFKDSRALNVGDILTVDIKIDDQAVFDNKTGRSRDNSLHKKLSGGFSIF 120

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           G+ +P M+ + NYDG   S GKGSISRAEKLN+LIAAIVT ILENGNLIISGSQEV VND
Sbjct: 121 GKNSPGMSADANYDGKSTSVGKGSISRAEKLNILIAAIVTEILENGNLIISGSQEVCVND 180

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           E+RSLNV GIVRPQDVDA+N VSYDKIAEARISYGGKG TTELL+ PIG +LI++ SPL
Sbjct: 181 EMRSLNVAGIVRPQDVDANNIVSYDKIAEARISYGGKGTTTELLKTPIGQRLIDSFSPL 239


>gi|222147575|ref|YP_002548532.1| flagellar basal body L-ring protein [Agrobacterium vitis S4]
 gi|254789275|sp|B9JRQ0|FLGH_AGRVS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|221734563|gb|ACM35526.1| flagellar L-ring protein precursor [Agrobacterium vitis S4]
          Length = 237

 Score =  254 bits (650), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 169/239 (70%), Gaps = 3/239 (1%)

Query: 1   MYRYSFIVLCYSSLLFGC-HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M + S +VL  + +L GC + ++ E+   P MSP+GS L   N+ P L    K + +   
Sbjct: 1   MIKRSAVVLM-AVILTGCGNKTLEEVGNAPAMSPVGSGL-RYNQAPQLASYPKQTKAVSN 58

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            YSLW DS AALFKDSRA+NVGD+LTV+I I D+A F N T RSR NS     S   +LF
Sbjct: 59  GYSLWNDSQAALFKDSRAINVGDLLTVNISIADKAKFKNDTSRSRKNSTSLTWSTVINLF 118

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           G   P  +G+++ D   +S GKGS+ R+E L L++AA+VT+ILENGNL+ISGSQEVRVN 
Sbjct: 119 GITPPDSSGDMSTDSNSSSDGKGSVDRSETLTLMVAAVVTSILENGNLLISGSQEVRVNH 178

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           E+R LNV GIVRPQDVDA N++SY+KIAEARISYGGKGR TE+ +PP+G Q+++  SP 
Sbjct: 179 EVRILNVAGIVRPQDVDAKNTISYEKIAEARISYGGKGRLTEVQQPPVGQQVVDMFSPF 237


>gi|86356316|ref|YP_468208.1| flagellar basal body L-ring protein [Rhizobium etli CFN 42]
 gi|190890367|ref|YP_001976909.1| flagellar L-ring protein [Rhizobium etli CIAT 652]
 gi|86280418|gb|ABC89481.1| flagellar L-ring protein [Rhizobium etli CFN 42]
 gi|190695646|gb|ACE89731.1| flagellar L-ring protein [Rhizobium etli CIAT 652]
          Length = 238

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 157/224 (70%), Gaps = 4/224 (1%)

Query: 17  GCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC S  ++SEI   P MSP+GS L    + P + +  K   +  + YSLW DS AALFKD
Sbjct: 17  GCQSPTAVSEIGRAPAMSPIGSGL-AYGQTPQMALYPKQPRAVAQGYSLWSDSQAALFKD 75

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
           +RALNVGDILTVDI+I+D+A FDN+T RSR NS          +FG  TP+   +L Y  
Sbjct: 76  ARALNVGDILTVDIQINDKASFDNETNRSRKNSSGMNWDVNAQIFGW-TPESKTDLTYGS 134

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             ++ GKG I R +KL LL+AA+VT ILENGNL+ISGSQEVR+N E+R LNV GIVRPQD
Sbjct: 135 DTSTDGKGKIERTDKLTLLVAAVVTGILENGNLVISGSQEVRLNQELRILNVAGIVRPQD 194

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           V+A N +SYDKIAEARISYGG+GR  E+ +PP G Q ++  SPL
Sbjct: 195 VNAENQISYDKIAEARISYGGRGRLMEVQQPPRGQQAVDLFSPL 238


>gi|116250486|ref|YP_766324.1| flagellar basal body L-ring protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255134|emb|CAK06208.1| putative flagellar L-ring protein precursor (basal body L-ring
           protein) [Rhizobium leguminosarum bv. viciae 3841]
          Length = 238

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 157/224 (70%), Gaps = 4/224 (1%)

Query: 17  GCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC S  ++SEI   P MSP+GS L    + P + +  K   +  + YSLW DS AALFKD
Sbjct: 17  GCQSPTAVSEIGRAPAMSPIGSGL-AYGQTPQMALYPKQPRAVAQGYSLWSDSQAALFKD 75

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
           +RALNVGDILTVDI+I+D+A FDN+T RSR NS          +FG  TP+   +L Y  
Sbjct: 76  ARALNVGDILTVDIQINDKASFDNETNRSRTNSSGMNWDVNAQIFGW-TPESKTDLTYGS 134

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             ++ GKG I R +KL LL+AA+VT ILENGNL+ISGSQEVR+N E+R LNV GIVRPQD
Sbjct: 135 DTSTDGKGKIERTDKLTLLVAAVVTGILENGNLVISGSQEVRLNQELRILNVAGIVRPQD 194

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           V+A N +SYDKIAEARISYGG+GR  E+ +PP G Q ++  SPL
Sbjct: 195 VNADNQISYDKIAEARISYGGRGRLMEVQQPPRGQQAVDLFSPL 238


>gi|209547932|ref|YP_002279849.1| flagellar basal body L-ring protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533688|gb|ACI53623.1| flagellar L-ring protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 238

 Score =  241 bits (614), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 125/224 (55%), Positives = 156/224 (69%), Gaps = 4/224 (1%)

Query: 17  GCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC S  ++SEI   P MSP+GS L    + P + +  K   +  + YSLW DS AALFKD
Sbjct: 17  GCQSPTAVSEIGRAPSMSPIGSGL-AYGQTPQMALYPKQPRAVAQGYSLWSDSQAALFKD 75

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
           +RALNVGDILTVDI+I+D+  FDN+T RSR NS          +FG  TP+   +L Y  
Sbjct: 76  ARALNVGDILTVDIQINDKGSFDNETNRSRKNSSGMNWDVNAQIFGW-TPESKTDLTYGS 134

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             ++ GKG I R +KL LL+AA+VT ILENGNL+ISGSQEVR+N E+R LNV GIVRPQD
Sbjct: 135 DTSTDGKGKIERTDKLTLLVAAVVTGILENGNLVISGSQEVRLNQELRILNVAGIVRPQD 194

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           V+A N +SYDKIAEARISYGG+GR  E+ +PP G Q ++  SPL
Sbjct: 195 VNAENQISYDKIAEARISYGGRGRLMEVQQPPRGQQAVDLFSPL 238


>gi|241203110|ref|YP_002974206.1| flagellar basal body L-ring protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857000|gb|ACS54667.1| flagellar L-ring protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 238

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 125/224 (55%), Positives = 156/224 (69%), Gaps = 4/224 (1%)

Query: 17  GCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC S  ++SEI   P MSP+GS L    + P + +  K   +  + YSLW DS AALFKD
Sbjct: 17  GCQSPTAVSEIGRAPAMSPIGSGL-AYGQTPQMALYPKQPRAVAQGYSLWSDSQAALFKD 75

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
           +RALNVGDILTVDI+I+D+  FDN+T RSR NS          +FG  TP+   +L Y  
Sbjct: 76  ARALNVGDILTVDIQINDKGSFDNETNRSRKNSSGMNWDVNAQIFGW-TPESKTDLTYGS 134

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             ++ GKG I R +KL LL+AA+VT ILENGNL+ISGSQEVR+N E+R LNV GIVRPQD
Sbjct: 135 DTSTDGKGKIERTDKLTLLVAAVVTGILENGNLVISGSQEVRLNQELRILNVAGIVRPQD 194

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           V+A N +SYDKIAEARISYGG+GR  E+ +PP G Q ++  SPL
Sbjct: 195 VNAENQISYDKIAEARISYGGRGRLMEVQQPPRGQQAVDLFSPL 238


>gi|150395489|ref|YP_001325956.1| flagellar basal body L-ring protein [Sinorhizobium medicae WSM419]
 gi|166214829|sp|A6U641|FLGH_SINMW RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|150027004|gb|ABR59121.1| flagellar L-ring protein [Sinorhizobium medicae WSM419]
          Length = 236

 Score =  238 bits (606), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 161/242 (66%), Gaps = 13/242 (5%)

Query: 3   RYSFIVLCYSSLLFGCHS-SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           R     +  + LL GC + + +EI   P MSP+GS L +  + P L +  K        Y
Sbjct: 2   RMRITAILAAGLLAGCQNQAFNEIGRAPAMSPIGSGL-QYTQTPQLAMYPKQPRHVTNGY 60

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW D  AALFKD+RA+N+GDILTVDIRIDD+A F+N+T RSR NS       GF+L   
Sbjct: 61  SLWNDQQAALFKDARAINIGDILTVDIRIDDKASFENETDRSRKNS------SGFNLGAS 114

Query: 122 QTPQ-----MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
              Q      +G+L Y     + G G   R+EKL LL+AA+VT +LENGNL+ISGSQEVR
Sbjct: 115 GESQTSDFAWSGDLEYGSNTKTEGDGKTERSEKLRLLVAAVVTGVLENGNLLISGSQEVR 174

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN E+R LNV GIVRP+DVDA N +SYD+IAEARISYGG+GR TE+ +PP G QL++ +S
Sbjct: 175 VNHELRILNVAGIVRPRDVDADNVISYDRIAEARISYGGRGRLTEVQQPPWGQQLVDLVS 234

Query: 237 PL 238
           PL
Sbjct: 235 PL 236


>gi|12057225|gb|AAB81417.2| FlgH [Sinorhizobium meliloti]
          Length = 236

 Score =  237 bits (605), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 161/242 (66%), Gaps = 13/242 (5%)

Query: 3   RYSFIVLCYSSLLFGCHS-SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           R     +  + LL GC + + +EI   P MSP+GS L +  + P L +  K        Y
Sbjct: 2   RTRITAVLAAGLLAGCQNQAFNEIGRAPAMSPIGSGL-QYTQTPQLAMYPKQPRHVTNGY 60

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW D  AALFKD+RA+N+GDILTVDIRIDD+A F+N+T RSR NS       GF+L   
Sbjct: 61  SLWNDQQAALFKDARAINIGDILTVDIRIDDKASFENETDRSRTNS------SGFNLGAS 114

Query: 122 QTPQ-----MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
              Q      +G+L Y     + G G   R+EKL LL+AA+VT +LENGNL+ISGSQEVR
Sbjct: 115 GQSQTSDFAWSGDLEYGSNTKTEGDGKTERSEKLRLLVAAVVTGVLENGNLLISGSQEVR 174

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN E+R LNV GIVRP+DVDA N +SYD+IAEARISYGG+GR TE+ +PP G QL++ +S
Sbjct: 175 VNHELRILNVAGIVRPRDVDADNVISYDRIAEARISYGGRGRLTEVQQPPWGQQLVDLVS 234

Query: 237 PL 238
           PL
Sbjct: 235 PL 236


>gi|15964419|ref|NP_384772.1| flagellar basal body L-ring protein [Sinorhizobium meliloti 1021]
 gi|307311561|ref|ZP_07591202.1| flagellar L-ring protein [Sinorhizobium meliloti BL225C]
 gi|17380483|sp|Q52950|FLGH_RHIME RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|15073596|emb|CAC45238.1| Flagellar L-ring protein precursor (basal body L-ring protein)
           [Sinorhizobium meliloti 1021]
 gi|306899578|gb|EFN30207.1| flagellar L-ring protein [Sinorhizobium meliloti BL225C]
          Length = 236

 Score =  237 bits (605), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 161/242 (66%), Gaps = 13/242 (5%)

Query: 3   RYSFIVLCYSSLLFGCHS-SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           R     +  + LL GC + + +EI   P MSP+GS L +  + P L +  K        Y
Sbjct: 2   RTRITAVLAAGLLAGCQNQAFNEIGRAPAMSPIGSGL-QYTQTPQLAMYPKQPRHVTNGY 60

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW D  AALFKD+RA+N+GDILTVDIRIDD+A F+N+T RSR NS       GF+L   
Sbjct: 61  SLWNDQQAALFKDARAINIGDILTVDIRIDDKASFENETDRSRKNS------SGFNLGAS 114

Query: 122 QTPQ-----MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
              Q      +G+L Y     + G G   R+EKL LL+AA+VT +LENGNL+ISGSQEVR
Sbjct: 115 GQSQTSDFAWSGDLEYGSNTKTEGDGKTERSEKLRLLVAAVVTGVLENGNLLISGSQEVR 174

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN E+R LNV GIVRP+DVDA N +SYD+IAEARISYGG+GR TE+ +PP G QL++ +S
Sbjct: 175 VNHELRILNVAGIVRPRDVDADNVISYDRIAEARISYGGRGRLTEVQQPPWGQQLVDLVS 234

Query: 237 PL 238
           PL
Sbjct: 235 PL 236


>gi|307318916|ref|ZP_07598347.1| flagellar L-ring protein [Sinorhizobium meliloti AK83]
 gi|306895330|gb|EFN26085.1| flagellar L-ring protein [Sinorhizobium meliloti AK83]
          Length = 236

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 161/242 (66%), Gaps = 13/242 (5%)

Query: 3   RYSFIVLCYSSLLFGCHS-SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           R     +  + LL GC + + +EI   P MSP+GS L +  + P L +  K        Y
Sbjct: 2   RTRITAVLAAGLLAGCQNQAFNEIGRAPAMSPIGSGL-QYTQTPQLAMYPKQPRHVTNGY 60

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW D  AALFKD+RA+N+GDILTVDIRIDD+A F+N+T RSR NS       GF+L   
Sbjct: 61  SLWNDQQAALFKDARAINIGDILTVDIRIDDKASFENETDRSRKNS------SGFNLGAS 114

Query: 122 QTPQ-----MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
              Q      +G+L Y     + G G   R+EKL LL+AA+VT +LENGNL+ISGSQEVR
Sbjct: 115 GQSQTSDFAWSGDLEYGSNTKTEGDGKTERSEKLRLLVAAVVTGVLENGNLLISGSQEVR 174

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN E+R LNV GIVRP+DVDA N +SYD+IAEARISYGG+GR TE+ +PP G Q+++ +S
Sbjct: 175 VNHELRILNVAGIVRPRDVDADNVISYDRIAEARISYGGRGRLTEVQQPPWGQQIVDLVS 234

Query: 237 PL 238
           PL
Sbjct: 235 PL 236


>gi|325291935|ref|YP_004277799.1| Flagellar basal body L-ring protein [Agrobacterium sp. H13-3]
 gi|325059788|gb|ADY63479.1| Flagellar basal body L-ring protein [Agrobacterium sp. H13-3]
          Length = 238

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 156/224 (69%), Gaps = 4/224 (1%)

Query: 17  GCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC +  ++ EI   P MSP+GS L + ++ P +G+  K        YSLW DS  ALFKD
Sbjct: 17  GCQNNQTLKEIGNAPAMSPIGSGL-QFSQTPQMGMYPKQPKHMASGYSLWSDSQGALFKD 75

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RALN+GDILTV+I+I+D+A FDN+T R+R NS          + G  TP+ + N+ Y  
Sbjct: 76  LRALNIGDILTVNIQINDKADFDNETERNRTNSSGLNWKAKAEILGW-TPEADSNIKYGS 134

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
              +  KG   R+EKL L++AA+VT ILENGNLIISGSQEVRVN EIR LNV GIVRPQD
Sbjct: 135 DTDTQAKGKTKRSEKLTLMVAAVVTGILENGNLIISGSQEVRVNHEIRILNVGGIVRPQD 194

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VDA N +SY++IAEARISYGG+GR TE+ +PP+G Q+++  SPL
Sbjct: 195 VDAQNMISYERIAEARISYGGRGRLTEVQQPPVGQQVVDLFSPL 238


>gi|227820862|ref|YP_002824832.1| flagellar basal body L-ring protein [Sinorhizobium fredii NGR234]
 gi|254789283|sp|C3MG28|FLGH_RHISN RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|227339861|gb|ACP24079.1| flagellar L-ring protein precursor (basal body L-ring protein) FlgH
           [Sinorhizobium fredii NGR234]
          Length = 236

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 159/242 (65%), Gaps = 13/242 (5%)

Query: 3   RYSFIVLCYSSLLFGCHS-SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           R     +  +SLL GC + +  EI   P MSP+GS L +  + P L    K        Y
Sbjct: 2   RMQLTAVLAASLLAGCQNQAFREIGQAPSMSPIGSGL-QYTQAPQLAAYPKQPHQMTAGY 60

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW D  AALFKD+RA+NVGDILTVDI+IDD+A F+N+T RSR NS       GF+L   
Sbjct: 61  SLWNDQQAALFKDARAINVGDILTVDIQIDDKASFNNETDRSRTNS------SGFNLGAS 114

Query: 122 QTPQ-----MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
              Q      +GNL Y     + G G   R+EKL LL+AA+VT +LENGNL+ISGSQEVR
Sbjct: 115 GESQTSDFEWSGNLKYGSNIKTEGDGKTERSEKLRLLVAAVVTGVLENGNLLISGSQEVR 174

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN E+R LNV GIVRP+DVDA N +SYD+IAEARISYGG+GR  E+ +PP G Q+++ +S
Sbjct: 175 VNHELRILNVAGIVRPRDVDADNIISYDRIAEARISYGGRGRLMEVQQPPWGQQVVDLVS 234

Query: 237 PL 238
           P+
Sbjct: 235 PI 236


>gi|222084869|ref|YP_002543398.1| flagellar L-ring protein [Agrobacterium radiobacter K84]
 gi|221722317|gb|ACM25473.1| flagellar L-ring protein [Agrobacterium radiobacter K84]
          Length = 238

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 120/228 (52%), Positives = 158/228 (69%), Gaps = 4/228 (1%)

Query: 13  SLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA 70
           ++L GC S  ++ E+   P MSP+GS L +  + P +    K      + YSLW DS AA
Sbjct: 13  AVLAGCQSPQALKELGRAPAMSPIGSGL-QYAQTPQMSQYPKRPHQVAQGYSLWNDSQAA 71

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LFKD+RALNVGDILTV I+I+D+A +DN+T R+R N           +FG + P  N + 
Sbjct: 72  LFKDARALNVGDILTVTIQINDKANWDNETNRNRTNKSDMNWDISAKIFGWK-PATNADA 130

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
                 ++  KG + R+E++NLL+AA+VT ILENGNL+ISGSQEVR+N EIR LNV GIV
Sbjct: 131 TSGSDTSTDSKGKMQRSEQINLLVAAVVTGILENGNLMISGSQEVRMNQEIRILNVAGIV 190

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           RPQDV A N++SYDKIAEARISYGG+GR TE+ +PP+G Q ++ LSPL
Sbjct: 191 RPQDVTADNTISYDKIAEARISYGGRGRLTEIQQPPVGQQAVDLLSPL 238


>gi|15887894|ref|NP_353575.1| flagellar basal body L-ring protein [Agrobacterium tumefaciens str.
           C58]
 gi|2494535|sp|Q44342|FLGH_AGRT5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|1086565|gb|AAB68972.1| FlgH [Agrobacterium tumefaciens]
 gi|2459718|gb|AAB71794.1| FlgH [Agrobacterium tumefaciens]
 gi|15155486|gb|AAK86360.1| flagellar L-ring protein precursor [Agrobacterium tumefaciens str.
           C58]
          Length = 239

 Score =  231 bits (590), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 120/224 (53%), Positives = 155/224 (69%), Gaps = 4/224 (1%)

Query: 17  GCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC +  ++ EI   P MSP+GS L + ++ P +G+  K        YSLW DS  ALFKD
Sbjct: 18  GCQNNQTLKEIGNAPAMSPIGSGL-QFSQTPQMGMYPKQPKHMASGYSLWSDSQGALFKD 76

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RALN+GDILTV+I+I+D+A FDN+T R+R N+          + G  TP  + ++ Y  
Sbjct: 77  LRALNIGDILTVNIQINDKADFDNETERNRTNASGLNWKAKAQILGW-TPDADSSIKYGS 135

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
              +  KG   R+EKL LL+AA+VT ILENGNLIISGSQEVRVN EIR LNV GIVRPQD
Sbjct: 136 DTDTQAKGKTKRSEKLTLLVAAVVTGILENGNLIISGSQEVRVNHEIRILNVGGIVRPQD 195

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VDA N +SY++IAEARISYGG+GR TE+ +PP+G Q+++  SPL
Sbjct: 196 VDAQNIISYERIAEARISYGGRGRLTEVQQPPVGQQVVDLFSPL 239


>gi|218679634|ref|ZP_03527531.1| flagellar basal body L-ring protein [Rhizobium etli CIAT 894]
          Length = 176

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 109/177 (61%), Positives = 133/177 (75%), Gaps = 1/177 (0%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW DS AALFKD+RALNVGDILTVDI+I+D+A FDN+T RSR NS          +FG 
Sbjct: 1   SLWSDSQAALFKDARALNVGDILTVDIQINDKASFDNETNRSRTNSSGMNWDVNAQIFGW 60

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
            TPQ   +L Y    ++ GKG I R +K+ LL+AA+VT ILENGNL+ISGSQEVR+N E+
Sbjct: 61  -TPQSKTDLTYGSDTSTDGKGKIERTDKITLLVAAVVTGILENGNLVISGSQEVRLNQEL 119

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           R LNV GIVRPQDV++ N +SYDKIAEARISYGG+GR  E+ +PP G Q ++  SPL
Sbjct: 120 RILNVAGIVRPQDVNSDNQISYDKIAEARISYGGRGRLMEVQQPPRGQQAVDLFSPL 176


>gi|163758019|ref|ZP_02165107.1| flagellar L-ring protein [Hoeflea phototrophica DFL-43]
 gi|162284308|gb|EDQ34591.1| flagellar L-ring protein [Hoeflea phototrophica DFL-43]
          Length = 239

 Score =  211 bits (537), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 114/229 (49%), Positives = 158/229 (68%), Gaps = 8/229 (3%)

Query: 15  LFGCHS-SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
           L GC + ++ E+   P MSP+G+ L      P +    K      + +SLW D+ + LF+
Sbjct: 14  LGGCSAQTLKEVGRAPSMSPVGAGL-AYGETPQMAAYPKQPMPRSQGFSLWDDNKSKLFQ 72

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL---FGQQTPQMN-GN 129
           D+RA++VGDILTVD+ I+D+A FDN T RSR NS    ++ GF+L    G     +N G+
Sbjct: 73  DARAMSVGDILTVDLAINDKATFDNATDRSRQNS--SGINAGFNLPLLEGLGIGAVNEGD 130

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           L +    ++SG+G+  R+E+L L IAA+VT IL NGNL+ISGSQEVRVN E+R LNV GI
Sbjct: 131 LEFGSNTSTSGQGTTERSEQLELRIAAVVTGILPNGNLVISGSQEVRVNQELRILNVAGI 190

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VRP DVD +N+V+YDKIAEAR+SYGG+GR  E+ +PP+G QL++ LSP+
Sbjct: 191 VRPLDVDHNNTVAYDKIAEARVSYGGRGRLMEVQQPPVGQQLVDILSPI 239


>gi|218513038|ref|ZP_03509878.1| flagellar basal body L-ring protein [Rhizobium etli 8C-3]
          Length = 213

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 109/195 (55%), Positives = 136/195 (69%), Gaps = 4/195 (2%)

Query: 17  GCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC S  ++SEI   P MSP+GS L    + P + +  K   +  + YSLW DS AALF+D
Sbjct: 21  GCQSPTAVSEIGRAPAMSPIGSGL-AYGQTPQMALYPKQPRAVAQGYSLWSDSQAALFED 79

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
           +RALNVGDILTVDI+I+D+A FDN+T RSR NS          +FG  TP+   +L Y  
Sbjct: 80  ARALNVGDILTVDIQINDKASFDNETNRSRKNSSGMNWDVNAQIFGW-TPESKTDLTYGS 138

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             ++ GKG I R +KL LL+AA+VT ILENGNL+ISGSQEVR+N E+R LNV GIVRPQD
Sbjct: 139 DTSTDGKGKIERTDKLTLLVAAVVTGILENGNLVISGSQEVRLNQELRILNVAGIVRPQD 198

Query: 195 VDAHNSVSYDKIAEA 209
           V+A N +SYDKIAEA
Sbjct: 199 VNAENQISYDKIAEA 213


>gi|254473379|ref|ZP_05086776.1| flagellar L-ring protein FlgH [Pseudovibrio sp. JE062]
 gi|211957495|gb|EEA92698.1| flagellar L-ring protein FlgH [Pseudovibrio sp. JE062]
          Length = 236

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/237 (41%), Positives = 152/237 (64%), Gaps = 3/237 (1%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY- 61
           + + + +  +  L GC++ +  +   P ++P+G  L + +         K+S  + ++Y 
Sbjct: 2   KRTLVCILAAITLTGCNA-MKNVGKEPHLTPLGQGL-QPSVASLPATPAKSSGRSNRAYH 59

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
            LW D     F+D RA  VGD+LTV I+I D+A  DN + R R++S    L G FS  G 
Sbjct: 60  GLWADGEQDFFRDPRAKQVGDVLTVAIKIKDKAKLDNSSERKRDSSRSTGLKGAFSWAGV 119

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
            + + + +++  G  AS G+G+I R+E+++L IAA+VT +L NGNLIISG QEVRVN E+
Sbjct: 120 DSGEADASISGTGATASKGEGAIDRSEEIDLSIAAVVTKVLRNGNLIISGQQEVRVNYEV 179

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           R L+V GIVRP+D+   N++ YDKIAEAR+SYGG+GR TE+ +P +G Q+I+ +SP 
Sbjct: 180 RVLSVAGIVRPEDITGRNTIQYDKIAEARVSYGGRGRMTEVQQPSVGQQVIDIISPF 236


>gi|170748103|ref|YP_001754363.1| flagellar L-ring protein [Methylobacterium radiotolerans JCM 2831]
 gi|170654625|gb|ACB23680.1| flagellar L-ring protein [Methylobacterium radiotolerans JCM 2831]
          Length = 232

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 99/227 (43%), Positives = 145/227 (63%), Gaps = 6/227 (2%)

Query: 13  SLLFGCHSSISEITGIPQMSPMGSSLDEN-NRMPFLGIDFKNSDSTKKSYSLWRDSHAAL 71
           + L  C + + EI   P +SP+G  +D N + +P L +    +   +  +S W    A L
Sbjct: 11  TTLGACATPVQEIGRAPALSPVGLGIDPNHDAVPPLAV----ASQAQGYHSTWAQQSADL 66

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN 131
           F+D RA NVGD+LTV I ++D+A FDN T RSR++     L   F LFG  TP+   +  
Sbjct: 67  FQDPRAKNVGDVLTVLIAMNDKAQFDNATDRSRDSRAKTSLDLQFDLFGL-TPESKNHYE 125

Query: 132 YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVR 191
            +G  ++ G+G+I R E+L L +AA+VT +  NGN++ISGSQEVRVN E+R LN+ GIVR
Sbjct: 126 VNGNSSTKGQGTIDRKEQLRLSVAAVVTHVFPNGNMLISGSQEVRVNFEVRVLNIAGIVR 185

Query: 192 PQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           P+D+   N++ YDKIAEAR+SYGG+GR  E+ +P +  Q+ + +SP 
Sbjct: 186 PRDISRRNTIDYDKIAEARVSYGGRGRLMEVQQPAVAQQVYDLVSPF 232


>gi|254691408|ref|ZP_05154662.1| flagellar basal body L-ring protein [Brucella abortus bv. 6 str.
           870]
 gi|256256594|ref|ZP_05462130.1| flagellar basal body L-ring protein [Brucella abortus bv. 9 str.
           C68]
 gi|260757022|ref|ZP_05869370.1| flagellar basal body L-ring protein [Brucella abortus bv. 6 str.
           870]
 gi|260882832|ref|ZP_05894446.1| flagellar L-ring protein [Brucella abortus bv. 9 str. C68]
 gi|297249950|ref|ZP_06933651.1| flagellar L-ring protein FlgH [Brucella abortus bv. 5 str. B3196]
 gi|260677130|gb|EEX63951.1| flagellar basal body L-ring protein [Brucella abortus bv. 6 str.
           870]
 gi|260872360|gb|EEX79429.1| flagellar L-ring protein [Brucella abortus bv. 9 str. C68]
 gi|297173819|gb|EFH33183.1| flagellar L-ring protein FlgH [Brucella abortus bv. 5 str. B3196]
          Length = 242

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/241 (43%), Positives = 143/241 (59%), Gaps = 13/241 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + +    LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW
Sbjct: 8   AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLW 64

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT- 123
                  FKD RA   GD+LTV I I+D+A  DN+T R R   + + + GG   F   + 
Sbjct: 65  DQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFATSSI 121

Query: 124 ------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRV
Sbjct: 122 TGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRV 181

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 182 NNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQKPPYGQQILDQFSP 241

Query: 238 L 238
            
Sbjct: 242 F 242


>gi|256014946|ref|YP_003104955.1| flagellar L-ring protein precursor [Brucella microti CCM 4915]
 gi|255997606|gb|ACU49293.1| flagellar L-ring protein precursor [Brucella microti CCM 4915]
          Length = 238

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/241 (43%), Positives = 143/241 (59%), Gaps = 13/241 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + +    LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW
Sbjct: 4   AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLW 60

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT- 123
                  FKD RA   GD+LTV I I+D+A  DN+T R R   + + + GG   F   + 
Sbjct: 61  DQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFATSSI 117

Query: 124 ------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRV
Sbjct: 118 TGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRV 177

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 178 NNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRVSEIQQPPYGQQILDQFSP 237

Query: 238 L 238
            
Sbjct: 238 F 238


>gi|17989427|ref|NP_542060.1| flagellar basal body L-ring protein [Brucella melitensis bv. 1 str.
           16M]
 gi|256043077|ref|ZP_05446021.1| flagellar basal body L-ring protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256262861|ref|ZP_05465393.1| flagellar L-ring protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260564307|ref|ZP_05834792.1| flagellar L-ring protein [Brucella melitensis bv. 1 str. 16M]
 gi|265989515|ref|ZP_06102072.1| flagellar L-ring protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|17985304|gb|AAL54324.1| flagellar l-ring protein flgh [Brucella melitensis bv. 1 str. 16M]
 gi|260151950|gb|EEW87043.1| flagellar L-ring protein [Brucella melitensis bv. 1 str. 16M]
 gi|263000184|gb|EEZ12874.1| flagellar L-ring protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092696|gb|EEZ16905.1| flagellar L-ring protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326410339|gb|ADZ67403.1| flagellar basal body L-ring protein [Brucella melitensis M28]
 gi|326553631|gb|ADZ88270.1| flagellar basal body L-ring protein [Brucella melitensis M5-90]
          Length = 242

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/241 (43%), Positives = 144/241 (59%), Gaps = 13/241 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + +    LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW
Sbjct: 8   AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLW 64

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT- 123
               +  FKD RA   GD+LTV I I+D+A  DN+T R R   + + + GG   F   + 
Sbjct: 65  DQRSSNFFKDPRAATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFATSSI 121

Query: 124 ------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRV
Sbjct: 122 TGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRV 181

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 182 NNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSP 241

Query: 238 L 238
            
Sbjct: 242 F 242


>gi|225686016|ref|YP_002733988.1| flagellar basal body L-ring protein [Brucella melitensis ATCC
           23457]
 gi|31076715|sp|Q8YB19|FLGH_BRUME RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789277|sp|C0RKA1|FLGH_BRUMB RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|225642121|gb|ACO02034.1| Flagellar L-ring protein precursor [Brucella melitensis ATCC 23457]
          Length = 238

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/241 (43%), Positives = 144/241 (59%), Gaps = 13/241 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + +    LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW
Sbjct: 4   AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLW 60

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT- 123
               +  FKD RA   GD+LTV I I+D+A  DN+T R R   + + + GG   F   + 
Sbjct: 61  DQRSSNFFKDPRAATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFATSSI 117

Query: 124 ------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRV
Sbjct: 118 TGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRV 177

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 178 NNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSP 237

Query: 238 L 238
            
Sbjct: 238 F 238


>gi|23499920|ref|NP_699360.1| flagellar basal body L-ring protein [Brucella suis 1330]
 gi|161620240|ref|YP_001594126.1| flagellar basal body L-ring protein [Brucella canis ATCC 23365]
 gi|254702580|ref|ZP_05164408.1| flagellar basal body L-ring protein [Brucella suis bv. 3 str. 686]
 gi|260568512|ref|ZP_05838981.1| flagellar L-ring protein [Brucella suis bv. 4 str. 40]
 gi|261753160|ref|ZP_05996869.1| flagellar L-ring protein [Brucella suis bv. 3 str. 686]
 gi|31076710|sp|Q8FXC2|FLGH_BRUSU RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|189044479|sp|A9MDR7|FLGH_BRUC2 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|23463497|gb|AAN33365.1| flagellar L-ring protein FlgH [Brucella suis 1330]
 gi|161337051|gb|ABX63355.1| Flagellar L-ring protein precursor [Brucella canis ATCC 23365]
 gi|260155177|gb|EEW90258.1| flagellar L-ring protein [Brucella suis bv. 4 str. 40]
 gi|261742913|gb|EEY30839.1| flagellar L-ring protein [Brucella suis bv. 3 str. 686]
          Length = 238

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/241 (43%), Positives = 143/241 (59%), Gaps = 13/241 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + +    LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW
Sbjct: 4   AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLW 60

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT- 123
                  FKD RA   GD+LTV I I+D+A  DN+T R R   + + + GG   F   + 
Sbjct: 61  DQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFATSSI 117

Query: 124 ------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRV
Sbjct: 118 TGAAAGGDMDASINTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRV 177

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 178 NNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSP 237

Query: 238 L 238
            
Sbjct: 238 F 238


>gi|148558224|ref|YP_001257216.1| flagellar basal body L-ring protein [Brucella ovis ATCC 25840]
 gi|148369509|gb|ABQ62381.1| flagellar L-ring protein FlgH [Brucella ovis ATCC 25840]
          Length = 242

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/241 (43%), Positives = 143/241 (59%), Gaps = 13/241 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + +    LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW
Sbjct: 8   AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLW 64

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT- 123
                  FKD RA   GD+LTV I I+D+A  DN+T R R   + + + GG   F   + 
Sbjct: 65  DQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFAASSI 121

Query: 124 ------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRV
Sbjct: 122 TGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRV 181

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 182 NNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSP 241

Query: 238 L 238
            
Sbjct: 242 F 242


>gi|83269098|ref|YP_418389.1| flagellar basal body L-ring protein [Brucella melitensis biovar
           Abortus 2308]
 gi|189022371|ref|YP_001932112.1| flagellar basal body L-ring protein [Brucella abortus S19]
 gi|237816668|ref|ZP_04595660.1| Flagellar L-ring protein precursor [Brucella abortus str. 2308 A]
 gi|254698389|ref|ZP_05160217.1| flagellar basal body L-ring protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731836|ref|ZP_05190414.1| flagellar basal body L-ring protein [Brucella abortus bv. 4 str.
           292]
 gi|260544345|ref|ZP_05820166.1| flagellar L-ring protein [Brucella abortus NCTC 8038]
 gi|260759606|ref|ZP_05871954.1| flagellar basal body L-ring protein [Brucella abortus bv. 4 str.
           292]
 gi|260762848|ref|ZP_05875180.1| flagellar basal body L-ring protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|294853180|ref|ZP_06793852.1| flagellar L-ring protein FlgH [Brucella sp. NVSL 07-0026]
 gi|82939372|emb|CAJ12322.1| Flagellar L-ring protein [Brucella melitensis biovar Abortus 2308]
 gi|189020945|gb|ACD73666.1| Flagellar L-ring protein [Brucella abortus S19]
 gi|237787481|gb|EEP61697.1| Flagellar L-ring protein precursor [Brucella abortus str. 2308 A]
 gi|260097616|gb|EEW81490.1| flagellar L-ring protein [Brucella abortus NCTC 8038]
 gi|260669924|gb|EEX56864.1| flagellar basal body L-ring protein [Brucella abortus bv. 4 str.
           292]
 gi|260673269|gb|EEX60090.1| flagellar basal body L-ring protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|294818835|gb|EFG35835.1| flagellar L-ring protein FlgH [Brucella sp. NVSL 07-0026]
          Length = 242

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/241 (43%), Positives = 143/241 (59%), Gaps = 13/241 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + +    LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW
Sbjct: 8   AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLW 64

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT- 123
                  FKD RA   GD+LTV I I+D+A  DN+T R R   + + + GG   F   + 
Sbjct: 65  DQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFATSSI 121

Query: 124 ------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRV
Sbjct: 122 TGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRV 181

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 182 NNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSP 241

Query: 238 L 238
            
Sbjct: 242 F 242


>gi|306838568|ref|ZP_07471405.1| flagellar basal body L-ring protein [Brucella sp. NF 2653]
 gi|306406354|gb|EFM62596.1| flagellar basal body L-ring protein [Brucella sp. NF 2653]
          Length = 238

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 106/232 (45%), Positives = 140/232 (60%), Gaps = 13/232 (5%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
           LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW       FK
Sbjct: 13  LLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLWDQRSTNFFK 69

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT-------PQM 126
           D RA   GD+LTV I I+D+A  DN+T R R   + + + GG   F   +         M
Sbjct: 70  DPRAATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFATSSITGAAAGGDM 126

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           + ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRVN+E+R LNV
Sbjct: 127 DASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRVNNELRVLNV 186

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP 
Sbjct: 187 AGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSPF 238


>gi|254720606|ref|ZP_05182417.1| flagellar basal body L-ring protein [Brucella sp. 83/13]
 gi|265985646|ref|ZP_06098381.1| flagellar L-ring protein [Brucella sp. 83/13]
 gi|264664238|gb|EEZ34499.1| flagellar L-ring protein [Brucella sp. 83/13]
          Length = 242

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 106/232 (45%), Positives = 140/232 (60%), Gaps = 13/232 (5%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
           LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW       FK
Sbjct: 17  LLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLWDQRSTNFFK 73

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT-------PQM 126
           D RA   GD+LTV I I+D+A  DN+T R R   + + + GG   F   +         M
Sbjct: 74  DPRAATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFATSSITGAAAGGDM 130

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           + ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRVN+E+R LNV
Sbjct: 131 DASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRVNNELRVLNV 190

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP 
Sbjct: 191 AGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSPF 242


>gi|62317106|ref|YP_222959.1| flagellar basal body L-ring protein [Brucella abortus bv. 1 str.
           9-941]
 gi|163844350|ref|YP_001622005.1| flagellar basal body L-ring protein [Brucella suis ATCC 23445]
 gi|75495898|sp|Q579T6|FLGH_BRUAB RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|110816524|sp|Q2YJ67|FLGH_BRUA2 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|189044480|sp|A9WXL7|FLGH_BRUSI RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|62197299|gb|AAX75598.1| FlgH, flagellar L-ring protein [Brucella abortus bv. 1 str. 9-941]
 gi|163675073|gb|ABY39183.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 238

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 106/241 (43%), Positives = 143/241 (59%), Gaps = 13/241 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + +    LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW
Sbjct: 4   AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLW 60

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT- 123
                  FKD RA   GD+LTV I I+D+A  DN+T R R   + + + GG   F   + 
Sbjct: 61  DQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFATSSI 117

Query: 124 ------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRV
Sbjct: 118 TGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRV 177

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 178 NNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSP 237

Query: 238 L 238
            
Sbjct: 238 F 238


>gi|182680544|ref|YP_001834690.1| flagellar L-ring protein [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182636427|gb|ACB97201.1| flagellar L-ring protein [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 344

 Score =  191 bits (486), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 146/240 (60%), Gaps = 10/240 (4%)

Query: 3   RYSFIVLCYSSL-LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           R+SF  +   S+ L GC   I E+   P MS +G+ L    + P     F+N+  T+   
Sbjct: 111 RFSFAFVALGSVALAGCAGDIRELGREPAMSALGTGLAARVQ-PSATAVFQNASMTRPQ- 168

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL--- 118
           S+W  S   +F D RA  +GD++TV I I+D A F N T RS    L  K++ GF     
Sbjct: 169 SIWNGSRTDIFSDPRAARIGDVVTVMIFINDHATFGNNTDRS----LEAKINTGFDYKLG 224

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
              QT Q    +  D   ++ G+G+I R+EK+ L +AA+VT +L NGNLIISGSQEVRVN
Sbjct: 225 LSNQTIQFKPTITSDILSSTQGQGAIDRSEKMQLSVAAVVTDVLPNGNLIISGSQEVRVN 284

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            E+R LNV GIVRPQD+   N+VSYDKIAEARISYGG+GR  E+ +P IG Q+ +   P+
Sbjct: 285 FELRLLNVAGIVRPQDIAKDNTVSYDKIAEARISYGGRGRIMEVQQPAIGQQIYDRFKPI 344


>gi|254695294|ref|ZP_05157122.1| flagellar basal body L-ring protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261215663|ref|ZP_05929944.1| flagellar basal body L-ring protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|260917270|gb|EEX84131.1| flagellar basal body L-ring protein [Brucella abortus bv. 3 str.
           Tulya]
          Length = 242

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 106/241 (43%), Positives = 142/241 (58%), Gaps = 13/241 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + +    LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW
Sbjct: 8   AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLW 64

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT- 123
                  FKD RA   GD+LTV I I+D+A  DN+T R R   +   + GG   F   + 
Sbjct: 65  DQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRER---VSNGIYGGGGSFATSSI 121

Query: 124 ------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRV
Sbjct: 122 TGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRV 181

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 182 NNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSP 241

Query: 238 L 238
            
Sbjct: 242 F 242


>gi|256111939|ref|ZP_05452890.1| flagellar basal body L-ring protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265993386|ref|ZP_06105943.1| flagellar L-ring protein [Brucella melitensis bv. 3 str. Ether]
 gi|262764256|gb|EEZ10288.1| flagellar L-ring protein [Brucella melitensis bv. 3 str. Ether]
          Length = 242

 Score =  191 bits (485), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 105/241 (43%), Positives = 143/241 (59%), Gaps = 13/241 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + +    LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW
Sbjct: 8   AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLW 64

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT- 123
               +  FKD RA   GD+LTV I I+D+A  DN+  R R   + + + GG   F   + 
Sbjct: 65  DQRSSNFFKDPRAATPGDVLTVIISINDRANLDNKADRER---VSKGIYGGGGSFATSSI 121

Query: 124 ------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRV
Sbjct: 122 TGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRV 181

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 182 NNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSP 241

Query: 238 L 238
            
Sbjct: 242 F 242


>gi|256059605|ref|ZP_05449803.1| flagellar basal body L-ring protein [Brucella neotomae 5K33]
 gi|261323572|ref|ZP_05962769.1| flagellar L-ring protein [Brucella neotomae 5K33]
 gi|261299552|gb|EEY03049.1| flagellar L-ring protein [Brucella neotomae 5K33]
          Length = 242

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 105/241 (43%), Positives = 142/241 (58%), Gaps = 13/241 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + +    LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW
Sbjct: 8   AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLW 64

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT- 123
                  FKD RA   GD+LTV I I+D+A  DN+T R R   + + + GG   F   + 
Sbjct: 65  DQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFATSSI 121

Query: 124 ------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   M+ ++N      S GKG+I R+E + L IAAIVT  L N NLII GSQEVRV
Sbjct: 122 TGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNANLIIRGSQEVRV 181

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 182 NNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSP 241

Query: 238 L 238
            
Sbjct: 242 F 242


>gi|260466615|ref|ZP_05812803.1| flagellar L-ring protein [Mesorhizobium opportunistum WSM2075]
 gi|259029621|gb|EEW30909.1| flagellar L-ring protein [Mesorhizobium opportunistum WSM2075]
          Length = 236

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/238 (43%), Positives = 148/238 (62%), Gaps = 11/238 (4%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK---KSYS 62
            +VLC  + L GC +++ E+   P +SP+GS +D  +     G  +K  ++ +   K +S
Sbjct: 5   MLVLCAVAALSGCGTNLKEVGKEPALSPVGSGIDGGD----TGSLYKYPETPRAPVKKFS 60

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR--NNSLHRKLSGGFSLFG 120
           LW D  + LF D RAL+ GDILTV I+I+D+A F NQ  RSR  N  L   +S  +   G
Sbjct: 61  LWDDRQSRLFTDPRALSQGDILTVRIKINDRANFKNQNDRSRTANRKLGFDISAQWDKIG 120

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
               +  G LN      ++  G I R+E L L +AAIVT +L NGNL+I+GSQEVRVN E
Sbjct: 121 STAGKGAGALNSQTD--TTADGEIKRSETLELNVAAIVTDVLPNGNLMITGSQEVRVNAE 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +R L + GIVRP D+ A N++ Y++IAEARISYGG+GR TE+ +P  G Q+++ + P 
Sbjct: 179 LRVLTIAGIVRPADIGAENTIPYERIAEARISYGGRGRITEVQQPAYGQQVLDQVLPF 236


>gi|225628629|ref|ZP_03786663.1| Flagellar L-ring protein precursor [Brucella ceti str. Cudo]
 gi|254706288|ref|ZP_05168116.1| flagellar basal body L-ring protein [Brucella pinnipedialis
           M163/99/10]
 gi|254711418|ref|ZP_05173229.1| flagellar basal body L-ring protein [Brucella pinnipedialis B2/94]
 gi|256029952|ref|ZP_05443566.1| flagellar basal body L-ring protein [Brucella pinnipedialis
           M292/94/1]
 gi|256158114|ref|ZP_05456032.1| flagellar basal body L-ring protein [Brucella ceti M490/95/1]
 gi|256252932|ref|ZP_05458468.1| flagellar basal body L-ring protein [Brucella ceti B1/94]
 gi|261220023|ref|ZP_05934304.1| flagellar L-ring protein [Brucella ceti B1/94]
 gi|261313732|ref|ZP_05952929.1| flagellar L-ring protein [Brucella pinnipedialis M163/99/10]
 gi|261319026|ref|ZP_05958223.1| flagellar L-ring protein [Brucella pinnipedialis B2/94]
 gi|265986971|ref|ZP_06099528.1| flagellar L-ring protein [Brucella pinnipedialis M292/94/1]
 gi|265996631|ref|ZP_06109188.1| flagellar L-ring protein [Brucella ceti M490/95/1]
 gi|225616475|gb|EEH13523.1| Flagellar L-ring protein precursor [Brucella ceti str. Cudo]
 gi|260918607|gb|EEX85260.1| flagellar L-ring protein [Brucella ceti B1/94]
 gi|261298249|gb|EEY01746.1| flagellar L-ring protein [Brucella pinnipedialis B2/94]
 gi|261302758|gb|EEY06255.1| flagellar L-ring protein [Brucella pinnipedialis M163/99/10]
 gi|262550928|gb|EEZ07089.1| flagellar L-ring protein [Brucella ceti M490/95/1]
 gi|264659168|gb|EEZ29429.1| flagellar L-ring protein [Brucella pinnipedialis M292/94/1]
          Length = 242

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 105/241 (43%), Positives = 142/241 (58%), Gaps = 13/241 (5%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + + +    LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW
Sbjct: 8   AILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLW 64

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT- 123
                  FKD RA   GD+LTV I I+D+A  DN+T R R   + + + GG   F   + 
Sbjct: 65  DQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFATSSI 121

Query: 124 ------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                   M+ ++N      S GKG+I R+E + L IAAIVT  L NGNLII G QEVRV
Sbjct: 122 TGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGLQEVRV 181

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R LNV G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP
Sbjct: 182 NNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSP 241

Query: 238 L 238
            
Sbjct: 242 F 242


>gi|306841045|ref|ZP_07473769.1| flagellar basal body L-ring protein [Brucella sp. BO2]
 gi|306288934|gb|EFM60234.1| flagellar basal body L-ring protein [Brucella sp. BO2]
          Length = 242

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 138/229 (60%), Gaps = 13/229 (5%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           GC +   EI   P +SP+ + L   N   F G   +     K SYSLW       FKD R
Sbjct: 20  GCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLWDQRSTNFFKDPR 76

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT-------PQMNGN 129
           A   GD+LTV I I+D+A  DN+T R R   + + + GG   F   +         M+ +
Sbjct: 77  AATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFATSSITGAAAGGDMDAS 133

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           +N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRVN+E+R LNV G+
Sbjct: 134 VNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRVNNELRVLNVAGV 193

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP 
Sbjct: 194 VRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSPF 242


>gi|319781677|ref|YP_004141153.1| flagellar L-ring protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167565|gb|ADV11103.1| flagellar L-ring protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 235

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 149/244 (61%), Gaps = 24/244 (9%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENN-----RMPFLGIDFKNSDSTKKS 60
            +VLC  ++L GC +++ E+   P +SP+GS +D  +     R P      +   +  K 
Sbjct: 5   MLVLCAVAMLSGCGTNLKEVGREPALSPVGSGIDGGSTGSLYRYP------QTPPAPVKK 58

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           +SLW D  + LF D RAL+ GDILTV I+I+D+A F NQ  RSR  + +RKL  G+ L  
Sbjct: 59  FSLWDDRQSRLFTDPRALSQGDILTVKIKINDRANFKNQNDRSR--TANRKL--GYDLSA 114

Query: 121 QQTPQMNGNLNYDGGGA------SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
           Q            G GA      ++  G I R+E L L +AAIVT +L NGNL+I+GSQE
Sbjct: 115 QWDKWSTAG---KGAGALSSTTDTTADGEIKRSETLELNVAAIVTDVLPNGNLMITGSQE 171

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           VRVN E+R L + GIVRP D+ A N++ Y++IAEARISYGG+GR TE+ +P  G Q+++ 
Sbjct: 172 VRVNAELRVLTLAGIVRPADIGAENTIPYERIAEARISYGGRGRITEVQQPAYGQQILDQ 231

Query: 235 LSPL 238
           + P 
Sbjct: 232 VLPF 235


>gi|153011520|ref|YP_001372734.1| flagellar basal body L-ring protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151563408|gb|ABS16905.1| flagellar L-ring protein [Ochrobactrum anthropi ATCC 49188]
          Length = 242

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 140/232 (60%), Gaps = 13/232 (5%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
           LL GC +   EI   P +SP+ + L   N     G   + S   K +YSLW       FK
Sbjct: 17  LLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQSNGYPARPS---KATYSLWDQRSTNFFK 73

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP-------QM 126
           D RA   GD+LTV I I+D+A  DN+T R R   + + + G    F   +         M
Sbjct: 74  DPRAATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGAGGSFATSSSTGAGAGGDM 130

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           + +LN      S GKG+I R+E + L +AAIVT  L NGN+II GSQEVRVN+E+R LNV
Sbjct: 131 DASLNTHSDSKSKGKGTIERSEDIRLQVAAIVTDTLPNGNMIIRGSQEVRVNNELRVLNV 190

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            G+VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++ +SP 
Sbjct: 191 AGVVRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQVSPF 242


>gi|13472580|ref|NP_104147.1| flagellar basal body L-ring protein [Mesorhizobium loti MAFF303099]
 gi|20138306|sp|Q98HD3|FLGH_RHILO RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|14023326|dbj|BAB49933.1| flagellar L-ring protein; FlgH [Mesorhizobium loti MAFF303099]
          Length = 235

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 147/244 (60%), Gaps = 15/244 (6%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R + I LC  + L GC +++ E+   P +SP+GS +D  N               KK 
Sbjct: 1   MIRRTLI-LCAVAALSGCGTNLREVGKEPSLSPVGSGIDGGNTSALYKYPEPPRAPVKK- 58

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           +SLW D  + LF D RAL+ GDILTV I+I+D+A F NQ  RSR  + +RKL  GF L  
Sbjct: 59  FSLWDDRQSRLFTDPRALSQGDILTVRIKINDRANFKNQNDRSR--TANRKL--GFDLSA 114

Query: 121 QQTPQMNGNLNYDGGGA------SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
           Q            G GA      ++  G I R+E L L +AAIVT +L NGNL+I+GSQE
Sbjct: 115 QWDKWSTAG---KGAGALNSATDTTADGEIKRSETLELNVAAIVTDVLPNGNLMITGSQE 171

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           VRVN E+R L + GIVRP D+ A N++ Y++IAEARISYGG+GR +E+ +P  G Q+++ 
Sbjct: 172 VRVNAELRVLTIAGIVRPADIGAENTIPYERIAEARISYGGRGRISEIQQPAYGQQVLDQ 231

Query: 235 LSPL 238
           + P 
Sbjct: 232 VLPF 235


>gi|306846274|ref|ZP_07478835.1| flagellar basal body L-ring protein [Brucella sp. BO1]
 gi|306273269|gb|EFM55138.1| flagellar basal body L-ring protein [Brucella sp. BO1]
          Length = 238

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 137/229 (59%), Gaps = 13/229 (5%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           GC     EI   P +SP+ + L   N   F G   +     K SYSLW       FKD R
Sbjct: 16  GCAIKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLWDQRSTNFFKDPR 72

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT-------PQMNGN 129
           A   GD+LTV I I+D+A  DN+T R R   + + + GG   F   +         M+ +
Sbjct: 73  AATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGGGGSFATSSITGAAAGGDMDAS 129

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           +N      S GKG+I R+E + L IAAIVT  L NGNLII GSQEVRVN+E+R LNV G+
Sbjct: 130 VNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLPNGNLIIRGSQEVRVNNELRVLNVAGV 189

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++  SP 
Sbjct: 190 VRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSPF 238


>gi|110632652|ref|YP_672860.1| flagellar basal body L-ring protein [Mesorhizobium sp. BNC1]
 gi|123058276|sp|Q11LN0|FLGH_MESSB RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|110283636|gb|ABG61695.1| flagellar L-ring protein [Chelativorans sp. BNC1]
          Length = 235

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 144/224 (64%), Gaps = 4/224 (1%)

Query: 15  LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           + GC ++  E+   P +SP+GS  +      +   D + +  ++  YSLW D  + LF D
Sbjct: 16  MAGC-TTTEELGKPPALSPVGSGAEPTAMQAYHYPDRRQAHVSR--YSLWSDRQSRLFTD 72

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RAL VGDILTV I I+D+A F+N++ RSR  + +  L+G F++ G  T     + +   
Sbjct: 73  PRALEVGDILTVVISINDKAKFENESERSRQATRNLGLAGTFAI-GSATGSAEADADIGS 131

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
           G ++ G G+  R+E + L+IAAIVT  L NGNL ISG+QEVRVN E+R L + G+VRP D
Sbjct: 132 GTSTVGSGATKRSEDMRLVIAAIVTERLPNGNLRISGTQEVRVNAELRVLTIAGLVRPAD 191

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +N++SY++IAEARISYGG+GR TE+ +PP G Q ++ + P 
Sbjct: 192 IGPNNTISYERIAEARISYGGRGRLTEVQQPPYGQQFLDTVLPF 235


>gi|239834438|ref|ZP_04682766.1| Flagellar L-ring protein precursor [Ochrobactrum intermedium LMG
           3301]
 gi|239822501|gb|EEQ94070.1| Flagellar L-ring protein precursor [Ochrobactrum intermedium LMG
           3301]
          Length = 242

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 139/229 (60%), Gaps = 13/229 (5%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           GC +   EI   P +SP+ ++L   N     G   + S   K SYSLW       FKD R
Sbjct: 20  GCATKPEEIGRAPDLSPVAANLGMQNNPQSNGYPARPS---KASYSLWDQRSTNFFKDPR 76

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP-------QMNGN 129
           A   GD+LTV I I+D+A  DN+T R R   + + + G    F   +         M+ +
Sbjct: 77  AATPGDVLTVIISINDRANLDNKTDRER---VSKGIYGAGGSFATSSSTGAGAGGDMDAS 133

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           +N      S GKG+I R+E + L +AAIVT  L NGN+II GSQEVRVN+E+R LNV G+
Sbjct: 134 VNTHSDSKSKGKGTIERSEDIRLQVAAIVTDTLPNGNMIIRGSQEVRVNNELRVLNVAGV 193

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VRP+D+  +N++SYDKIAEARISYGG+GR +E+ +PP G Q+++ +SP 
Sbjct: 194 VRPRDISGNNTISYDKIAEARISYGGRGRLSEIQQPPYGQQILDQVSPF 242


>gi|188579871|ref|YP_001923316.1| flagellar L-ring protein [Methylobacterium populi BJ001]
 gi|179343369|gb|ACB78781.1| flagellar L-ring protein [Methylobacterium populi BJ001]
          Length = 236

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 144/225 (64%), Gaps = 11/225 (4%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRA 77
           C S I++I+  P ++P+GS L+   R P L   F    +    +S W  + AAL++D RA
Sbjct: 19  CQSDIAQISRPPVLTPIGSGLNAP-REP-LPTTFGALGARHSYHSTWSPASAALYQDPRA 76

Query: 78  LNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYD---- 133
            +VGD++TV I I+D+A FDN + R+R+    +K S GF  FG     +      D    
Sbjct: 77  RDVGDVITVSIAINDKAQFDNASERARS----QKSSLGFD-FGYGVSALKDTATADTGIR 131

Query: 134 GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQ 193
            G  + G+GSI R E L+L +AA+VT +L NGN++ISGSQEVRVN+E+R L V GIVRP+
Sbjct: 132 SGTETKGQGSIDRKESLSLSVAAVVTEVLPNGNVVISGSQEVRVNNEVRVLEVAGIVRPR 191

Query: 194 DVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           D+   N++ YDKIAEARISYGG+GR T++  P +G ++ E ++P 
Sbjct: 192 DISRKNTIDYDKIAEARISYGGRGRITDVQGPTLGQRVFETVAPF 236


>gi|163850067|ref|YP_001638110.1| flagellar L-ring protein [Methylobacterium extorquens PA1]
 gi|240137201|ref|YP_002961670.1| flagellar L-ring protein FlgH [Methylobacterium extorquens AM1]
 gi|254559213|ref|YP_003066308.1| flagellar L-ring protein FlgH [Methylobacterium extorquens DM4]
 gi|163661672|gb|ABY29039.1| flagellar L-ring protein [Methylobacterium extorquens PA1]
 gi|240007167|gb|ACS38393.1| flagellar L-ring protein FlgH [Methylobacterium extorquens AM1]
 gi|254266491|emb|CAX22255.1| flagellar L-ring protein FlgH [Methylobacterium extorquens DM4]
          Length = 235

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 141/238 (59%), Gaps = 3/238 (1%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M   S  V   +  L  C S +  +   P ++P+G+ L+   R P L   F         
Sbjct: 1   MRPSSAAVAVLALSLGACQSDLDRLGRPPLLTPIGTGLNAP-REP-LPTSFGALGPRHSY 58

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           +S W  + AAL++D RA +VGD++TV I I+D+A FDN + R R+         G+ + G
Sbjct: 59  HSTWSPASAALYQDPRARDVGDVITVSIAINDKAQFDNASERGRSQKSSLGFDFGYGISG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            +      +     G  + G+GSI R E L+L +AA+VT +L NGN++ISGSQEVRVN+E
Sbjct: 119 LKD-TATADTGIRSGTETKGQGSIDRKESLSLSVAAVVTEVLPNGNVLISGSQEVRVNNE 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +R L V GIVRP+D+   N++ YDKIAEARISYGG+GR T++  P +G ++ E ++P 
Sbjct: 178 VRVLEVAGIVRPRDISRKNTIDYDKIAEARISYGGRGRITDVQGPSLGQRVFETVAPF 235


>gi|114706775|ref|ZP_01439675.1| flagellar L-ring protein precursor H [Fulvimarina pelagi HTCC2506]
 gi|114537723|gb|EAU40847.1| flagellar L-ring protein precursor H [Fulvimarina pelagi HTCC2506]
          Length = 235

 Score =  175 bits (443), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 139/226 (61%), Gaps = 6/226 (2%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
           LL GC ++  +    P +SP+G+ + +   +      F    +  K+ SLW DS A  ++
Sbjct: 13  LLAGCSTNSQDAFREPALSPVGAGIYQYPNL-VTPASFPKGGTGAKN-SLWTDSRADFYQ 70

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH--RKLSGGFSLFGQQTPQMNGNLN 131
           D RAL++GDI+TV I I D+A   N + R R + +     +SG F  +    P +   L 
Sbjct: 71  DPRALSMGDIVTVKINISDKASLANLSERERESGISGGADISGSFGSWA--LPTVGATLG 128

Query: 132 YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVR 191
            DGG  + G G + R+E + L +AA+VT  L NGNL ISG QEVRVN E+R L++ GI+R
Sbjct: 129 LDGGSDAKGSGRVKRSEDIELSVAAVVTQELPNGNLFISGQQEVRVNFEVRVLSIAGIIR 188

Query: 192 PQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           P+D+  +N++ YDKIAEARISYGG+GR TE+ +P  GHQ+ + +SP
Sbjct: 189 PRDILPNNTIDYDKIAEARISYGGRGRITEVQQPGWGHQVYDTVSP 234


>gi|218528670|ref|YP_002419486.1| flagellar L-ring protein [Methylobacterium chloromethanicum CM4]
 gi|218520973|gb|ACK81558.1| flagellar L-ring protein [Methylobacterium chloromethanicum CM4]
          Length = 235

 Score =  174 bits (442), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 92/221 (41%), Positives = 136/221 (61%), Gaps = 3/221 (1%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRA 77
           C S +  +   P ++P+G+ L+   R P L   F         +S W  + AAL++D RA
Sbjct: 18  CQSDLDRLGRPPLLTPIGTGLNAP-REP-LPTSFGALGPRHSYHSTWSPASAALYQDPRA 75

Query: 78  LNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGA 137
            +VGD++TV I I+D+A FDN + R R+         G+ + G +      +     G  
Sbjct: 76  RDVGDVITVSIAINDKAQFDNASERGRSQKSSLGFDFGYGISGLKD-TATADTGIRSGTE 134

Query: 138 SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDA 197
           + G+GSI R E L+L +AA+VT +L NGN++ISGSQEVRVN+E+R L V GIVRP+D+  
Sbjct: 135 TKGQGSIDRKESLSLSVAAVVTEVLPNGNVLISGSQEVRVNNEVRVLEVAGIVRPRDISR 194

Query: 198 HNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            N++ YDKIAEARISYGG+GR T++  P +G ++ E ++P 
Sbjct: 195 KNTIDYDKIAEARISYGGRGRITDVQGPSLGQRVFETVAPF 235


>gi|312115245|ref|YP_004012841.1| flagellar L-ring protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311220374|gb|ADP71742.1| flagellar L-ring protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 243

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 142/232 (61%), Gaps = 9/232 (3%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
           +L GC + ++EI   P ++P+G+ L   +    +G       S     SLW+D+ A LFK
Sbjct: 14  MLGGCFNRMNEIGREPGLTPVGAGLVPAHTA--IGTMPATPASYVTRASLWQDNGADLFK 71

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG-----QQTPQMNG 128
           D RA  VGD++TV I I D+A  DN   RSR+++    ++   +L           Q +G
Sbjct: 72  DPRATKVGDVITVKISIKDKASIDNNNSRSRSSTRELDITNKANLSWSGLNKHLDTQSSG 131

Query: 129 NLN--YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
            L+   +   ++  KG ISRAE +NLLI A+VT +L NGNLI++G QEVRVN E+R L +
Sbjct: 132 ELDPKVESTTSTDAKGGISRAESINLLIGAVVTEVLPNGNLIVAGRQEVRVNFELRELLI 191

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +GI+RP+D+   NS+SYDKIAEARISYGG+GR  ++ +P  G Q+ + L P 
Sbjct: 192 SGIIRPRDIATDNSISYDKIAEARISYGGRGRIMDVAQPAWGQQVTDWLLPF 243


>gi|170741840|ref|YP_001770495.1| flagellar L-ring protein [Methylobacterium sp. 4-46]
 gi|168196114|gb|ACA18061.1| flagellar L-ring protein [Methylobacterium sp. 4-46]
          Length = 232

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 135/225 (60%), Gaps = 6/225 (2%)

Query: 15  LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS-LWRDSHAALFK 73
           L  C   +  I   P ++P+G+ L    R P L   F  + + ++SYS  W    A LF+
Sbjct: 13  LGACAQPLDPIGRPPLLTPIGTGL-AAPREP-LPASF--AATPRRSYSSTWAPGAADLFQ 68

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYD 133
           D RA N+GD++TV I I+D+A FDN T RSR+          + + G +      +    
Sbjct: 69  DPRARNIGDVITVSISINDKAQFDNATDRSRSQKSSLGFDFSYGVSGVKD-SATADAGIR 127

Query: 134 GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQ 193
            G  + G G+I R E L+L +AA+VT  L NGNL+ISGSQEVRVN E+R L V GIVRP+
Sbjct: 128 SGTETKGNGTIDRKENLSLSVAAVVTDTLPNGNLLISGSQEVRVNSEVRVLTVAGIVRPR 187

Query: 194 DVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           D+   N++ YDKIAEARISYGG+GR T++  P IG ++ E ++P 
Sbjct: 188 DITRKNTIDYDKIAEARISYGGRGRITDVQDPTIGQRVFETVTPF 232


>gi|300024602|ref|YP_003757213.1| flagellar L-ring protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526423|gb|ADJ24892.1| flagellar L-ring protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 246

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 141/224 (62%), Gaps = 13/224 (5%)

Query: 22  ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY----SLWRDSHAALFKDSRA 77
           + E++  P MSP+GS L    R+P + +       TK +Y    S WRDS A LF+D+RA
Sbjct: 29  LKEVSREPVMSPVGSGL-LPERLPHVQLPV-----TKAAYTSGNSTWRDSGADLFRDARA 82

Query: 78  LNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF---SLFGQQTPQMNGNLNYDG 134
              GD++TV ++I DQA   N   R R++S+    S  +         +   + N N D 
Sbjct: 83  FKNGDVVTVKVQIKDQATLGNTLNRKRDSSVGLTSSLDYDLGFGGAGGSGSGSLNGNLDR 142

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             ++  KG I+R+E +NLL+AA+V+ +L NGNL+ISG+QEVRVN E+R L+V GI+RP+D
Sbjct: 143 TTSTDSKGGITRSENINLLVAAVVSEVLPNGNLVISGTQEVRVNFEVRVLSVAGIIRPRD 202

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +   N +SYDKIAEAR+SYGG+GR  E+ +P  G Q+++ ++P 
Sbjct: 203 ISTDNQISYDKIAEARVSYGGRGRVMEVQQPAYGQQILDIIAPF 246


>gi|90418388|ref|ZP_01226300.1| flagellar L-ring protein FlgH [Aurantimonas manganoxydans SI85-9A1]
 gi|90338060|gb|EAS51711.1| flagellar L-ring protein FlgH [Aurantimonas manganoxydans SI85-9A1]
          Length = 234

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 135/220 (61%), Gaps = 1/220 (0%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           GC ++ ++    P +SP+G+ L E   +      F  S     S+SLW D+ A  ++D R
Sbjct: 14  GCSTAGNDALREPSLSPVGAGLYEYPPIIAQPASFPAS-KPHTSHSLWSDARADFYQDPR 72

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGG 136
           AL+ GDI+TV IRI DQA  DN + RSR + +   L    +L     P +   L  D   
Sbjct: 73  ALSEGDIVTVKIRIRDQASIDNNSERSRKSGIAAGLDLAGNLGQYTLPTVGAQLGSDNSS 132

Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVD 196
             +GKG I R+E ++L +AA+V   L NGNL ISG QEVRVN E+R L++ GI+RP+D+ 
Sbjct: 133 DMTGKGKIKRSEDIDLSVAAVVGQKLPNGNLFISGQQEVRVNFEVRVLSIAGIIRPRDIL 192

Query: 197 AHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
             N+++YDKIAEARISYGG+GR T++ +P  G Q+ + ++
Sbjct: 193 PDNTINYDKIAEARISYGGRGRITDVQQPGWGQQIYDAVA 232


>gi|46203816|ref|ZP_00050943.2| COG2063: Flagellar basal body L-ring protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 191

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 119/178 (66%), Gaps = 1/178 (0%)

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           +S W  + AAL++D RA +VGD++TV I I+D+A FDN + R R+         G+ + G
Sbjct: 15  HSTWSPASAALYQDPRAHDVGDVITVSISINDKAQFDNASDRQRSQKSSLGFDFGYGVSG 74

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            +      +     G  + G+GSI R E L+L +AA+VT +L NGN++ISGSQEVRVN+E
Sbjct: 75  LKD-TATADTGIRSGTETKGQGSIDRKESLSLSVAAVVTEVLPNGNVVISGSQEVRVNNE 133

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +R L V GIVRP+D+   N++ YDKIAEARISYGG+GR T++  P +G Q+ E L+P 
Sbjct: 134 VRVLEVAGIVRPRDISRKNTIDYDKIAEARISYGGRGRLTDVQGPTLGQQVFETLAPF 191


>gi|319898641|ref|YP_004158734.1| flagellar L-ring protein precursor (Basal body L-ring protein)
           [Bartonella clarridgeiae 73]
 gi|319402605|emb|CBI76150.1| Flagellar L-ring protein precursor (Basal body L-ring protein)
           [Bartonella clarridgeiae 73]
          Length = 210

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 121/182 (66%), Gaps = 4/182 (2%)

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
           ++  YSL+R S  + ++D RA+  GD+LTV I I+D+A F+N++   R++     +  G+
Sbjct: 33  SESQYSLYRSSANSFYRDPRAMKPGDVLTVQIFINDRASFNNKSDLKRDSGSKYTIGAGY 92

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           S   +      G++  +    S G   I R E + L IAAIVT +L NGNL+I+GSQEVR
Sbjct: 93  SFMNK----FAGSIEGESSSQSKGDAKIERQENIRLSIAAIVTDVLPNGNLVINGSQEVR 148

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LN+ G+VRP+D+  +N + YDKIAEARISYGG+GR +E+ +PP G QL+  ++
Sbjct: 149 VNNELRVLNIAGLVRPRDISGNNMIDYDKIAEARISYGGRGRMSEIQQPPYGQQLLNQIA 208

Query: 237 PL 238
           P 
Sbjct: 209 PF 210


>gi|288958677|ref|YP_003449018.1| flagellar L-ring protein precursor [Azospirillum sp. B510]
 gi|288910985|dbj|BAI72474.1| flagellar L-ring protein precursor [Azospirillum sp. B510]
          Length = 255

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 99/250 (39%), Positives = 147/250 (58%), Gaps = 16/250 (6%)

Query: 1   MYRYSFIVLCYSSLL-FGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           + R++ I    +SL   G  S I++I   P+MS +     +    P + +       T++
Sbjct: 10  LIRFAMIATAATSLTACGAASRIADIGKAPEMSNIQDPQAKPGYQP-VSLPMPTPLPTER 68

Query: 60  SY-SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           +  SLWR    A FKD RA  VGDILT++I I DQA   N++ R+R N+   + +G  +L
Sbjct: 69  NPNSLWRTGAKAFFKDQRAGKVGDILTINISIADQAKLSNESKRARANT---EKAGIPNL 125

Query: 119 FGQQTPQMNGNL----------NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
           FG +   +N  L          N +    + GKGS+ R EK+ L +AA+VT  L NGNL+
Sbjct: 126 FGMEGDTLNRILPTGASATNLVNMNSNTNNDGKGSVDRNEKIELKVAALVTQTLPNGNLV 185

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G QEVRVN E+R L + G++RP+D+ A N++SY+KIAEARISYGG+G+ T++ +P  G
Sbjct: 186 IQGRQEVRVNYELRDLQIHGVIRPEDITAQNTISYEKIAEARISYGGRGQITDVQQPRYG 245

Query: 229 HQLIENLSPL 238
            QL + + P 
Sbjct: 246 QQLYDIIMPF 255


>gi|121602817|ref|YP_989396.1| flagellar basal body L-ring protein [Bartonella bacilliformis
           KC583]
 gi|166214815|sp|A1UTU3|FLGH_BARBK RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|120614994|gb|ABM45595.1| flagellar L-ring protein FlgH [Bartonella bacilliformis KC583]
          Length = 230

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 137/233 (58%), Gaps = 7/233 (3%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           F ++  S ++  C  +  +   +P  SP+ + L      P            + +YSL+R
Sbjct: 5   FGIIFTSVIVTSCSYNTKDFNSVPDFSPVRADL---GYAPSRTAQTYPLPPRESNYSLYR 61

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
            S  + F+D RA+  GD+LTV I I+D+A  +N++    ++S    +  G+S   +    
Sbjct: 62  ASGNSFFRDPRAMQPGDVLTVQISINDRASLNNKSDLKSDSSSKYTIGTGYSFMDR---- 117

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           + G+L  +    S G G I R E + L +AAIVT +L NGNLII GSQEVRVN E+R LN
Sbjct: 118 IAGSLEGESSNQSKGDGKIERQENIRLSVAAIVTDVLPNGNLIIRGSQEVRVNHELRILN 177

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           + G+VRP+D+  +N + YDKIAEARISYGG+GR +E+ +PP G QL+  +SP 
Sbjct: 178 IAGVVRPRDISGNNMIEYDKIAEARISYGGRGRISEIQQPPYGQQLLNQISPF 230


>gi|319406980|emb|CBI80617.1| Flagellar L-ring protein [Bartonella sp. 1-1C]
          Length = 221

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/229 (38%), Positives = 141/229 (61%), Gaps = 11/229 (4%)

Query: 12  SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAAL 71
           S +L  C  ++ +    P  SP+ + L   +              ++  YSL+R S ++ 
Sbjct: 2   SIILASCSYNVKDFNSAPNFSPVRADLGYASSH---AASIYPPAPSESRYSLYRSSASSF 58

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN 131
           ++D RA+  GD+LTV I I+D+A  +N++   R+++    +  G+S   +    + G++ 
Sbjct: 59  YRDPRAMKPGDVLTVQIFINDRASLNNKSDLKRDSNSKYTIGAGYSFMDK----LAGSI- 113

Query: 132 YDGGGASSGKG--SISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
            +GG +S  KG   + R E + L IAAIVT +L NGNL+I+GSQEVRVN+E+R LN+ G+
Sbjct: 114 -EGGSSSQSKGDTKVERQENIRLSIAAIVTDVLPNGNLVINGSQEVRVNNELRILNIAGL 172

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VRP+D+  +N + YDKIAEARISYGG+GR +E+ +PP G QL+  ++P 
Sbjct: 173 VRPRDISGNNMIDYDKIAEARISYGGRGRMSEIQQPPYGQQLLNQIAPF 221


>gi|319403965|emb|CBI77553.1| Flagellar L-ring protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 221

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/229 (38%), Positives = 141/229 (61%), Gaps = 11/229 (4%)

Query: 12  SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAAL 71
           S +L  C  ++ +    P  SP+ + L   +              ++  YSL+R S ++ 
Sbjct: 2   SIILASCSYNVKDFNSAPNFSPVRADLGYASSH---AASIYPPAPSESRYSLYRSSASSF 58

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN 131
           ++D RA+  GD+LTV I I+D+A  +N++   R+++    +  G+S   +    + G++ 
Sbjct: 59  YRDPRAMKPGDVLTVQIFINDRASLNNKSDLKRDSNSKYTIGAGYSFMDK----LAGSI- 113

Query: 132 YDGGGASSGKG--SISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
            +GG +S  KG   + R E + L IAAIVT +L NGNL+I+GSQEVRVN+E+R LN+ G+
Sbjct: 114 -EGGSSSQSKGDTKVERQENIRLSIAAIVTDVLPNGNLVINGSQEVRVNNELRILNIVGL 172

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VRP+D+  +N + YDKIAEARISYGG+GR +E+ +PP G QL+  ++P 
Sbjct: 173 VRPRDISGNNMIDYDKIAEARISYGGRGRMSEIQQPPYGQQLLNQIAPF 221


>gi|90422614|ref|YP_530984.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           BisB18]
 gi|90104628|gb|ABD86665.1| flagellar L-ring protein [Rhodopseudomonas palustris BisB18]
          Length = 234

 Score =  169 bits (427), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 91/224 (40%), Positives = 140/224 (62%), Gaps = 5/224 (2%)

Query: 15  LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           L GC ++++E+   P MSP+G  L  + R   + ++ + S   +  YSLW +    L++D
Sbjct: 16  LAGCANNLAELGQAPAMSPIGQGLYADARA--IPVEPR-SRYAQNRYSLWNERRD-LYRD 71

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDG 134
            RA  VGD+LTV I ++D+A  DN+T RSR++    K +   + F   + +     N D 
Sbjct: 72  PRASRVGDLLTVTISMNDKATLDNKTDRSRDSETKFK-TNYLAEFLPWSSKGKLEANVDS 130

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             ++ G G I R E++   +AA V  +L NGNL+I+GSQEVRVN E+R L+V GIVRP D
Sbjct: 131 QTSTKGTGKIDRTEEVKFSVAAAVVDVLPNGNLLIAGSQEVRVNYEMRVLHVGGIVRPLD 190

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +N+++Y+K+AEARISYGG+GR  E+ +P  GHQ+ + + P 
Sbjct: 191 ITRNNTIAYEKVAEARISYGGRGRLMEVQQPAWGHQVYDQVVPF 234


>gi|328545501|ref|YP_004305610.1| flagellar L-ring protein H [polymorphum gilvum SL003B-26A1]
 gi|326415243|gb|ADZ72306.1| Flagellar L-ring protein H [Polymorphum gilvum SL003B-26A1]
          Length = 234

 Score =  168 bits (426), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 102/224 (45%), Positives = 138/224 (61%), Gaps = 8/224 (3%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY-SLWRDSHAALFKDSR 76
           C   ++E+   P MSP+G  L       F    F  S S +K Y SLW       F D R
Sbjct: 16  CAGQLNEVGREPTMSPVGYGLMAQPGAMFPLNTF--SPSARKEYNSLWVSGREDFFSDPR 73

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGG 136
           A  +GD+LTV I I+D+A  DN + R RN+S+     GG +  G       G+   D   
Sbjct: 74  ARRIGDVLTVRIAINDKATLDNTSNRRRNSSIG---FGGEASAGWDGSSTGGDAALDASS 130

Query: 137 AS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
           AS  +GKGSI R E++ L +AA+VT  L NGNL+ISGSQEVRVN E+R L+VTGIVRP+D
Sbjct: 131 ASSSTGKGSIDRKEEIALSVAAVVTDRLPNGNLVISGSQEVRVNYEMRVLHVTGIVRPRD 190

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +   N+++YDKIAEARISYGG+GR +E+ +P  G Q+++ ++P 
Sbjct: 191 IGGDNTIAYDKIAEARISYGGRGRISEIQQPGWGQQVLDIVTPF 234


>gi|217976229|ref|YP_002360376.1| flagellar L-ring protein [Methylocella silvestris BL2]
 gi|217501605|gb|ACK49014.1| flagellar L-ring protein [Methylocella silvestris BL2]
          Length = 233

 Score =  168 bits (426), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 97/233 (41%), Positives = 136/233 (58%), Gaps = 7/233 (3%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
             +LC    L GC   + E+   P MSP+G+ L    + P     F  +     S S+W 
Sbjct: 8   LTMLC----LCGCAGDLRELGREPSMSPVGTGLMAEVQ-PTASALFLPA-PKPDSRSIWS 61

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
              A +F D RA  +GD++T++I I+D+A F N T RS ++++   L     L   +  +
Sbjct: 62  GGRADIFSDPRAAKIGDVVTINIGINDRASFGNTTDRSLDSAVGASLDWKLGLNNTRN-E 120

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
                       + G+G+  RAEK+ L +AAIVT +L NGNLIISGSQEVRVN E+R LN
Sbjct: 121 FKPEYLATAISKTKGEGNTDRAEKIQLSVAAIVTDVLPNGNLIISGSQEVRVNFELRLLN 180

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           V GIVRP+D+   N++SYDK+AEARISYGG+GR  E+ +P  G Q+ +   PL
Sbjct: 181 VAGIVRPRDISKENTISYDKVAEARISYGGRGRIMEVQQPAWGQQVYDWFKPL 233


>gi|319405405|emb|CBI79024.1| Flagellar L-ring protein [Bartonella sp. AR 15-3]
          Length = 217

 Score =  168 bits (425), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 122/182 (67%), Gaps = 4/182 (2%)

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
           ++  YSL+R S  + ++D RA+  GD+LTV I I+D+A  +N++   R++S    +  G+
Sbjct: 40  SESRYSLYRSSANSFYRDPRAMKPGDVLTVQIFINDRASLNNKSDLKRDSSSKYTIGAGY 99

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           S   +    + G++  +    S G   + R E + L IAAIVT +L NGNL+I+GSQEVR
Sbjct: 100 SFMDK----LAGSIEGESSSQSKGDTKVERQENIRLSIAAIVTNVLPNGNLVINGSQEVR 155

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN+E+R LN+ G+VRP+D+  +N + YDKIAEARISYGG+GR +E+ +PP G QL+  ++
Sbjct: 156 VNNELRILNIAGLVRPRDISGNNMIDYDKIAEARISYGGRGRMSEIQQPPYGQQLLNQIA 215

Query: 237 PL 238
           P 
Sbjct: 216 PF 217


>gi|319409183|emb|CBI82827.1| Flagellar L-ring protein [Bartonella schoenbuchensis R1]
          Length = 247

 Score =  167 bits (424), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 89/225 (39%), Positives = 131/225 (58%), Gaps = 8/225 (3%)

Query: 15  LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA-LFK 73
           L  C  +  +    P  SP+ + L      P     F      +  YSL+R +     ++
Sbjct: 30  LAACSYNPKDFNSTPDFSPVRADL---GFAPSRAAHFYPPAPKESKYSLYRPNVVNNFYR 86

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYD 133
           D RA+  GD+LTV I I+D+A F+N++   R++S    +   +S   +    + G +   
Sbjct: 87  DPRAMKPGDVLTVQIFINDRASFNNKSDLKRDSSSKYTVGTEYSFLEK----LAGGVEAS 142

Query: 134 GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQ 193
               S G G + R E + L IAA+VT +L NGNL+ISGSQEVRVN E+R LN+ G+VRP+
Sbjct: 143 SSNQSKGDGKVERQENIRLSIAAVVTDVLPNGNLVISGSQEVRVNYEMRILNIAGVVRPR 202

Query: 194 DVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           D+ A+N + YDKIAEARISYGG+GR +E+ +PP G QL+  ++P 
Sbjct: 203 DISANNMIDYDKIAEARISYGGRGRMSEIQQPPYGQQLLNQIAPF 247


>gi|209964692|ref|YP_002297607.1| flagellar L-ring protein FlgH [Rhodospirillum centenum SW]
 gi|209958158|gb|ACI98794.1| flagellar L-ring protein FlgH [Rhodospirillum centenum SW]
          Length = 259

 Score =  165 bits (418), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 142/246 (57%), Gaps = 16/246 (6%)

Query: 6   FIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
            ++    SLL  C S   ++ +   P ++P+ +        P        +   +++ SL
Sbjct: 17  LVLAAAVSLLSACSSMDRLASVGQTPPLTPIQNPATAPGYQPVSLPMPAPAQGEREANSL 76

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ- 122
           WR    A F+D RA  VGDILT+ I+I+D+A   NQ+ R+RN   +  + G   LFG Q 
Sbjct: 77  WRAGARAFFRDQRANRVGDILTITIQINDKAQIQNQSQRTRNGKENMGIPG---LFGLQR 133

Query: 123 -------TP---QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
                  TP    +   +      +S G GSI R+E++N+ +AA++T +L NGNL++ G 
Sbjct: 134 NIARVLPTPDNDTLESLVKTTADSSSVGTGSIGRSEQINMQVAALITQVLPNGNLVVQGK 193

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           QEVRVN E+R L + GI+RP+D+ + N++SY+KIAEARISYGG+G  +++ +P  G Q+ 
Sbjct: 194 QEVRVNYEVRELTINGIIRPEDITSQNTISYEKIAEARISYGGRGHISDVQQPRWGQQVF 253

Query: 233 ENLSPL 238
           + ++P 
Sbjct: 254 DIVAPF 259


>gi|315497879|ref|YP_004086683.1| flagellar l-ring protein [Asticcacaulis excentricus CB 48]
 gi|315415891|gb|ADU12532.1| flagellar L-ring protein [Asticcacaulis excentricus CB 48]
          Length = 242

 Score =  165 bits (417), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 132/228 (57%), Gaps = 10/228 (4%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           GC +S++E    P + PMG        +P   +    + ++  + SLWR    A FKD R
Sbjct: 19  GC-ASVNEAVNGPSLQPMGYPAQ---LVPQQQVYAPPASTSASANSLWRTGAKAFFKDQR 74

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL---FGQQTPQM---NGNL 130
           A +VGDILTV I IDD+A   N T R R+ S    +   F L    G+  P     +  L
Sbjct: 75  ARHVGDILTVTIDIDDKAQTQNTTSRKRDGSYTGSVPSVFGLESSLGKILPSEYNPSAGL 134

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
           + +     SG GS++R+EK++L +AAIVT +L NGNLII GSQEVR N E+R L V+GIV
Sbjct: 135 SNNTAAEFSGSGSVNRSEKISLTVAAIVTGVLPNGNLIIQGSQEVRTNREVRELIVSGIV 194

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            PQD+ + N + + ++AEARISYGG+G  + +   P+   L+E  SP 
Sbjct: 195 NPQDISSANIIKHTQLAEARISYGGRGDVSRMQAAPVSQNLMEKFSPF 242


>gi|115523183|ref|YP_780094.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           BisA53]
 gi|115517130|gb|ABJ05114.1| flagellar L-ring protein [Rhodopseudomonas palustris BisA53]
          Length = 234

 Score =  164 bits (416), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 143/237 (60%), Gaps = 17/237 (7%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           +  C +S   GC +++++    P MSP+G  L  + R   + I+ +    T   +SLW D
Sbjct: 10  LAACLASA--GCANNLADFNQAPLMSPIGQGLQADARA--IPIE-RRGRFTPGRHSLW-D 63

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP-- 124
               L++D RA  +GD+LTV I ++D+A  DN+T RSR++    K    F    +  P  
Sbjct: 64  ERKDLYRDPRASRIGDLLTVTISMNDKATLDNKTDRSRDS----KTKFDFDYLAEFLPLS 119

Query: 125 ---QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
              +++ N+N     ++ G G I R E++   +AA+V  +L NG+L+ISGSQEVRVN E+
Sbjct: 120 KKGKLDANVN--SQSSTKGTGKIDRTEEVKFSVAAVVVDVLPNGSLLISGSQEVRVNYEM 177

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           R L V GIVRP D+  +N+++Y+K+AEARISYGG+GR  E+ +P  GHQ+ + + P 
Sbjct: 178 RVLTVGGIVRPLDITRNNTIAYEKVAEARISYGGRGRLMEVQQPAWGHQVYDQVVPF 234


>gi|148256794|ref|YP_001241379.1| flagellar basal body L-ring protein [Bradyrhizobium sp. BTAi1]
 gi|146408967|gb|ABQ37473.1| Flagellar L-ring protein (Basal body L-ring protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 259

 Score =  164 bits (416), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 142/249 (57%), Gaps = 14/249 (5%)

Query: 1   MYRYSFIVLCYSSLLF--GCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDS 56
           + R + + + ++ L F  GC S   IS+I   P+++ + +   +    P      K    
Sbjct: 14  LRRVALVSVSFAVLSFAGGCSSIDRISQIGERPKLTEIDNPTTQPGYKPVQMPMPKPEVV 73

Query: 57  TKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF 116
           +    SLWR+   A FKD RA  VGD+LTV + I D+A   N+T RSR N   ++ SG  
Sbjct: 74  SYAPNSLWRNGSRAFFKDQRARQVGDLLTVTVSISDKANIANETQRSRTN---KEDSGIT 130

Query: 117 SLFGQQTPQMNGN-------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
              G +T    G        L  DG  +S GKG+I R+E L   +AA+VT +L NGNL++
Sbjct: 131 DFVGSKTLGATGKNILPGRILTADGTSSSDGKGTIQRSESLTTSVAAVVTQVLPNGNLVV 190

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
            G QE+RVN EIR L V GIVRP+D+ + N++   KIA+ARISYGG+G+ T++ +P  G 
Sbjct: 191 EGKQEIRVNYEIRELIVAGIVRPEDIQSDNTIDSTKIAQARISYGGRGQITDVQQPRYGQ 250

Query: 230 QLIENLSPL 238
           Q+++ L P 
Sbjct: 251 QVMDILLPF 259


>gi|146341906|ref|YP_001206954.1| flagellar basal body L-ring protein [Bradyrhizobium sp. ORS278]
 gi|146194712|emb|CAL78737.1| Flagellar L-ring protein (Basal body L-ring protein)
           [Bradyrhizobium sp. ORS278]
          Length = 259

 Score =  164 bits (416), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 140/240 (58%), Gaps = 9/240 (3%)

Query: 5   SFIVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           SF VL   S+  GC S   +S+I   P+++ + +   +    P      K    +    S
Sbjct: 23  SFAVL---SVAGGCSSIDRLSQIGERPKLTEIDNPTTQPGYKPVQMPMPKPETVSYAPNS 79

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS---GGFSLF 119
           LWR+   A FKD RA  +GD+LTV + I D+A F N+T RSR N     ++   G  +L 
Sbjct: 80  LWRNGSRAFFKDQRAHQIGDLLTVTVSISDKANFANETQRSRTNKEDSGITDFIGSKTLG 139

Query: 120 GQQTPQMNGN-LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
            Q    + G  L  DG  +S GKG+I R+E L   +AA+VT +L NGNL++ G QE+RVN
Sbjct: 140 AQAQKVLPGRILTADGTSSSDGKGTIQRSESLTTSVAAVVTQVLPNGNLVVEGKQEIRVN 199

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            EIR L V GIVRP+D+ + N++   KIA+ARISYGG+G+ T++ +P  G Q+++ L P 
Sbjct: 200 YEIRELIVAGIVRPEDIQSDNTIDSTKIAQARISYGGRGQITDVQQPRYGQQVMDILLPF 259


>gi|302383958|ref|YP_003819781.1| flagellar L-ring protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302194586|gb|ADL02158.1| flagellar L-ring protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 241

 Score =  164 bits (415), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 99/242 (40%), Positives = 134/242 (55%), Gaps = 39/242 (16%)

Query: 18  CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDST------KKSYSLWRDSHAAL 71
           C + +  + G PQ++P+G         P   +    + +T        + SLWR    A 
Sbjct: 18  CSTVVETVQG-PQLAPIG--------YPAQLVPVTQAYTTVPEPRSASANSLWRTGARAF 68

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN--------------SLHRKLSGGFS 117
           F D RA  +GDILTV+I IDDQA   N T RSR+N              SL R   GGF 
Sbjct: 69  FGDQRARQIGDILTVNIDIDDQAQTSNTTSRSRSNDITGGISNFFGLENSLGRAFPGGFD 128

Query: 118 LFGQQTPQMNGNL-NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                 PQ   NL   +G   ++G GS+SR+EK++L IAA+VT IL NGNL+I G QEVR
Sbjct: 129 ------PQ---NLVGVEGQSNANGTGSVSRSEKVSLTIAAVVTDILSNGNLVIQGRQEVR 179

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
            N E+R L V GIVRP+D+ + N++++ +IAEARISYGG+G  + +   P    L+E  S
Sbjct: 180 TNREVRELTVAGIVRPEDISSANTIAHTQIAEARISYGGRGDISRVQSTPAAQSLVERFS 239

Query: 237 PL 238
           P 
Sbjct: 240 PF 241


>gi|167645394|ref|YP_001683057.1| flagellar basal body L-ring protein [Caulobacter sp. K31]
 gi|167347824|gb|ABZ70559.1| flagellar L-ring protein [Caulobacter sp. K31]
          Length = 238

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 90/233 (38%), Positives = 132/233 (56%), Gaps = 26/233 (11%)

Query: 20  SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALN 79
           S+++E    P+++P+G       ++  +   +        S SLWR    A F D RA  
Sbjct: 18  STVAEAVKGPELAPVGYPA----QLAPMTQQYAPQPQAASSNSLWRTGARAFFNDQRASK 73

Query: 80  VGDILTVDIRIDDQAVFDNQTGRSR--------------NNSLHRKLSGGFSLFGQQTPQ 125
           VGDILTV+I IDD A   NQT  SR               +SL + L GGF         
Sbjct: 74  VGDILTVNIDIDDSATTKNQTQTSRASNSSLGVPNFLGLESSLGKVLPGGFDPANM---- 129

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
               +N   G +++G G+++R+EK++L IAA+V+ +L NGNL+I G+QEVR N E+R L 
Sbjct: 130 ----INTKSGTSNAGAGAVNRSEKISLTIAAVVSGVLPNGNLVIQGTQEVRTNAEVRQLT 185

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           V GIVRP+D+ + N++ + +IAEARISYGG+G  + + + P G  L+E  SP 
Sbjct: 186 VAGIVRPEDISSANTIKHTQIAEARISYGGRGDISRVQKVPGGQALVEKFSPF 238


>gi|329849716|ref|ZP_08264562.1| flagellar L-ring family protein [Asticcacaulis biprosthecum C19]
 gi|328841627|gb|EGF91197.1| flagellar L-ring family protein [Asticcacaulis biprosthecum C19]
          Length = 239

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 93/247 (37%), Positives = 133/247 (53%), Gaps = 17/247 (6%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNS---DST 57
           M   +   L +S++  G   ++SE    PQ++ M          P   I  + +    + 
Sbjct: 1   MKTIALTALAFSAVTLGACGTVSETVKGPQLTAMA--------YPVAVIPAQQAVIQPAP 52

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
             S SLWR      F D RA NVGDILT+ + IDD A   N T RSR NS        F 
Sbjct: 53  ASSNSLWRAGARTFFNDQRARNVGDILTIQVDIDDSAQTQNSTDRSRTNSYEASTPSIFG 112

Query: 118 L---FGQQTP-QMNGN--LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
           L    G+  P + N    L  DG    SG GS+ R+EK+++ +AA VT ++ NGNL+I G
Sbjct: 113 LESSLGKLLPSEYNPTRALGADGSSTFSGNGSVQRSEKISVTLAATVTGVMRNGNLVIQG 172

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            QEVR   E+R L+V GIVRP+D+ + N++ + ++AEARISYGGKG  T + + P+   +
Sbjct: 173 HQEVRTGREMRVLSVAGIVRPEDISSTNTIRHTQLAEARISYGGKGDITNMQQAPVTQNI 232

Query: 232 IENLSPL 238
           ++  SP 
Sbjct: 233 MDKFSPF 239


>gi|323136550|ref|ZP_08071631.1| flagellar L-ring protein [Methylocystis sp. ATCC 49242]
 gi|322397867|gb|EFY00388.1| flagellar L-ring protein [Methylocystis sp. ATCC 49242]
          Length = 242

 Score =  162 bits (409), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 138/231 (59%), Gaps = 13/231 (5%)

Query: 17  GCHSSISEITGIPQMSPMGSSLD-ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDS 75
           GC +   + T  P M+P+GS L+  ++++P   +     ++         ++   LF D 
Sbjct: 16  GCATDPRDFTREPHMTPVGSGLNFHDDQIPVGAL----QNAVLGPGMRIDENRVNLFHDI 71

Query: 76  RALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF-------GQQTPQMNG 128
           RA+NVGD++TV I ++D+A+  N T RSR   +  K +    L          QT Q   
Sbjct: 72  RAMNVGDVVTVVIEMNDRAILGNSTDRSREAKIKSKWTFLLDLVPMLGGPTNSQTKQTGA 131

Query: 129 NLN-YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
             N  D    + G+G+I+R+E++   +AA+VTA+L NGNL++ GSQE+RVN E+R L++ 
Sbjct: 132 WQNDIDSSTETQGQGTINRSEQIRFTLAAVVTAVLPNGNLVLHGSQEIRVNQELRVLSIG 191

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           G+ RP+D++  NS++YDKIAEAR+SYGG+GR TE+ +P  G QL +   P 
Sbjct: 192 GVARPRDINKDNSINYDKIAEARVSYGGRGRLTEVQQPAWGQQLYDTFVPF 242


>gi|254419064|ref|ZP_05032788.1| flagellar L-ring protein FlgH [Brevundimonas sp. BAL3]
 gi|196185241|gb|EDX80217.1| flagellar L-ring protein FlgH [Brevundimonas sp. BAL3]
          Length = 246

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 135/232 (58%), Gaps = 9/232 (3%)

Query: 15  LFGCHSSISEITGIPQMSPMG--SSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALF 72
           L  C ++I  + G P+++P+G  ++L    +        +   +   + SLWR      F
Sbjct: 16  LGACSTAIEAVRG-PELAPIGYPAALVPAQQAYMADPSLRQEATPASANSLWRVGARTFF 74

Query: 73  KDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL---FGQQTP---QM 126
            D RA ++GDILTV I IDD+A   N T R+R+N+    +S  F L    G+  P     
Sbjct: 75  GDQRARHIGDILTVRIDIDDRAQTQNSTQRARSNTSANGVSNFFGLESSLGRVFPGGFDP 134

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
              +  +G   ++G GS++R+EK++L +AA+VT +L NGNL+I G QEVR N E+R L V
Sbjct: 135 ANMVGLEGKTNAAGSGSVNRSEKVSLTVAAVVTDVLANGNLVIQGRQEVRTNREVRELTV 194

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            GIVRP+D+ + NS+++ +IAEARISYGG+G  + +   P    L+E  SP 
Sbjct: 195 AGIVRPEDISSANSINHTQIAEARISYGGRGDISRMQATPAAQSLVERFSPF 246


>gi|254502121|ref|ZP_05114272.1| flagellar L-ring protein FlgH [Labrenzia alexandrii DFL-11]
 gi|222438192|gb|EEE44871.1| flagellar L-ring protein FlgH [Labrenzia alexandrii DFL-11]
          Length = 231

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 143/234 (61%), Gaps = 4/234 (1%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
            +V   + LL GC   + +I   P+M+P+G  L  N       +   +    K   SLWR
Sbjct: 1   MLVSLGAVLLSGCAGQLEDIGRAPEMTPVGYGL-ANRPATVYPLGTFSKGGIKDYNSLWR 59

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-FGQQTP 124
           +     F D RA  +GD+LTV I+IDD+A  DN + R R+  +   + G +S      T 
Sbjct: 60  NDRENFFADPRAKKIGDVLTVVIQIDDRAELDNTSERGRSADIG--IGGSYSAGSNNSTS 117

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
                LN + G +S+G GSI R+E++ L +AAIV   L NGN++ISGSQEVRVN E+R L
Sbjct: 118 GGEAELNGNSGSSSAGSGSIDRSEEIELSVAAIVIDRLPNGNMVISGSQEVRVNYEMRIL 177

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           NV GIVRP+D++++N++ YDKIAEARISYGG+GR +E+ +P  G Q+ + ++P 
Sbjct: 178 NVGGIVRPRDIESNNTIPYDKIAEARISYGGRGRISEVQQPGWGQQIYDIVTPF 231


>gi|118589977|ref|ZP_01547381.1| flagellar L-ring protein precursor H [Stappia aggregata IAM 12614]
 gi|118437474|gb|EAV44111.1| flagellar L-ring protein precursor H [Stappia aggregata IAM 12614]
          Length = 230

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 140/228 (61%), Gaps = 4/228 (1%)

Query: 12  SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY-SLWRDSHAA 70
           +++L GC   + ++   P+M+P+G  L       +    F     T K Y SLW      
Sbjct: 6   AAMLTGCAGQLEDVGRAPEMTPVGYGLAVQQPAAYPLSTF--GQGTVKDYNSLWASGRDN 63

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
            F D RA  VGD+LTV I+I+D+A  DN++ R R + +    +  +   G      +GNL
Sbjct: 64  FFADPRAKKVGDVLTVTIQINDRANMDNKSDRRRTSDIGWGGTMDYDWDGIGHGG-SGNL 122

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
             D G  S+G GSI R+E++ L +AA+VT  L NGNL+ISGSQE+RVN E+R L + GIV
Sbjct: 123 GVDSGSGSAGSGSIDRSEEIQLSVAAVVTDRLPNGNLVISGSQEMRVNFEMRILQIAGIV 182

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           RP+D+ A+N++ YDKIAEAR+SYGG+GR TE+ +P  G Q+ + ++P 
Sbjct: 183 RPRDIQANNTIPYDKIAEARVSYGGRGRITEVQQPAWGQQIYDIVTPF 230


>gi|90423015|ref|YP_531385.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           BisB18]
 gi|90105029|gb|ABD87066.1| flagellar L-ring protein [Rhodopseudomonas palustris BisB18]
          Length = 252

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 92/238 (38%), Positives = 137/238 (57%), Gaps = 6/238 (2%)

Query: 7   IVLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           ++L +  L  GC S   +S+I   P+++ + +   +    P      K   ++  + SLW
Sbjct: 15  LLLAFGGLAGGCSSIDRLSQIGEKPKLAAIENPTAQPGYKPVQMPMPKPEAASYNANSLW 74

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS--GGFSLFGQQ 122
           R+   A F+D RA  VGDILTV +   D+A   N+T RSR N     ++   G  L G  
Sbjct: 75  RNGSRAFFRDQRAHQVGDILTVTVNFTDKANIANETQRSRTNKEDSGITDFAGSKLIGGA 134

Query: 123 TPQ-MNGN-LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
             Q M G  L  D   +S GKGS+ R E L   +AA+VT +L NGNL++ G QE+RVN E
Sbjct: 135 ASQVMPGRILTADATSSSDGKGSVQRQEALQTSVAAVVTQLLPNGNLVVEGKQEIRVNFE 194

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           IR L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ +++ +P  G Q+++ L P 
Sbjct: 195 IRELIVAGIVRPEDIQSDNTIDSAKIAQARIAYGGRGQISDVQQPRYGQQVMDVLLPF 252


>gi|209884524|ref|YP_002288381.1| flagellar L-ring protein FlgH [Oligotropha carboxidovorans OM5]
 gi|226701926|sp|B6JBH5|FLGH_OLICO RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|209872720|gb|ACI92516.1| flagellar L-ring protein FlgH [Oligotropha carboxidovorans OM5]
          Length = 249

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 140/242 (57%), Gaps = 9/242 (3%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY- 61
           R +  ++    L  GC SSI  ++ I +   + +  +   +  +  +          SY 
Sbjct: 11  RTAAALVAVGCLASGC-SSIERLSQIGEQPKLTAIDNPTTKAGYKPVSMPMPTPQPASYN 69

Query: 62  --SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
             SLWR+   A FKD RA  VGDILTV + I D+A   N+T RSR N+    ++  F + 
Sbjct: 70  PNSLWRNGSRAFFKDQRAHQVGDILTVIVNITDKANIANETQRSRANTEDSSITNFFGI- 128

Query: 120 GQQTPQMNG--NLNYDGGGASS-GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            ++ P  NG  N+   G  ASS GKGS+ R E L   +AA+VT +L NGNL++ G QE+R
Sbjct: 129 -KKVPGTNGAGNMLTTGSVASSDGKGSVVRQEALQTNVAAVVTQLLPNGNLVVEGKQEIR 187

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN E+R L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +P  G Q+++ L 
Sbjct: 188 VNFEMRELVVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQVMDILL 247

Query: 237 PL 238
           P 
Sbjct: 248 PF 249


>gi|296445181|ref|ZP_06887141.1| flagellar L-ring protein [Methylosinus trichosporium OB3b]
 gi|296257355|gb|EFH04422.1| flagellar L-ring protein [Methylosinus trichosporium OB3b]
          Length = 240

 Score =  158 bits (400), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 91/229 (39%), Positives = 144/229 (62%), Gaps = 11/229 (4%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDE-NNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDS 75
           GC +   +I   P MSP+GS L+  ++++P   I     D     +    ++   L++D 
Sbjct: 16  GCATDPRDIGREPHMSPVGSGLNTVDDQLPTGSI----RDGALGPHMRLDENRINLYRDV 71

Query: 76  RALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF----GQQTPQMNGNLN 131
           RA++ GD++TV+I +DD+AV  N T RSR++ +  + S  F       G    + NG ++
Sbjct: 72  RAMSAGDVVTVNISMDDKAVLGNSTDRSRDSKVKSEWSFLFDFLAGGSGATEHKWNGTIS 131

Query: 132 YD--GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
            D     ++ G+GSI+R+E++ L IAA+VTA+L NGNL++ GSQE+RVN E+R L + GI
Sbjct: 132 NDLQSSSSTQGQGSINRSEQIRLSIAAVVTAVLPNGNLVLRGSQEIRVNYELRVLTIAGI 191

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            RP+D+   N++SYDKIAEAR+SYGG+GR +E+ +P  G Q+ +  +P 
Sbjct: 192 ARPRDIAKDNTISYDKIAEARVSYGGRGRLSEVQQPAWGQQVYDIFAPF 240


>gi|27381980|ref|NP_773509.1| flagellar basal body L-ring protein [Bradyrhizobium japonicum USDA
           110]
 gi|81735148|sp|Q89F32|FLGH2_BRAJA RecName: Full=Flagellar L-ring protein 2; AltName: Full=Basal body
           L-ring protein 2; Flags: Precursor
 gi|27355150|dbj|BAC52134.1| flagellar L-ring protein precursor [Bradyrhizobium japonicum USDA
           110]
          Length = 231

 Score =  158 bits (399), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 92/227 (40%), Positives = 132/227 (58%), Gaps = 15/227 (6%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           GC    ++    P++SP+GS L    R     I       T  SY    D    L++D R
Sbjct: 15  GCVGDPADALTGPRLSPVGSGL----RTQADPIPVTPRMRTPVSYRSTWDDGTDLYRDPR 70

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS-----GGFSLFGQQTPQMNGNLN 131
           A   GD++TV I + D+A  DN+TGRSR++ +   L       G++  GQ T  ++ N  
Sbjct: 71  ARRTGDVVTVIISMQDKAKLDNKTGRSRDSQIKFGLDWLMDVAGWADKGQTTANLSTNTQ 130

Query: 132 YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVR 191
                   G G I R E + L IAAIVT +L NGN++ISGSQE RVN E+R LNV GIVR
Sbjct: 131 I------KGNGQIDRTEDIKLSIAAIVTDVLPNGNMMISGSQEFRVNTEMRVLNVGGIVR 184

Query: 192 PQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           P+D+   N++SY+KIAEAR+SYGG+G  +++ +P  GH++ + ++P 
Sbjct: 185 PRDISRTNTISYEKIAEARVSYGGQGNLSDVQQPGWGHRIYDAVAPF 231


>gi|316932821|ref|YP_004107803.1| flagellar L-ring protein [Rhodopseudomonas palustris DX-1]
 gi|315600535|gb|ADU43070.1| flagellar L-ring protein [Rhodopseudomonas palustris DX-1]
          Length = 252

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 135/238 (56%), Gaps = 8/238 (3%)

Query: 8   VLCYSSLLFGCHSSISEITGI---PQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           ++    L  GC SSI  +  I   P ++P+ +   +    P      K   ++  + SLW
Sbjct: 16  LMATGGLAGGC-SSIDRLAAIGERPALTPIENPTTQPGYKPVQMPMPKPEVASYNANSLW 74

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS---GGFSLFGQ 121
           R+   A FKD RA  VGDILTV +   D+A   NQT RSR++     ++   G  ++   
Sbjct: 75  RNGSRAFFKDQRAAKVGDILTVTVNFTDKANIANQTQRSRSSKEDSGVTDFIGSKTITNT 134

Query: 122 QTPQMNGN-LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            T  + G  L  D   ++ GKGS+ R E L   +AA+VT +L NGNL++ G QE+RVN E
Sbjct: 135 ATAVLPGRILTTDSTSSTDGKGSVQRQEALQTTVAAVVTQVLPNGNLVVEGKQEIRVNFE 194

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           IR L V GIVRP+D+ + N +   KIA+ARI+YGG+G+ T++ +P  G Q+++ L P 
Sbjct: 195 IRELIVAGIVRPEDIQSDNIIDSSKIAQARIAYGGRGQITDVQQPRYGQQVMDVLLPF 252


>gi|39936963|ref|NP_949239.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           CGA009]
 gi|192292791|ref|YP_001993396.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           TIE-1]
 gi|81619648|sp|Q6N2Z5|FLGH_RHOPA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701929|sp|B3QIW5|FLGH_RHOPT RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|39650820|emb|CAE29343.1| putative flagellar L-ring protein FlgH [Rhodopseudomonas palustris
           CGA009]
 gi|192286540|gb|ACF02921.1| flagellar L-ring protein [Rhodopseudomonas palustris TIE-1]
          Length = 252

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 135/238 (56%), Gaps = 8/238 (3%)

Query: 8   VLCYSSLLFGCHSSISEITGI---PQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           ++    L  GC SSI  +  I   P ++P+ +   +    P      K   ++  + SLW
Sbjct: 16  LMATGGLAGGC-SSIDRLAAIGERPALTPIENPTTQPGYKPVQMPMPKPEVASYNANSLW 74

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS---GGFSLFGQ 121
           R+   A FKD RA  VGDILTV +   D+A   N+T RSR +     ++   G  ++   
Sbjct: 75  RNGSRAFFKDQRAAKVGDILTVTVNFTDKANIANETQRSRTSKEDSGITDFIGSKTITTP 134

Query: 122 QTPQMNGN-LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            T  + G  L  D   +S GKGS+ R E L   +AA+VT +L NGNL++ G QE+RVN E
Sbjct: 135 ATAVLPGRILTTDSTSSSDGKGSVQRQEALQTNVAAVVTQVLPNGNLVVEGKQEIRVNFE 194

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           IR L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +P  G Q+++ L P 
Sbjct: 195 IRELIVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQVMDVLLPF 252


>gi|299131787|ref|ZP_07024982.1| flagellar L-ring protein [Afipia sp. 1NLS2]
 gi|298591924|gb|EFI52124.1| flagellar L-ring protein [Afipia sp. 1NLS2]
          Length = 249

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/252 (38%), Positives = 144/252 (57%), Gaps = 17/252 (6%)

Query: 1   MYRY-SFIVLCYSSLL--FGC----HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKN 53
           MYR+    +LC ++ L   GC     SS+  +  + +   + S  +   +  +  +    
Sbjct: 1   MYRHRKRHLLCTAAALAMIGCLAGGCSSLERLANVGEQPKLSSIDNPTTKAGYKPVSMPM 60

Query: 54  SDSTKKSY---SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR 110
                 SY   SLWR+   A FKD RA  VGDILT+ + I D+A   N+T RSR+ +   
Sbjct: 61  PTPQPASYNPNSLWRNGSRAFFKDQRAHQVGDILTITVNITDKANIANETQRSRSGTEDS 120

Query: 111 KLSGGFSLFG-QQTPQMN--GN-LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGN 166
            ++   S FG ++ P  N  GN L  D   ++ GKGSI+R E L   +AA+VT +L NGN
Sbjct: 121 NIT---SFFGVKKVPGTNTSGNMLTTDSTSSTDGKGSITRQEALQTNVAAVVTQLLPNGN 177

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPP 226
           L++ G QE+RVN EIR L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +  
Sbjct: 178 LVVEGKQEIRVNYEIRELVVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQITDVQQAR 237

Query: 227 IGHQLIENLSPL 238
            G Q+++ L P 
Sbjct: 238 YGQQVMDILLPF 249


>gi|329888228|ref|ZP_08266826.1| flagellar L-ring family protein [Brevundimonas diminuta ATCC 11568]
 gi|328846784|gb|EGF96346.1| flagellar L-ring family protein [Brevundimonas diminuta ATCC 11568]
          Length = 240

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 132/229 (57%), Gaps = 19/229 (8%)

Query: 20  SSISEITGIPQMSPMGSSLD----ENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDS 75
           ++I  + G P+++P+G        E   +P          ++  + SLWR    + F D 
Sbjct: 21  TAIEAVKG-PELAPIGYPAALVPVEQAYLP--------EPTSASANSLWRTGARSFFGDQ 71

Query: 76  RALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL---FGQQTP---QMNGN 129
           RA  VGDILTV I I+D+A   N T R+R NS    ++  F L    G+  P        
Sbjct: 72  RARRVGDILTVAIDINDRAQTQNTTQRNRTNSASGGVTNFFGLENSLGRAFPGGFDPANM 131

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           +  +G   ++G GS++R+E++NL +AA+VTA++ NGNL+I G QEVR N E+R L V GI
Sbjct: 132 IGTEGAVNANGSGSVNRSERVNLTVAAVVTAVMPNGNLVIQGRQEVRTNREVRELTVAGI 191

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VRP+D+D+ N++ + +IAEARISYGG+G  + +   P    L+E  SP 
Sbjct: 192 VRPEDIDSANTIRHSQIAEARISYGGRGDISRMQATPAAQSLVERFSPF 240


>gi|92116934|ref|YP_576663.1| flagellar basal body L-ring protein [Nitrobacter hamburgensis X14]
 gi|91799828|gb|ABE62203.1| flagellar L-ring protein [Nitrobacter hamburgensis X14]
          Length = 252

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 90/237 (37%), Positives = 135/237 (56%), Gaps = 6/237 (2%)

Query: 8   VLCYSSLLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           +L  + L  GC S   +S+I   P+++ + +   +    P      K   ++  + SLWR
Sbjct: 16  LLAAAGLASGCSSIDRLSQIGERPKLTAIDNPTTQPGYKPVQMPMPKPELASYNANSLWR 75

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS---GGFSLFGQQ 122
           +   A FKD RA  VGD+LTV +   D+A   N+T RSR N     ++   G   +    
Sbjct: 76  NGSRAFFKDQRAARVGDLLTVTVNFTDKANIANETQRSRTNKEDSGITDFIGSKVIKNPA 135

Query: 123 TPQMNGN-LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
           T  + G  L  D   +S GKGS+ R E L   +AA+VT +L NGNL++ G QE+RVN EI
Sbjct: 136 TAVLPGRILTADSTASSDGKGSVQRQENLQTSVAAVVTQVLPNGNLVVEGKQEIRVNLEI 195

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           R L V GIVRP+D+ + N++   KIA+ARISYGG+G+ +++ +P  G Q+++ L P 
Sbjct: 196 RELIVAGIVRPEDIQSDNTIDSSKIAQARISYGGRGQISDVQQPRYGQQVMDVLLPF 252


>gi|254292903|ref|YP_003058926.1| flagellar L-ring protein [Hirschia baltica ATCC 49814]
 gi|254041434|gb|ACT58229.1| flagellar L-ring protein [Hirschia baltica ATCC 49814]
          Length = 249

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 140/241 (58%), Gaps = 13/241 (5%)

Query: 8   VLCYSSLLFGCHSS-ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY---SL 63
               +++L  C ++ IS+    P++SP+ +    N   P   +         + Y   SL
Sbjct: 12  TFAVTAMLGACSTAGISDKMASPELSPIENPASVNGPYP---VSMPQPAPITQDYAQNSL 68

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           WR    + F D RA ++GDILTV+I I DQA  +N T RSR  +   +++  F L     
Sbjct: 69  WRTGARSFFDDQRAGDIGDILTVNIEISDQAQVNNTTSRSRTGNTSAEINAMFGLNELID 128

Query: 124 PQMNGNLNYDGGG------ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
             + G +    G       +S+G G+++RAE ++L IAA++T  L NGNL+I+GSQEV+V
Sbjct: 129 RNIPGGIGLSPGADFGSSSSSNGTGTVNRAETIDLTIAAVITQKLPNGNLVIAGSQEVKV 188

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R L V GI+RPQD+ A N++S+++IA+ARISYGG+G  + L R     + ++ ++P
Sbjct: 189 NNEVRELVVGGIIRPQDISATNTISHEQIAQARISYGGRGDLSNLQRASTAARAVDAINP 248

Query: 238 L 238
            
Sbjct: 249 F 249


>gi|209963567|ref|YP_002296482.1| flagellar L-ring protein FlgH [Rhodospirillum centenum SW]
 gi|209957033|gb|ACI97669.1| flagellar L-ring protein FlgH [Rhodospirillum centenum SW]
          Length = 245

 Score =  155 bits (391), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 136/233 (58%), Gaps = 12/233 (5%)

Query: 15  LFGCHSSISEITGIPQMSPM-GSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
           L GC      +   P MSP+    +    R+  + +   ++++ ++  SLWR       +
Sbjct: 16  LPGCAGQFDHLGRAPAMSPIEDPGMQTEARLVRMPMPVPSTEA-RQPASLWRTGSTGFLR 74

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSR--------NNSLHRKLSGGFSLFGQQTPQ 125
           D RA  VGDI+TV I + +QA   NQT RSR         N L  +   G  L     P+
Sbjct: 75  DLRAKRVGDIVTVVIDMSEQAQIRNQTQRSRASGEQMGTPNFLGLESRLGAVLPDAVDPE 134

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              NLN     +S+G GS++R E++ L +AA+VT +L NGNL+I+G QEVRVN E+R L 
Sbjct: 135 RLVNLNSSS--SSTGAGSVNRQEQIQLKVAAVVTDVLPNGNLVIAGKQEVRVNFELRELR 192

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           + G++RP+D+   N +SY+KIAEARI+YGG+G+ T++ +P IG Q+++ + P 
Sbjct: 193 IAGVIRPEDISTRNIISYEKIAEARIAYGGRGQITDVQQPRIGQQVLDVVLPF 245


>gi|91976159|ref|YP_568818.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           BisB5]
 gi|91682615|gb|ABE38917.1| flagellar L-ring protein [Rhodopseudomonas palustris BisB5]
          Length = 252

 Score =  154 bits (389), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 135/238 (56%), Gaps = 8/238 (3%)

Query: 8   VLCYSSLLFGCHSSISEITGI---PQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           +L    L  GC SSI  +  I   P +S + +   +    P      K   ++  + SLW
Sbjct: 16  LLATGGLAGGC-SSIDRLASIGERPALSAIENPTTQPGYKPVQMPMPKPEVASYNANSLW 74

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS---GGFSLFGQ 121
           R+   A F+D RA  VGDI+TV +   D+A   NQT RSR++S    ++   G   L G 
Sbjct: 75  RNGSRAFFRDQRAAKVGDIMTVTVNFTDKANIANQTQRSRSSSEDSGITDFAGSKLLTGN 134

Query: 122 QTPQMNGNL-NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
               + G L + D    + GKGS+ R E L   +AA+VT +L NGNL++ G QE+RVN E
Sbjct: 135 AAQVLPGRLLSTDSTSTADGKGSVQRQEALQTSVAAVVTQVLPNGNLVVEGKQEIRVNFE 194

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +R L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +P  G Q+++ L P 
Sbjct: 195 VRELIVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQVMDVLLPF 252


>gi|115523554|ref|YP_780465.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           BisA53]
 gi|115517501|gb|ABJ05485.1| flagellar L-ring protein [Rhodopseudomonas palustris BisA53]
          Length = 252

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 112/184 (60%), Gaps = 10/184 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLWR+   A FKD RA  VGDILTV +   D+A   NQT RSR N   ++ SG     G 
Sbjct: 72  SLWRNGSRAFFKDQRAHQVGDILTVTVNFTDKANIANQTQRSRTN---KEDSGVTDFIGS 128

Query: 122 QTPQMNGN-------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
           +T             L  D   +S GKGS+ R E L   +AA+VT +L NGNL++ G QE
Sbjct: 129 KTIGTPATAILPGRILTTDSTASSDGKGSVQRQEALQTSVAAVVTQLLPNGNLVVEGKQE 188

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           +RVN EIR L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +P  G Q+++ 
Sbjct: 189 IRVNFEIRELIVAGIVRPEDIQSDNTIDSAKIAQARIAYGGRGQITDVQQPRYGQQVMDV 248

Query: 235 LSPL 238
           L P 
Sbjct: 249 LLPF 252


>gi|218531218|ref|YP_002422034.1| flagellar basal body L-ring protein [Methylobacterium
           chloromethanicum CM4]
 gi|218523521|gb|ACK84106.1| flagellar L-ring protein [Methylobacterium chloromethanicum CM4]
          Length = 250

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 139/245 (56%), Gaps = 10/245 (4%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMP-FLGIDFKNSDSTKKSY 61
           R S + +  +    G  +++  ++ +   +P  S++++    P +  +     D++  SY
Sbjct: 7   RLSRLAVILALAPLGACNTVDRLSQV-GATPTLSAIEDPTAQPGYRPVRMAMPDTSPVSY 65

Query: 62  ---SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
              SLWR    A FKD RA  +GD+LT+ + + D+A  +N+T RSR N+    L   F L
Sbjct: 66  APNSLWRTGSRAFFKDQRAARIGDLLTIKVNVTDRANLNNETKRSRTNAEGFGLPNAFGL 125

Query: 119 FGQQTPQMNGN-----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                    G      +N     +S G GS+ RAE +   +AA+VT +L NGNL++ G Q
Sbjct: 126 ENSAGVAAAGIAPDKLINGTSTSSSDGAGSVQRAETVTTNVAAVVTQVLPNGNLVVEGKQ 185

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+R+N E+R L V G+VRP+D+++ N++   KIA+ARI+YGG+G+ T++ +P  G QL++
Sbjct: 186 EIRINFEVRELIVAGVVRPEDIESDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQLVD 245

Query: 234 NLSPL 238
            L P 
Sbjct: 246 ILLPF 250


>gi|163852462|ref|YP_001640505.1| flagellar basal body L-ring protein [Methylobacterium extorquens
           PA1]
 gi|240139799|ref|YP_002964276.1| Flagellar L-ring protein precursor (Basal body L-ring protein)
           [Methylobacterium extorquens AM1]
 gi|254562214|ref|YP_003069309.1| flagellar L-ring protein [Methylobacterium extorquens DM4]
 gi|163664067|gb|ABY31434.1| flagellar L-ring protein [Methylobacterium extorquens PA1]
 gi|240009773|gb|ACS40999.1| Flagellar L-ring protein precursor (Basal body L-ring protein)
           [Methylobacterium extorquens AM1]
 gi|254269492|emb|CAX25458.1| Flagellar L-ring protein precursor (Basal body L-ring protein)
           [Methylobacterium extorquens DM4]
          Length = 250

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 139/245 (56%), Gaps = 10/245 (4%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMP-FLGIDFKNSDSTKKSY 61
           R S + +  +    G  +++  ++ +   +P  S++++    P +  +     D++  SY
Sbjct: 7   RLSRLAVILALAPLGACNTVDRLSQV-GATPTLSAIEDPTAQPGYRPVRMAMPDTSPVSY 65

Query: 62  ---SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
              SLWR    A FKD RA  +GD+LT+ + + D+A  +N+T RSR N+    L   F L
Sbjct: 66  APNSLWRTGSRAFFKDQRAARIGDLLTIKVNVTDRANLNNETKRSRTNAEGFGLPNAFGL 125

Query: 119 FGQQTPQMNGN-----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                    G      +N     +S G GS+ RAE +   +AA+VT +L NGNL++ G Q
Sbjct: 126 ENSAGVAAAGIAPDKLINGTSTSSSDGAGSVQRAETVTTNVAAVVTQVLPNGNLVVEGKQ 185

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+R+N E+R L V G+VRP+D+++ N++   KIA+ARI+YGG+G+ T++ +P  G QL++
Sbjct: 186 EIRINFEVRELIVAGVVRPEDIESDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQLVD 245

Query: 234 NLSPL 238
            L P 
Sbjct: 246 ILLPF 250


>gi|188582484|ref|YP_001925929.1| flagellar basal body L-ring protein [Methylobacterium populi BJ001]
 gi|179345982|gb|ACB81394.1| flagellar L-ring protein [Methylobacterium populi BJ001]
          Length = 250

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/245 (34%), Positives = 137/245 (55%), Gaps = 10/245 (4%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMP-FLGIDFKNSDSTKKSY 61
           R S + +  +    G  +++  ++ +   +P  S++++    P +  +     D    SY
Sbjct: 7   RLSRLAVILALAPLGACNTVDRLSQV-GATPTLSAIEDPTAQPGYRPVRMAMPDVAPVSY 65

Query: 62  ---SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
              SLWR    A FKD RA  +GD+LTV + + D+A  +N+T RSR N+    L   F L
Sbjct: 66  APNSLWRTGSRAFFKDQRAARIGDLLTVKVNVTDRANLNNETKRSRTNAEGFGLPNAFGL 125

Query: 119 FGQQTPQMNGN-----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                    G      +N     +S G GS+ RAE +   +AA+VT +L NGNL++ G Q
Sbjct: 126 ENSAGVAAAGISPDKLINGTSTSSSDGAGSVQRAETVTTSVAAVVTQVLPNGNLVVEGKQ 185

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+R+N E+R L V G+VRP+D+++ N++   KIA+ARI+YGG+G+ T++ +P  G QL++
Sbjct: 186 EIRINFEVRELIVAGVVRPEDIESDNTIDSTKIAQARIAYGGRGQITDVQQPRYGQQLVD 245

Query: 234 NLSPL 238
            L P 
Sbjct: 246 ILLPF 250


>gi|46203669|ref|ZP_00209069.1| COG2063: Flagellar basal body L-ring protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 247

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 128/216 (59%), Gaps = 9/216 (4%)

Query: 32  SPMGSSLDENNRMP-FLGIDFKNSDSTKKSY---SLWRDSHAALFKDSRALNVGDILTVD 87
           +P  S++++    P +  +     D    SY   SLWR    A FKD RA  +GD+LTV 
Sbjct: 32  TPTLSAIEDPTAQPGYRPVRMAMPDIQPVSYAPNSLWRTGSRAFFKDQRAARIGDLLTVK 91

Query: 88  IRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL---FGQQTPQMNGN--LNYDGGGASSGKG 142
           + + D+A  +N+T RSR N+    L   F L    G     ++ +  LN     +S G G
Sbjct: 92  VNVTDKANLNNETKRSRTNAEGFGLPNAFGLEKNAGVAAAGISADKLLNGTSTSSSDGAG 151

Query: 143 SISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVS 202
           S+ RAE +   +AA+VT +L NGNL++ G QE+R+N E+R L V G+VRP+D+++ N++ 
Sbjct: 152 SVQRAETVTTNVAAVVTQVLPNGNLVVEGKQEIRINFEVRELIVAGVVRPEDIESDNTID 211

Query: 203 YDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
             KIA+ARI+YGG+G+ T++ +P  G QL++ L P 
Sbjct: 212 STKIAQARIAYGGRGQITDVQQPRYGQQLVDILLPF 247


>gi|85715050|ref|ZP_01046035.1| flagellar L-ring protein precursor [Nitrobacter sp. Nb-311A]
 gi|85698247|gb|EAQ36119.1| flagellar L-ring protein precursor [Nitrobacter sp. Nb-311A]
          Length = 252

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 91/230 (39%), Positives = 134/230 (58%), Gaps = 10/230 (4%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMP-FLGIDFKNSDSTKKSY---SLWRDSHAALF 72
           GC SSI+ ++ I + SP  +++D     P +  +          SY   SLWR+   A F
Sbjct: 25  GC-SSINRLSQIGE-SPKLTAIDNPTTQPGYKPVQMPMPKPETVSYNANSLWRNGSRAFF 82

Query: 73  KDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS---GGFSLFGQQTPQMNGN 129
           +D RA  VGD+LTV +   D+A   NQT RSR N     ++   G  ++    T  + G 
Sbjct: 83  RDQRAARVGDLLTVIVNFTDKANIANQTQRSRINKEDSGITDFIGSKTISNPATAVLPGR 142

Query: 130 -LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
            L  D    S GKGS+ R E L   +AA+VT +L NGNL++ G QE+RVN+EIR L V G
Sbjct: 143 ILTTDSTSLSDGKGSVQRQENLQTRVAAVVTQLLPNGNLVVEGKQEIRVNNEIRELIVAG 202

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           IVRP+D+ + N++   KIA+ARI+YGG+G+ +++ +P  G Q+++ L P 
Sbjct: 203 IVRPEDIQSDNTIDSSKIAQARIAYGGRGQISDVQQPRYGQQVMDVLLPF 252


>gi|89056682|ref|YP_512133.1| flagellar basal body L-ring protein [Jannaschia sp. CCS1]
 gi|123400875|sp|Q28JK4|FLGH_JANSC RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|88866231|gb|ABD57108.1| flagellar L-ring protein FlgH [Jannaschia sp. CCS1]
          Length = 244

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 132/241 (54%), Gaps = 10/241 (4%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQM-SPM-GSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
           FI L +++        ++ +   P + SP  G+ +   N +P    D ++  S  +  SL
Sbjct: 6   FIFLIFAAASVSACGRLASVGQTPNLTSPADGNEVFAMNVVPIP--DARDVPSRTEGASL 63

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL----- 118
           W    A+L  D RA   GDILTV I IDD A F N + R R+ S    +S  F L     
Sbjct: 64  WTSGRASLLGDRRASLRGDILTVVIEIDDSAEFSNSSERERSGSEQMGISNLFGLPQRVD 123

Query: 119 -FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
               Q   +   +  D    SSG+G+I R E+L L +AA +T +L+NG L I GSQEVRV
Sbjct: 124 GLLTQGGSLGEAVELDSASRSSGEGAIRRNEQLTLRVAATITEVLQNGVLRIEGSQEVRV 183

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R L VTG VRP+D+   N++ YD+IA ARISYGG+G  T+  RP  G ++ + + P
Sbjct: 184 NNEVRELLVTGYVRPEDISRQNAIEYDRIAAARISYGGRGLITDAQRPRYGQEIADTVLP 243

Query: 238 L 238
            
Sbjct: 244 F 244


>gi|126734109|ref|ZP_01749856.1| flagellar L-ring protein FlgH, putative [Roseobacter sp. CCS2]
 gi|126716975|gb|EBA13839.1| flagellar L-ring protein FlgH, putative [Roseobacter sp. CCS2]
          Length = 244

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 97/251 (38%), Positives = 138/251 (54%), Gaps = 20/251 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRM-PFLGIDFKNSDSTKK 59
           M +  F  +    L+ GC   +S+I   P+ SP   + +    + P +      S     
Sbjct: 1   MCKGKFFAVVLMLLVTGC--GVSDIGTPPRFSPPAQNTERAAMLNPSMPTPIAASALGPS 58

Query: 60  SY-SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           S+ SLW  +  +L  D RA+  GDI+TV I IDD+A   N + RSR+ S   + +G   L
Sbjct: 59  SHASLWTGARGSLLGDRRAMQRGDIMTVVIEIDDRAEISNSSDRSRSAS---QQAGVPQL 115

Query: 119 FGQQTPQ-MNGNLNYDGGGAS----------SGKGSISRAEKLNLLIAAIVTAILENGNL 167
           FG   PQ +N  L      A+          SG GS+ R E+L L +A  +T +L NG L
Sbjct: 116 FG--IPQRINRALPEGASSAAIVDLNSQSSASGDGSVRRNERLTLRVAVTITDVLPNGVL 173

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            I G QEVRVN E+R L VTG VRP+D+   N ++YDKIA ARISYGG+G+ T + +P +
Sbjct: 174 AIVGQQEVRVNFELRELIVTGYVRPEDITRQNEITYDKIASARISYGGRGQITNMQQPRL 233

Query: 228 GHQLIENLSPL 238
           GHQ++E++ P 
Sbjct: 234 GHQVLESVLPF 244


>gi|83858808|ref|ZP_00952330.1| flagellar L-ring protein precursor [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853631|gb|EAP91483.1| flagellar L-ring protein precursor [Oceanicaulis alexandrii
           HTCC2633]
          Length = 266

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 84/188 (44%), Positives = 117/188 (62%), Gaps = 15/188 (7%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SLWR +++   F D RA +VGDILTV+I I D A   NQT RSR  S    L+   S FG
Sbjct: 83  SLWRAANSTTFFGDPRAAHVGDILTVNIDISDSAQVSNQTTRSRTTSEDSNLT---SFFG 139

Query: 121 QQTPQMNGNLN----------YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
            +   ++   N          +    ++ G G+I+R+E + L  AAIV  +L NGNL+I 
Sbjct: 140 GEA-ALDQFFNDAVDPASLASFGSASSTQGAGNINRSESITLTAAAIVVDVLWNGNLVIH 198

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G QEVR+N+E+R L ++GIVRPQD+ A N++ + +IAEARISYGG+G  +E+ RPP+G +
Sbjct: 199 GRQEVRINNEVRELLISGIVRPQDIAADNTIDHQQIAEARISYGGRGHISEMQRPPVGQE 258

Query: 231 LIENLSPL 238
           L   L P 
Sbjct: 259 LYNLLWPF 266


>gi|149912836|ref|ZP_01901370.1| flagellar L-ring protein precursor [Roseobacter sp. AzwK-3b]
 gi|149813242|gb|EDM73068.1| flagellar L-ring protein precursor [Roseobacter sp. AzwK-3b]
          Length = 241

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 135/239 (56%), Gaps = 9/239 (3%)

Query: 8   VLCYSSL-LFGCHSSISEITGIPQMSPMGSSLDENNRM-PFLGIDFKNSDSTKKSYSLWR 65
            LC+S + L G  +    +   P  +P  ++++    M P L +  +      ++ SLWR
Sbjct: 4   CLCFSLIFLLGACARADHLGRAPTFTPTKNAVEHTAMMDPGLPLVAEPQRLVDQA-SLWR 62

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL---FGQQ 122
               +L  D RAL  GDILTV I ID++A   N T RSR+ S    +   F L     ++
Sbjct: 63  AGRTSLLGDRRALQKGDILTVRIEIDEEAEISNSTSRSRSGSDSLGIPQLFGLPQRLNEK 122

Query: 123 TPQ---MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
            P+   M   ++ +    S G GS+SR E+L L +AA V  +L NG L I GSQEVRVN 
Sbjct: 123 LPEGASMADAVSLNSNSRSDGDGSVSRREELTLRLAATVMEVLPNGVLAIKGSQEVRVNF 182

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           E+R L VTG VRP+D+   N ++YDKIA ARISYGG+G+ +++ +P  G Q+++ + P 
Sbjct: 183 ELRELLVTGYVRPEDISRQNEITYDKIAAARISYGGRGQISDMQQPRYGQQVLDMILPF 241


>gi|86750898|ref|YP_487394.1| flagellar basal body L-ring protein [Rhodopseudomonas palustris
           HaA2]
 gi|86573926|gb|ABD08483.1| Flagellar L-ring protein [Rhodopseudomonas palustris HaA2]
          Length = 252

 Score =  152 bits (383), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 135/238 (56%), Gaps = 8/238 (3%)

Query: 8   VLCYSSLLFGCHSSISEITGI---PQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           +L    L  GC SSI  +  I   P +S + +   +    P      K   ++  + SLW
Sbjct: 16  LLATGGLAGGC-SSIDRLAAIGEKPALSAIENPTTQPGYKPVQMPMPKPEVASYNANSLW 74

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS---GGFSLFGQ 121
           R+   A F+D RA  VGDI+TV +   D+A   N+T RSR+ S    ++   G   L G 
Sbjct: 75  RNGSRAFFRDQRAAKVGDIMTVTVNFTDKAAIANETKRSRSGSEDSGITDFAGSKLLTGD 134

Query: 122 QTPQMNGN-LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
               + G  L  D   +S GKG++ R EKL   +AA+VT +L NGNL++ G QE+RVN E
Sbjct: 135 AAQVLPGRILTTDSSSSSGGKGTVDRQEKLQTSVAAVVTQVLPNGNLVVEGKQEIRVNFE 194

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +R L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +P  G Q+++ L P 
Sbjct: 195 VRELIVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQVMDVLLPF 252


>gi|296531726|ref|ZP_06894554.1| flagellar L-ring protein FlgH [Roseomonas cervicalis ATCC 49957]
 gi|296267942|gb|EFH13741.1| flagellar L-ring protein FlgH [Roseomonas cervicalis ATCC 49957]
          Length = 272

 Score =  152 bits (383), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 112/180 (62%), Gaps = 4/180 (2%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLWR    + F+D RA  VGD+LTV+I IDD A FDN+T   R +    KL   F L G 
Sbjct: 92  SLWRPGARSFFRDQRARMVGDLLTVEIEIDDSAQFDNRTDLERESEQTFKLPFLFGLQGV 151

Query: 122 QTPQMNGNLN----YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                 G L+      G   + G G I R EK+ L +AA V  +L +GNL I+GSQEVRV
Sbjct: 152 LGRAFGGALDPAVELGGDSTAKGNGRIRRTEKIRLQLAATVVRVLPSGNLEIAGSQEVRV 211

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R L + G++RP+D+  +N ++ +KIAEARI+YGG+G  ++L RP  G Q++E + P
Sbjct: 212 NNELRELQLRGLIRPEDIRPNNRIASEKIAEARITYGGRGVASDLQRPRWGQQIMERVLP 271


>gi|296283230|ref|ZP_06861228.1| flagellar L-ring protein FlgH [Citromicrobium bathyomarinum JL354]
          Length = 253

 Score =  151 bits (382), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 99/251 (39%), Positives = 140/251 (55%), Gaps = 24/251 (9%)

Query: 8   VLCYSSLLFGCHS--SISEITGIPQMSPMGS-----------SLDE---NNRMPFLGIDF 51
           +   +SLL GC +   +  +   P MSP+ +           S D       +P      
Sbjct: 7   IAVTASLLSGCGTIDRLKNVGKAPSMSPVEAYTTPAYEPSIASTDPVRMRGTVPTAPAPQ 66

Query: 52  KNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK 111
             + +   + SL+R     LF+D RA  VGDILTV+I I D+A F N T RSR+ S    
Sbjct: 67  APAQAQAPNASLFRAGAGELFQDQRASRVGDILTVEINIADKAEFGNSTSRSRSGSESMG 126

Query: 112 LSGGFSLFGQQTPQMNGN----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           +    +L G Q   + GN    ++     AS G+GS +R+E +N+ +AAIVT +L NGNL
Sbjct: 127 IG---ALLGLQD-LLPGNPAQAVDATSNSASGGQGSTTRSETINMTMAAIVTDVLPNGNL 182

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
           +I G QE+RVN E+R L VTGIVRPQD+   N++ + KIAEARISYGG+G+ T++ +   
Sbjct: 183 VIRGRQEMRVNFELRELIVTGIVRPQDIAKGNTIQHGKIAEARISYGGRGQLTDVQQARW 242

Query: 228 GHQLIENLSPL 238
           G Q+ E L P 
Sbjct: 243 GQQIYEALFPF 253


>gi|170747258|ref|YP_001753518.1| flagellar basal body L-ring protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653780|gb|ACB22835.1| flagellar L-ring protein [Methylobacterium radiotolerans JCM 2831]
          Length = 249

 Score =  151 bits (381), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 87/230 (37%), Positives = 127/230 (55%), Gaps = 29/230 (12%)

Query: 20  SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY---SLWRDSHAALFKDSR 76
           S+I + T  P   P+        RMP         D    SY   SLWR    A FKD R
Sbjct: 38  SAIEDPTAQPGYKPV--------RMPM-------PDVQPVSYAPNSLWRTGSRAFFKDQR 82

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL--------FGQQTPQMNG 128
           A  +GDILTV +++ DQA   N+T RSR N+    L     L        FG  +  +  
Sbjct: 83  AAKLGDILTVKVKVTDQANISNETKRSRANTESFGLPNALGLENNTVGKSFGVGSTAL-- 140

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
            L+     A+ G GS+ R E +   +AA+VT +L NGNL++ G QE+RVN E+R + V G
Sbjct: 141 -LSATSATANDGAGSVQRTESVTTNVAAVVTQVLPNGNLVVEGKQEIRVNFEVREMIVAG 199

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +VRP+D+++ N++   KIA+ARI+YGG+G+ T++ +P  G Q+++ L P 
Sbjct: 200 VVRPEDIESDNTIDSAKIAQARIAYGGRGQITDVQQPRYGQQIVDILLPF 249


>gi|220924576|ref|YP_002499878.1| flagellar basal body L-ring protein [Methylobacterium nodulans ORS
           2060]
 gi|219949183|gb|ACL59575.1| flagellar L-ring protein [Methylobacterium nodulans ORS 2060]
          Length = 246

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 76/182 (41%), Positives = 115/182 (63%), Gaps = 6/182 (3%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLWR    A FKD RA  VGD++TV + + D+A  +N+T RSR+NS    +   F L   
Sbjct: 66  SLWRTGSRAFFKDQRAAKVGDLVTVKVNVTDKANLNNETKRSRSNSESFGIPNAFGL-ET 124

Query: 122 QTPQMNGN-----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           +T  + G      L  D   ++ G GSI RAE +   +AAIVT +L NGNL++ G QE+R
Sbjct: 125 KTKLLGGADPDKLLTADSTTSNDGAGSIQRAETVTTNVAAIVTQVLPNGNLVVEGKQEIR 184

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N E+R L V G++RP+D+++ N++   KIA+ARI+YGG+G+ T++ +P  G Q ++ + 
Sbjct: 185 INFEVRELIVAGVIRPEDIESDNTIDSAKIAQARIAYGGRGQITDVQQPRYGQQFLDIML 244

Query: 237 PL 238
           P 
Sbjct: 245 PF 246


>gi|295688782|ref|YP_003592475.1| flagellar L-ring protein [Caulobacter segnis ATCC 21756]
 gi|295430685|gb|ADG09857.1| flagellar L-ring protein [Caulobacter segnis ATCC 21756]
          Length = 244

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 111/191 (58%), Gaps = 22/191 (11%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR--------------NNS 107
           SLWR    A F D RA  VGDILTV I IDD A   NQT  SR               +S
Sbjct: 62  SLWRVGARAFFNDQRASRVGDILTVMIDIDDSADTKNQTDSSRASTTKAGVPHLLGLESS 121

Query: 108 LHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           L + L GGF          +  L       ++G G+I R+EK++L IAA+V+ +L NGN+
Sbjct: 122 LGKVLPGGF--------DPSNALETSSTTTNAGAGNIKRSEKISLTIAAVVSQVLPNGNM 173

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
           +I G+QEVR N E+R L V GIVRP+D+ + N++ + +IAEARISYGG+G  + + + P 
Sbjct: 174 VIQGTQEVRTNAELRQLTVAGIVRPEDISSANTIRHTQIAEARISYGGRGDISRVQKTPA 233

Query: 228 GHQLIENLSPL 238
           G  L+E  SP 
Sbjct: 234 GQSLVERFSPF 244


>gi|27380941|ref|NP_772470.1| flagellar basal body L-ring protein [Bradyrhizobium japonicum USDA
           110]
 gi|81736030|sp|Q89I09|FLGH1_BRAJA RecName: Full=Flagellar L-ring protein 1; AltName: Full=Basal body
           L-ring protein 1; Flags: Precursor
 gi|27354107|dbj|BAC51095.1| flagellar L-ring protein precursor [Bradyrhizobium japonicum USDA
           110]
          Length = 254

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 89/230 (38%), Positives = 131/230 (56%), Gaps = 11/230 (4%)

Query: 17  GCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKD 74
           GC S   +S+I   P++S + +   +    P      K   ++    SLWR    A FKD
Sbjct: 28  GCSSIDRLSQIGEQPKLSAIDNPTAQPGYKPVQMPMPKPEVASYNPNSLWRSGSRAFFKD 87

Query: 75  SRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ-----MNGN 129
            RA  +GD+LTV + I D+A   N+T RSR     ++ SG     G QT       + G 
Sbjct: 88  QRAHQIGDLLTVTVNITDKANIANETQRSRT---AKEDSGITDFIGSQTVTQPLKVLPGR 144

Query: 130 L-NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           L   D   ++ GKGS++R E L   +AA+VT +L NGNL++ G QE+RVN EIR L V G
Sbjct: 145 LLTTDSTSSADGKGSVNRQEALQTNVAAVVTQVLPNGNLVVEGKQEIRVNYEIRELVVAG 204

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           IVRP+D+ + N++   KIA+ARI+YGG+G+  ++ +P  G Q+++ L P 
Sbjct: 205 IVRPEDIQSDNTIDSSKIAQARIAYGGRGQIMDVQQPRYGQQVMDVLLPF 254


>gi|158422254|ref|YP_001523546.1| flagellar L-ring protein precursor [Azorhizobium caulinodans ORS
           571]
 gi|189044478|sp|A8IPJ4|FLGH_AZOC5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|158329143|dbj|BAF86628.1| flagellar L-ring protein precursor [Azorhizobium caulinodans ORS
           571]
          Length = 239

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 90/233 (38%), Positives = 140/233 (60%), Gaps = 20/233 (8%)

Query: 11  YSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDST-KKSYSLWRDSHA 69
           Y SL +G           P ++P+G  L E  RMP      +  + T + +Y+L   +  
Sbjct: 22  YDSLAYG-----------PTLTPVGQGL-EAGRMPVPQPFQQAKERTFRSAYNL---NSQ 66

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           ++++  RA  VGD++ + I IDD+A  DN T RSR ++     +   +L G Q+   +G 
Sbjct: 67  SMYRALRAAAVGDVIRITIDIDDKAQLDNNTNRSRKSASDVGFASALNLSGFQSGSTSGS 126

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              NL   G  ++ GKG I R+EKL L +AA+VT ++ NGNL+I+GSQE+ VN E+R L 
Sbjct: 127 ASGNLGLTGDTSTDGKGKIDRSEKLRLSLAAVVTEVMPNGNLVINGSQEILVNYEVRVLT 186

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           + GIV P DV ++N+V+YDK+AEARISY G+GR  ++ +P  G +L + ++P+
Sbjct: 187 LGGIVNPLDVTSNNTVAYDKVAEARISYAGRGRLNDVQQPAWGQRLFDAVNPM 239


>gi|75675312|ref|YP_317733.1| flagellar basal body L-ring protein [Nitrobacter winogradskyi
           Nb-255]
 gi|110816533|sp|Q3STL0|FLGH_NITWN RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|74420182|gb|ABA04381.1| flagellar L-ring protein [Nitrobacter winogradskyi Nb-255]
          Length = 252

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/239 (38%), Positives = 134/239 (56%), Gaps = 10/239 (4%)

Query: 8   VLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMP-FLGIDFKNSDSTKKSY---SL 63
           +L  + L  GC SSI  ++ I + SP  +++D     P +  +          SY   SL
Sbjct: 16  LLAAAGLASGC-SSIDRLSQIGE-SPKLTAIDNPTTQPGYKPVQMPMPKPETVSYNANSL 73

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR---NNSLHRKLSGGFSLFG 120
           WR+   A F+D RA  VGD+LTV +   D+A   NQT RSR   ++S     +G   L G
Sbjct: 74  WRNGSRAFFRDQRAARVGDLLTVTVNFTDRANIANQTQRSRVSKDDSGIADFAGSKLLGG 133

Query: 121 QQTPQMNGNL-NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                + G L   D    S GKG + R E L   +A +VT +L NGNL++ G QE+RVN 
Sbjct: 134 TAQKVLPGRLLTTDSESLSDGKGLVQRQENLQTSVATVVTQVLPNGNLVVEGKQEIRVNF 193

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           EIR L V GIVRP+D+ + N++   KIA+ARI+YGG+G+ T++ +P  G Q+++ L P 
Sbjct: 194 EIRELIVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQITDVQQPRYGQQVMDVLLPF 252


>gi|260431746|ref|ZP_05785717.1| flagellar L-ring protein FlgH [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415574|gb|EEX08833.1| flagellar L-ring protein FlgH [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 242

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 88/217 (40%), Positives = 127/217 (58%), Gaps = 8/217 (3%)

Query: 29  PQMSPMGSSLDENNRM-PFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVD 87
           P +SP   S +    + P L +  +   +  +S SLW     +L  D RA+  GDILTV 
Sbjct: 27  PSLSPNTESPEHVAMLWPGLPMHTQPQRAVDRS-SLWSGGQQSLLGDQRAMKKGDILTVV 85

Query: 88  IRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL---FGQQTPQ---MNGNLNYDGGGASSGK 141
           I +D++A   N T RSR+ S   ++ G F L        P+   ++  ++ D    S GK
Sbjct: 86  IELDEKAEISNDTSRSRSGSEDLQVPGLFGLPQRVAGHLPEGASLDEAVSIDSASVSKGK 145

Query: 142 GSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSV 201
           GS+ R EKL L +AA V  IL NG L I+GSQE+RVN E+R L V+G VRPQD+   N +
Sbjct: 146 GSVKRKEKLTLRVAATVVDILPNGVLSIAGSQELRVNFELRELLVSGYVRPQDISRQNEI 205

Query: 202 SYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +YDKIA AR+SYGG+G+ +++ +P  G Q+++ L P 
Sbjct: 206 TYDKIASARVSYGGRGQISDVQQPRYGQQVLDALLPF 242


>gi|170742323|ref|YP_001770978.1| flagellar basal body L-ring protein [Methylobacterium sp. 4-46]
 gi|168196597|gb|ACA18544.1| flagellar L-ring protein [Methylobacterium sp. 4-46]
          Length = 246

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 83/233 (35%), Positives = 131/233 (56%), Gaps = 12/233 (5%)

Query: 15  LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY---SLWRDSHAAL 71
           L  C++ +  ++ I    P+ +  D   +  +  +     +    SY   SLWR    A 
Sbjct: 17  LSACNT-VDRLSQIGARPPLSAIEDPTAQAGYKPVRLPMPEVQPVSYAPNSLWRTGSRAF 75

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF------SLFGQQTPQ 125
           FKD RA  VGD++TV + + D+A  +N+T RSR N+    +   F       L G   P+
Sbjct: 76  FKDQRAAKVGDLVTVKVNVTDKANLNNETKRSRANTEAFGVPNAFGLEKSAKLIGAADPK 135

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
               L+     ++ G GSI RAE +   +AAIVT +L NGNL++ G QE+RVN E+R L 
Sbjct: 136 --NLLDTASTMSNDGAGSIQRAETVTTNVAAIVTQVLPNGNLVVEGKQEIRVNFEVRELV 193

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           V G++RP+D+++ N++   KIAEARI+YGG+G+ T++ +P  G Q ++ + P 
Sbjct: 194 VAGVIRPEDIESDNTIDSAKIAEARIAYGGRGQITDVQQPRYGQQFLDVMLPF 246


>gi|328543154|ref|YP_004303263.1| flagellar L-ring protein FlgH [polymorphum gilvum SL003B-26A1]
 gi|326412900|gb|ADZ69963.1| Flagellar L-ring protein FlgH [Polymorphum gilvum SL003B-26A1]
          Length = 248

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 114/190 (60%), Gaps = 21/190 (11%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK---------- 111
           SLW+  + A F+D RA  +GDILTV + I D+A FDNQT R+R+ S              
Sbjct: 67  SLWKSGNRAFFEDQRAKQIGDILTVMVTISDKAQFDNQTKRARSGSDSTGAGGALGAAID 126

Query: 112 ---LSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
              L  G       T  +N + NY       G GS+ R EKL   +AA+VT +L NGNL+
Sbjct: 127 KIFLPAGMDASSLAT--LNSSSNY------QGSGSVDREEKLQTTVAAVVTQVLPNGNLV 178

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G QE+RVN E+R L V GIVRP+D+ + N+++ +KIAEARI YGG+G+ T++ +P  G
Sbjct: 179 IEGRQEIRVNFEVRELVVAGIVRPEDIASDNTIASEKIAEARIGYGGRGQITDVQQPRYG 238

Query: 229 HQLIENLSPL 238
            Q+++ L P 
Sbjct: 239 TQVLDILLPF 248


>gi|307945668|ref|ZP_07661004.1| flagellar L-ring protein FlgH [Roseibium sp. TrichSKD4]
 gi|307771541|gb|EFO30766.1| flagellar L-ring protein FlgH [Roseibium sp. TrichSKD4]
          Length = 250

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 90/251 (35%), Positives = 143/251 (56%), Gaps = 20/251 (7%)

Query: 1   MYRYSFIVLCYSSLLFGCHSS--ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           + R S  VL  +++L  C ++  +S++   P ++ +    D      +  +     +  +
Sbjct: 7   LTRLSLCVLT-ATMLTACGTADKLSQVGKAPALNAIQ---DPTTTPGYRPVQMPMPEPQQ 62

Query: 59  KSYS---LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
             YS   LWR  + A F+D RA  VGDILTV + I D+A  DN+T R R ++ +   +G 
Sbjct: 63  AHYSPNSLWRSGNRAFFEDQRANQVGDILTVLVTIADKAEIDNKTERKREDTSN---TGA 119

Query: 116 FSLFGQQTPQM--------NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
             + G Q  Q         +   + +     SG+GS+ R EKL   +AA+VT +L NGN+
Sbjct: 120 GGVLGSQIEQWVLPDAASASALASINSSTDFSGEGSVDREEKLQTTVAAVVTQVLPNGNM 179

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
           +I G QEVRVN E+R L V GIVRP+D+ ++N+++ +KIAEARI YGG+G+ T++ +P  
Sbjct: 180 VIEGRQEVRVNFEVRELIVAGIVRPEDIASNNTIASEKIAEARIGYGGRGQITDVQQPRY 239

Query: 228 GHQLIENLSPL 238
           G Q+++ L P 
Sbjct: 240 GSQVMDILLPF 250


>gi|288962680|ref|YP_003452974.1| flagellar L-ring protein precursor [Azospirillum sp. B510]
 gi|288914946|dbj|BAI76430.1| flagellar L-ring protein precursor [Azospirillum sp. B510]
          Length = 249

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 113/183 (61%), Gaps = 6/183 (3%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLWR      F+D RA +VGD+LTV I I DQA   N T R R+NS    L     L  +
Sbjct: 67  SLWRTGSRDFFRDPRAKSVGDLLTVVIDISDQAQMRNSTQRGRSNSEKEGLPNFLGLESR 126

Query: 122 QTPQMN-----GNL-NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
               +       NL N D    S+G G+I R E++ + +AA+VT +L NGN +I+G QEV
Sbjct: 127 LPAVLPDAVDPSNLVNLDSTSNSTGNGTIQRNERIAMRVAAVVTQVLPNGNFVIAGRQEV 186

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           RVN E+R + + G++RP+D+   N++ YDKIAEARI+YGG+G+ T++ +P  G Q+++ +
Sbjct: 187 RVNFELREMRIAGVIRPEDISNANTIEYDKIAEARITYGGRGQITDVQQPRYGQQVLDVI 246

Query: 236 SPL 238
            P 
Sbjct: 247 LPF 249


>gi|16126305|ref|NP_420869.1| flagellar basal body L-ring protein [Caulobacter crescentus CB15]
 gi|221235082|ref|YP_002517518.1| flagellar basal body L-ring protein [Caulobacter crescentus NA1000]
 gi|13637801|sp|P22606|FLGH_CAUCR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|13423545|gb|AAK24037.1| flagellar L-ring protein [Caulobacter crescentus CB15]
 gi|220964254|gb|ACL95610.1| flagellar L-ring protein flgH [Caulobacter crescentus NA1000]
          Length = 244

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 110/191 (57%), Gaps = 22/191 (11%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN--------------NS 107
           SLWR    A F D RA  VGDI+TV I IDD A   N T  SR               +S
Sbjct: 62  SLWRVGARAFFNDQRASRVGDIVTVMIDIDDSASTKNATNSSRTANMKAGVPHLLGMESS 121

Query: 108 LHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           L + L GGF             L  +    ++G G +SR+EK++L IAA+V+ +L NGN+
Sbjct: 122 LGKFLPGGFDPASA--------LETNSTTTNAGSGGVSRSEKISLTIAAVVSQVLPNGNM 173

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
           +I G+QEVR N E+R L V GIVRP+D+ + N++ + +IAEARISYGG+G  + + + P 
Sbjct: 174 VIQGTQEVRTNAELRQLTVAGIVRPEDISSANTIRHTQIAEARISYGGRGDISRVQKTPA 233

Query: 228 GHQLIENLSPL 238
           G  L+E  SP 
Sbjct: 234 GQSLVEKFSPF 244


>gi|118588713|ref|ZP_01546121.1| flagellar L-ring protein precursor H [Stappia aggregata IAM 12614]
 gi|118438699|gb|EAV45332.1| flagellar L-ring protein precursor H [Stappia aggregata IAM 12614]
          Length = 249

 Score =  147 bits (372), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 87/244 (35%), Positives = 137/244 (56%), Gaps = 9/244 (3%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY- 61
           R+    +  S+L  GC ++  ++  + Q   + +  D      +  +     +  +  Y 
Sbjct: 7   RHLLASIALSTLAAGCGTA-DKLANVGQQPALNAIQDPTTTPGYRPVQMPMPEPQQAHYN 65

Query: 62  --SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF--- 116
             SLW+    A FKD RA  VGDILTV + IDDQA  +N+T R R+ S    + G     
Sbjct: 66  PNSLWQSGSRAFFKDQRASQVGDILTVVVTIDDQAEIENKTERKRSESSGAGVGGALGTA 125

Query: 117 --SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
             ++F   +   +   N +   + SG GS+ R E L   +AA+VT +L NGN++I G QE
Sbjct: 126 IDTIFLPASSAASDLANVNSDSSFSGDGSVDRNETLQTTVAAVVTQVLPNGNMVIEGRQE 185

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           VRVN E+R L V GIVRP+D+ + N ++ ++IAEARI YGG+G+ T++ +P +G+Q+++ 
Sbjct: 186 VRVNFEVRELIVAGIVRPEDITSDNRIASEQIAEARIGYGGRGQITDVQQPRVGNQVLDI 245

Query: 235 LSPL 238
           L P 
Sbjct: 246 LLPF 249


>gi|144897834|emb|CAM74698.1| Flagellar L-ring protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 251

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 134/247 (54%), Gaps = 10/247 (4%)

Query: 1   MYRYSFIVLCYSSLLFGCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           + R + I L   SL   C+  S +SE+   P +S +          P +    +     +
Sbjct: 6   LLRTTVIALAVGSL-SACNALSRLSEVGSGPTVSKIEDPTQRAGYQPVVMPMPQPVAPPQ 64

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRI-DDQAVFDNQTGRSRNNSLHRKLSGGFS 117
            + SLWR    A FKD RA  +GDILTV + I ++ A F+++  RSR    +  ++G   
Sbjct: 65  NANSLWRPGSRAFFKDQRAKEIGDILTVAVAITNETASFESKLTRSREAEENAGITGLLG 124

Query: 118 LFGQQTPQMNGNLN------YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
                   +   +N        G   ++  G   R E L + +AAI+T +L NGNL+I+G
Sbjct: 125 FENSLNKILPDAVNPATLVGSTGTSTNTNSGKTERNESLTVSLAAIITQVLPNGNLVIAG 184

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            QE+RVN E+R LNV GI+RP+D+ + NSV+YDKIAEARI YGG+G  ++L +P  G QL
Sbjct: 185 KQEIRVNYEMRELNVQGIIRPEDISSANSVTYDKIAEARIYYGGRGVNSDLTQPRYGQQL 244

Query: 232 IENLSPL 238
           ++ + P 
Sbjct: 245 LDVILPF 251


>gi|310816833|ref|YP_003964797.1| flagellar L-ring protein FlgH [Ketogulonicigenium vulgare Y25]
 gi|308755568|gb|ADO43497.1| flagellar L-ring protein FlgH [Ketogulonicigenium vulgare Y25]
          Length = 240

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 130/245 (53%), Gaps = 12/245 (4%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNS-DSTKK 59
           M R S ++ C  +L   C    + + G PQ++P   SL  +  +  +  D   S      
Sbjct: 1   MLRPSLLLACAMTL-SACGGG-TPLVGQPQLTP---SLMSDEHLAMVSSDMPMSLGPLNT 55

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
             SLW  +  +L  D RA+  GDILTV I I+D+A F N +G+SR  S    +     L 
Sbjct: 56  GASLWSGTRNSLLGDRRAMQRGDILTVVISINDRAEFSNSSGQSRTASQDMSVGALLGLP 115

Query: 120 GQQTPQMNGN------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
            +    ++G       +  D     +G GS+SR E+L L +AA V   L NG L I GSQ
Sbjct: 116 ERAAEVLHGGATLNPGIQLDSSSNFNGTGSVSRNERLTLRVAATVIGTLPNGALEIIGSQ 175

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           E+RVN+EIR L VTG VR  D++  N VSYD+IA ARISYGG+G  +    P  G Q+I+
Sbjct: 176 EIRVNNEIRELTVTGFVRTADINRQNEVSYDRIASARISYGGRGPISVAQSPRYGQQIID 235

Query: 234 NLSPL 238
            ++P 
Sbjct: 236 RIAPF 240


>gi|149203123|ref|ZP_01880094.1| flagellar L-ring protein precursor H [Roseovarius sp. TM1035]
 gi|149143669|gb|EDM31705.1| flagellar L-ring protein precursor H [Roseovarius sp. TM1035]
          Length = 244

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 114/191 (59%), Gaps = 16/191 (8%)

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           +  SLW     +L  D RA   GDI+TV I ID++A   N T RSR+ S    +     L
Sbjct: 59  QQASLWSGGKQSLLGDRRAAQRGDIMTVVIEIDEEAQISNSTSRSRDGSESLAIP---DL 115

Query: 119 FGQQTPQ-MNGNL----------NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           FG   PQ +N NL            +    S G+GS+SR+E+L L +AA V  +L NG L
Sbjct: 116 FG--IPQRINRNLPEGASLDRAAGLNSTSQSGGEGSVSRSEELTLRVAATVMQVLPNGVL 173

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            I GSQEVRVN E+R L V+G VRP+D+   N ++YDKIA ARISYGG+G+ T++ +P I
Sbjct: 174 EIQGSQEVRVNFELRELLVSGFVRPEDISRQNEITYDKIAAARISYGGRGQITDVQQPRI 233

Query: 228 GHQLIENLSPL 238
           G QL++ L P 
Sbjct: 234 GQQLLDGLLPF 244


>gi|254501335|ref|ZP_05113486.1| flagellar L-ring protein FlgH [Labrenzia alexandrii DFL-11]
 gi|222437406|gb|EEE44085.1| flagellar L-ring protein FlgH [Labrenzia alexandrii DFL-11]
          Length = 249

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 127/230 (55%), Gaps = 9/230 (3%)

Query: 17  GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY---SLWRDSHAALFK 73
           GC S+   +  + Q   + +  D      +  +     D  +  Y   SLW+    A FK
Sbjct: 21  GCGSA-DRLANVGQQPALNAIQDPTTTPGYRPVQMPMPDPVQAHYNPNSLWQSGSRAFFK 79

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF-----SLFGQQTPQMNG 128
           D RA  VGDILTV + ID++A  +N T RSR  +    + G       ++F       + 
Sbjct: 80  DQRASQVGDILTVVVSIDEKAEIENDTARSRTETNGAGVGGALGTAIDTIFLPAGTSASD 139

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
             N +     +G G + R E+L   +AA+VT +L NGNL+I G QE+RVN E+R L V G
Sbjct: 140 LGNVNSSSTFAGAGEVDREEELRTTVAAVVTQVLPNGNLVIEGRQEIRVNFEVRELIVAG 199

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           IVRP+D+ ++N+++  +IAEARI YGG+G+ T++ +P  G+Q+++ L P 
Sbjct: 200 IVRPEDITSNNTIASQQIAEARIGYGGRGQITDVQQPRYGNQVLDILLPF 249


>gi|154253001|ref|YP_001413825.1| flagellar L-ring protein [Parvibaculum lavamentivorans DS-1]
 gi|154156951|gb|ABS64168.1| flagellar L-ring protein [Parvibaculum lavamentivorans DS-1]
          Length = 244

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 130/226 (57%), Gaps = 17/226 (7%)

Query: 22  ISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY---SLWRDSHAALFKDSRAL 78
           +S I   P  +P+ S        P   I     +  +  Y   SLWR    A F+D RA 
Sbjct: 27  VSNIGKAPDFAPISS--------PATTIAMPMPEPEQIVYQPNSLWRSGSRAFFRDQRAA 78

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF---SLFGQQTPQMNGNLNY--- 132
            VGDILTV I I D A  DN T RSR N+   +L   F   +  G+  P    N N    
Sbjct: 79  RVGDILTVLIGIADSAKVDNSTKRSRANAEDAELGNLFGYENYLGKVFPDGVDNDNLARL 138

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
               +S+G GS+ R EK++L +AA+VT +L NGNL+I+G Q+VRVN E+R L VTGIVRP
Sbjct: 139 GSSSSSAGAGSVDRKEKIDLTVAAVVTQVLPNGNLVIAGRQQVRVNYEVRDLEVTGIVRP 198

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +D+   N+V++ +IAEARI+YGG+G+ +++ +P  G QL + + P 
Sbjct: 199 EDISNTNTVAHTQIAEARIAYGGQGQISDVQQPRYGQQLFDIIMPF 244


>gi|197104379|ref|YP_002129756.1| flagellar L-ring protein FlgH [Phenylobacterium zucineum HLK1]
 gi|196477799|gb|ACG77327.1| flagellar L-ring protein FlgH [Phenylobacterium zucineum HLK1]
          Length = 254

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 94/250 (37%), Positives = 132/250 (52%), Gaps = 32/250 (12%)

Query: 9   LCYSSLLFGCHSSISEITGIPQMSPMGSSLD----ENNRMPFLGIDFKNSDSTKKSYSLW 64
           L   + L  C S+++E    P+++P+G        E N +P L    +       + SLW
Sbjct: 17  LLLGASLAAC-STVTEAVRGPELAPVGYPAALVPREQNVLP-LASAREPLPHPASANSLW 74

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAV----------------FDNQTGRSRNNSL 108
           R    A F D RA  VGDILTV I IDD A                 F +  G    +SL
Sbjct: 75  RAGARAFFVDQRAGRVGDILTVQIDIDDSAKTINSTTSSRSSGTTMGFPHLLGL--ESSL 132

Query: 109 HRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
            R L G F             ++     +++G G+++RAEK++L IAA+VT +L NGN+ 
Sbjct: 133 GRILPGEF--------DPANAVDVGSKTSNTGAGAVNRAEKISLTIAAVVTGVLPNGNMT 184

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G+QEVR N +IR L V GIVRP+D+ A N++ + +IAEARISYGG+G  + + + P G
Sbjct: 185 IQGTQEVRTNTDIRQLTVAGIVRPEDISASNTIRHTQIAEARISYGGRGDISRVQKTPAG 244

Query: 229 HQLIENLSPL 238
             LIE  SP 
Sbjct: 245 QSLIERFSPF 254


>gi|114570499|ref|YP_757179.1| flagellar L-ring protein [Maricaulis maris MCS10]
 gi|123026895|sp|Q0AN96|FLGH_MARMM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|114340961|gb|ABI66241.1| flagellar L-ring protein [Maricaulis maris MCS10]
          Length = 251

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 114/181 (62%), Gaps = 4/181 (2%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG--GFSLF 119
           SLW  +    F D RA  VGDI+TV+I I D A  +N T RSR+++    L+   G  L 
Sbjct: 71  SLWTANSPTFFGDPRADQVGDIVTVNIAISDSAQLNNTTNRSRSSAEDSDLTSFLGADLT 130

Query: 120 GQQTPQMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           G     ++       G  SS  G GS++R E ++L +AA+VT +L NGNL+I+G QEVRV
Sbjct: 131 GFFNDNIDPTSMTSLGSTSSLAGSGSVNRTESISLTVAALVTQVLPNGNLVIAGRQEVRV 190

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+E+R L +TGI RPQD+ + N++++ +IAEARISYGG+G  ++  RP  G +L + L P
Sbjct: 191 NNEVRELLITGIARPQDIGSDNTIAHTQIAEARISYGGRGHLSDAQRPRYGQELYDILMP 250

Query: 238 L 238
            
Sbjct: 251 F 251


>gi|58039744|ref|YP_191708.1| flagellar basal body L-ring protein [Gluconobacter oxydans 621H]
 gi|81351941|sp|Q5FRE4|FLGH_GLUOX RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|58002158|gb|AAW61052.1| Flagellar L-ring protein flgH [Gluconobacter oxydans 621H]
          Length = 248

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 84/229 (36%), Positives = 125/229 (54%), Gaps = 4/229 (1%)

Query: 14  LLFGCHS--SISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAAL 71
           +L  C+S   +SEI   P+M+ +      N+  P             ++ SLWR    A 
Sbjct: 20  VLSACNSLAQMSEIGRPPRMTSITDPTLANSYRPVTMPMPPLQAPPDEAASLWRSGSKAF 79

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN 131
           FKD RA  VGD++T+ + I D A F+N T   R       +   F + G+    + G  +
Sbjct: 80  FKDQRASQVGDLVTIIVDITDNAAFNNGTTADRTADEKFGIPNLFGIKGKVISAITGADS 139

Query: 132 YDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
                +S     G I+R E + L +A  +T +L NGN ++ G QEVRVN E+R L V+GI
Sbjct: 140 LSTASSSDSGATGKITRNETVTLRLAGTITQVLPNGNFVVMGKQEVRVNSELRELGVSGI 199

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VRPQD+ A N+V++D++AEARISYGG+G  T+L  P  G Q+++ + P 
Sbjct: 200 VRPQDITADNTVTHDRMAEARISYGGRGTLTQLQTPRYGQQVMDAILPF 248


>gi|254511221|ref|ZP_05123288.1| flagellar L-ring protein FlgH [Rhodobacteraceae bacterium KLH11]
 gi|221534932|gb|EEE37920.1| flagellar L-ring protein FlgH [Rhodobacteraceae bacterium KLH11]
          Length = 174

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 108/174 (62%), Gaps = 6/174 (3%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL---FGQQTPQ-- 125
           +  D RA+  GDILTV I +D++A   N T RSR  S    +   F L    G++ P+  
Sbjct: 1   MLGDQRAMKKGDILTVVIELDEKAEISNDTNRSRAGSESLAVPDLFGLPQRAGERLPEGA 60

Query: 126 -MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
            ++  ++ D    S GKGS+ R EKL L +AA V  +L NG L ISGSQE+RVN E+R L
Sbjct: 61  SLDEAVSIDSASVSKGKGSVKRKEKLTLRVAATVVDVLPNGVLSISGSQELRVNFELREL 120

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            V G VRPQD+   N ++YDKIA AR+SYGG+G+ T++ +P  G Q+++ L P 
Sbjct: 121 LVAGYVRPQDISRQNEITYDKIASARVSYGGRGQITDVQQPRYGQQILDTLLPF 174


>gi|254463113|ref|ZP_05076529.1| flagellar L-ring protein FlgH [Rhodobacterales bacterium HTCC2083]
 gi|206679702|gb|EDZ44189.1| flagellar L-ring protein FlgH [Rhodobacteraceae bacterium HTCC2083]
          Length = 202

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 108/183 (59%), Gaps = 6/183 (3%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK---LSGGFSL 118
           SLWR    +L  D RAL  GDI+TV I IDD+A   N T RSR+ S       L G    
Sbjct: 20  SLWRRDRMSLLGDRRALQQGDIMTVVIEIDDKAEISNTTSRSRDGSDSMNIPNLVGIPQK 79

Query: 119 FGQQTPQ---MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
             +Q P        ++ +   +S G GS+ R EKL L IAA +  +L NG L I G+QEV
Sbjct: 80  LAKQWPDGASPTNAIDLNSNSSSKGDGSVRRKEKLTLRIAATIIQVLPNGVLAIEGTQEV 139

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           RVN E+R L V G VRP+D+   N ++YDKIA ARISYGG+G+ +++ +P  G Q++E +
Sbjct: 140 RVNFELRELLVNGYVRPEDISRQNEITYDKIASARISYGGRGQISDVQQPRYGRQVLEAI 199

Query: 236 SPL 238
            P 
Sbjct: 200 LPF 202


>gi|294679029|ref|YP_003579644.1| flagellar L-ring protein FlgH [Rhodobacter capsulatus SB 1003]
 gi|294477849|gb|ADE87237.1| flagellar L-ring protein FlgH [Rhodobacter capsulatus SB 1003]
          Length = 241

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 85/186 (45%), Positives = 112/186 (60%), Gaps = 6/186 (3%)

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           +  SLW  +  +L  D RA   GDILTV I IDD+A   N +GRSR +S    +   F +
Sbjct: 56  QEASLWSGNRGSLLGDRRAATRGDILTVVIEIDDKAEISNTSGRSRKSSDKMGIPSMFGI 115

Query: 119 ---FGQQTPQMNGNLN-YDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
                 Q P+     + ++ G +SS  G GS++R EKL L +AA V   L NG L I GS
Sbjct: 116 PQRLDAQLPEGATMADAFETGSSSSYKGDGSVARKEKLTLRVAATVLDRLPNGVLRIQGS 175

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           QEVRVN E+R L VTG VRP+DV   N ++YDKIA ARISYGG+G+ T++ +P  G Q+ 
Sbjct: 176 QEVRVNFEVRELIVTGFVRPEDVSRQNEITYDKIAGARISYGGRGQITDVQQPRYGQQVS 235

Query: 233 ENLSPL 238
           + L P 
Sbjct: 236 DILLPF 241


>gi|77464902|ref|YP_354406.1| flagellar basal body L-ring protein [Rhodobacter sphaeroides 2.4.1]
 gi|126463744|ref|YP_001044858.1| flagellar basal body L-ring protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221640823|ref|YP_002527085.1| flagellar basal body L-ring protein [Rhodobacter sphaeroides KD131]
 gi|332559800|ref|ZP_08414122.1| FlgH2 [Rhodobacter sphaeroides WS8N]
 gi|77389320|gb|ABA80505.1| Flagellar L-ring protein [Rhodobacter sphaeroides 2.4.1]
 gi|126105408|gb|ABN78086.1| flagellar L-ring protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221161604|gb|ACM02584.1| Flagellar L-ring protein precursor [Rhodobacter sphaeroides KD131]
 gi|332277512|gb|EGJ22827.1| FlgH2 [Rhodobacter sphaeroides WS8N]
          Length = 239

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 94/231 (40%), Positives = 120/231 (51%), Gaps = 18/231 (7%)

Query: 20  SSISEITGIPQMSPMGSSLDENNRMPF-LGIDFKNSDSTKKSYSLWRDSHAALFKDSRAL 78
           + +SE+   P  +P   +   +      L  D  NS  T  S SLW    A+L  D RA 
Sbjct: 15  ARLSEVGKAPSFTPADDTFQYHAMYALPLPEDVANSGPTAGS-SLWAGDRASLLGDRRAS 73

Query: 79  NVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGAS 138
             GDILTV I IDD+A   N TGRSR+      L   F L     PQ       DG   +
Sbjct: 74  RRGDILTVVIEIDDRAEISNSTGRSRSGGETLGLPSFFGL-----PQRIDRHLPDGASMA 128

Query: 139 -----------SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
                      +G GS+ R EK+ L +AA V   L NG L I G QEVRVN E+R L VT
Sbjct: 129 DAVSTTSSSNYAGDGSVRRKEKMTLRVAATVVEELPNGVLRIQGQQEVRVNYELRELVVT 188

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           G VRP D+   N ++YDKIAEARISYGG+G+ T++ +P  G Q+ + + P 
Sbjct: 189 GYVRPGDISRQNEITYDKIAEARISYGGRGQITDVQQPRYGQQVADIILPF 239


>gi|260429182|ref|ZP_05783159.1| flagellar L-ring protein FlgH [Citreicella sp. SE45]
 gi|260419805|gb|EEX13058.1| flagellar L-ring protein FlgH [Citreicella sp. SE45]
          Length = 243

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 111/188 (59%), Gaps = 16/188 (8%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW     +L  D RA+  GDILTV I ID+ A   N T RSRN S    +     LFG 
Sbjct: 61  SLWSRERNSLLGDRRAMARGDILTVVIEIDESADISNSTSRSRNGSESLSIP---QLFG- 116

Query: 122 QTPQMNGNLNYDGG-----------GASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
             PQ + +   DG             +S G G +SR+EKL L +AA +  +L NG L I 
Sbjct: 117 -IPQRHEHKMPDGSSLTNPVDLSSQASSGGDGQVSRSEKLALRVAATILEVLPNGVLAIQ 175

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G QEVRVN E+R L V+G VRP+D+  +N ++YDKIA ARISYGG+G+ T++ +P IG Q
Sbjct: 176 GMQEVRVNFEMRELLVSGYVRPEDITRNNEITYDKIASARISYGGRGQITDVQQPRIGQQ 235

Query: 231 LIENLSPL 238
           +++ + P 
Sbjct: 236 VLDVILPF 243


>gi|114765242|ref|ZP_01444374.1| flagellar L-ring protein precursor [Pelagibaca bermudensis
           HTCC2601]
 gi|114542377|gb|EAU45405.1| flagellar L-ring protein precursor [Roseovarius sp. HTCC2601]
          Length = 253

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 123/221 (55%), Gaps = 19/221 (8%)

Query: 13  SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY-----SLWRDS 67
           ++L GC +   +    PQ+SP+G +  E      + +     ++ +  Y     SLW   
Sbjct: 15  TILVGCGTPAFDRD--PQLSPVGVNPSELAAARNVSVPMPPPEAVRVPYRAEGASLWEQG 72

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM- 126
            +  F D RA  VGDILT+ I IDD+A   N++ R+R  S        F  +G Q  ++ 
Sbjct: 73  SSGFFGDQRATQVGDILTIIIEIDDEASLSNESDRNRTGSSTLAFPKFFG-YGTQIDKIL 131

Query: 127 ---------NGNL-NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                     GNL +      ++G GSI R E ++L +AA+V   L NGNL++ G QEV+
Sbjct: 132 PGVGPEDLPEGNLVDITSTTGAAGDGSIERNEAISLRMAALVVQQLPNGNLVVLGRQEVK 191

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           VN+E+R L V+GI+RPQD++  NS+ YDK+AEARI YGG+G
Sbjct: 192 VNEELRELRVSGIIRPQDINRDNSIPYDKMAEARIGYGGRG 232


>gi|126738576|ref|ZP_01754281.1| flagellar L-ring protein precursor H [Roseobacter sp. SK209-2-6]
 gi|126720375|gb|EBA17081.1| flagellar L-ring protein precursor H [Roseobacter sp. SK209-2-6]
          Length = 246

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 132/232 (56%), Gaps = 8/232 (3%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFK-NSDSTKKSYSLWRDSHAALF 72
            + G  + +  +   P  +P   +  E+  M + G+  +  S     + SLW  S  +L 
Sbjct: 16  FVLGACNRMDHLGKPPSFTPANET-QEHVAMLWQGLPHQVQSQRPVDNASLWSGSQQSLL 74

Query: 73  KDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL---FGQQTPQ-MNG 128
            D RA+N GDILTV I ID++A   N T RSR++S    +     L     +  P   + 
Sbjct: 75  GDRRAMNKGDILTVVIEIDEEAEISNDTSRSRSSSESLNMPQLLGLPQRLDEHLPTGASA 134

Query: 129 NLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
               D GGAS+  G GS+ R+EKL L +AA V  IL NG L ISGSQE+RVN E+R L V
Sbjct: 135 ATAVDLGGASTSRGNGSVKRSEKLELKVAATVVDILPNGVLAISGSQELRVNFELRELLV 194

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G VRPQD+   N ++YDKIA AR+SYGG+G+ T++ +P  G Q+++ + P 
Sbjct: 195 SGYVRPQDISRKNEITYDKIASARVSYGGRGQITDVQQPRYGQQVLDAILPF 246


>gi|254475405|ref|ZP_05088791.1| flagellar L-ring protein FlgH [Ruegeria sp. R11]
 gi|214029648|gb|EEB70483.1| flagellar L-ring protein FlgH [Ruegeria sp. R11]
          Length = 246

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/218 (39%), Positives = 123/218 (56%), Gaps = 10/218 (4%)

Query: 29  PQMSPMGSSLDENNRMPFLGI--DFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTV 86
           P  SP   +  E+  M F G+  D +      ++ SLW  S  +L  D RA   GDILTV
Sbjct: 31  PSFSPANET-PEHVAMLFQGLPTDTQTQRPVDQA-SLWSGSRQSLLGDRRATKRGDILTV 88

Query: 87  DIRIDDQAVFDNQTGRSRNNS---LHRKLSGGFSLFGQQTPQ---MNGNLNYDGGGASSG 140
            I ID++A   N T RSR+ S      +L G      +  P+       ++      S G
Sbjct: 89  VIEIDEEAEISNDTKRSRSGSESLAMPQLLGLPQRLDRHLPEGATAADAVDLSSTSQSGG 148

Query: 141 KGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNS 200
           KGS+ R+E+L L +AA V  +L NG L ISG+QE+RVN E+R L VTG VRP D+   N 
Sbjct: 149 KGSVKRSERLELRVAATVVDVLPNGVLAISGTQELRVNFELRELLVTGYVRPDDISRQNE 208

Query: 201 VSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           ++YDKIA AR+SYGG+G+ T++ +P  G Q+++ + P 
Sbjct: 209 ITYDKIASARVSYGGRGQITDVQQPRYGQQVLDVILPF 246


>gi|114762166|ref|ZP_01441634.1| flagellar L-ring protein precursor H [Pelagibaca bermudensis
           HTCC2601]
 gi|114545190|gb|EAU48193.1| flagellar L-ring protein precursor H [Roseovarius sp. HTCC2601]
          Length = 242

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 78/201 (38%), Positives = 116/201 (57%), Gaps = 10/201 (4%)

Query: 44  MPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRS 103
           +P + +  + +D      SLW    ++L  D RA+  GDILTV I IDD+A   N T RS
Sbjct: 46  VPTVALPQRQTDQA----SLWSRERSSLLGDRRAMKQGDILTVVIEIDDEASISNSTSRS 101

Query: 104 RNNSLH---RKLSGGFSLFGQQTP---QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
           R+ S      +L G      +  P    M   ++     AS G G + R E+L L +AA 
Sbjct: 102 RSGSESLSVPQLLGIPQRIDEDLPLGATMADAVDLGSQAASGGDGQVQRREELTLRVAAT 161

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +T ++ NG L I G+QEVRVN E+R L V+G VRP+D+   N ++YDKIA A+ISYGG+G
Sbjct: 162 ITDVMPNGVLAIEGAQEVRVNFELRELLVSGFVRPEDITRQNEITYDKIASAKISYGGRG 221

Query: 218 RTTELLRPPIGHQLIENLSPL 238
           + +++ +P  G Q+++ + P 
Sbjct: 222 QISDMQQPRYGQQVLDIVLPF 242


>gi|304392502|ref|ZP_07374442.1| flagellar L-ring protein FlgH [Ahrensia sp. R2A130]
 gi|303295132|gb|EFL89492.1| flagellar L-ring protein FlgH [Ahrensia sp. R2A130]
          Length = 224

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 134/237 (56%), Gaps = 15/237 (6%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           R + I++  +S   GC    ++I  + Q  PM S+++     P     +     +    S
Sbjct: 2   RLALILVLLAS---GC----AQIDKLDQPKPM-SAVEH----PVAQHAYARQPGSATRSS 49

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG-GFSLFGQ 121
           L+R + + LF D  AL+ GDI+TV + IDD+A   N++ R R  ++ R LSG G    G 
Sbjct: 50  LYRPARSGLFTDRIALDPGDIVTVLVSIDDRASLQNKSERQR--TVGRTLSGQGTIAAGS 107

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                +G+   +      G G+  RAE + + +AAI+     NGNL++ GSQEVRVN E+
Sbjct: 108 LVGTGSGSAGLESQTRFDGDGATVRAETIRVSVAAIIRQRYPNGNLLVEGSQEVRVNREL 167

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           R L VTGI+RP D+  +N++  ++IAEARISYGG+G   E+ +PP G +L++ + P 
Sbjct: 168 RRLTVTGIIRPSDIGPNNTIQSERIAEARISYGGRGPIAEVQKPPYGARLLDKVLPF 224


>gi|296534163|ref|ZP_06896656.1| flagellar L-ring protein FlgH [Roseomonas cervicalis ATCC 49957]
 gi|296265509|gb|EFH11641.1| flagellar L-ring protein FlgH [Roseomonas cervicalis ATCC 49957]
          Length = 246

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 128/225 (56%), Gaps = 15/225 (6%)

Query: 22  ISEITGIPQMSPMG-----SSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSR 76
           ISEI   PQ++P+      + L+    MP             ++ SLWR       +D R
Sbjct: 29  ISEIGRGPQLAPIENPAQVAGLERTVAMPM----PPAQAPLPETNSLWRPGSRTFLRDQR 84

Query: 77  ALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ--QTPQMNGNL-NYD 133
           A  VGD++TV ++I D+A  +N T RSR N+   +  G   L G   + P   GNL    
Sbjct: 85  AAQVGDLVTVLVQITDKAELENTTARSRANN---EDFGITRLLGMAARLPGGAGNLLETA 141

Query: 134 GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQ 193
               + G GSI+R E + L +AA V  +L NGNL+++G Q+VRVN E+R L V+GI+R Q
Sbjct: 142 SNSGTEGTGSINRNETVTLRVAATVVQMLPNGNLVVAGRQQVRVNHELRELQVSGIIRSQ 201

Query: 194 DVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           D+ + N+V +D++AEARI+YGG+G  +++ +P  G Q ++ + P 
Sbjct: 202 DIASDNTVRHDRLAEARIAYGGRGIISDVQQPRYGQQFLDLVLPF 246


>gi|126730132|ref|ZP_01745944.1| flagellar L-ring protein precursor H [Sagittula stellata E-37]
 gi|126709512|gb|EBA08566.1| flagellar L-ring protein precursor H [Sagittula stellata E-37]
          Length = 246

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 91/224 (40%), Positives = 117/224 (52%), Gaps = 36/224 (16%)

Query: 26  TGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILT 85
           +GIP+ +P G + D                      SLW    A+L  D RA+  GDILT
Sbjct: 48  SGIPEAAPPGRASD--------------------GASLWSAGQASLLGDRRAMKRGDILT 87

Query: 86  VDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSG----- 140
           V I IDD A   N T RSRN S    +     LFG   P+       DG    S      
Sbjct: 88  VVILIDDSAEIQNSTSRSRNGSESLAIP---DLFG--VPERINQGITDGASLDSAVDLNS 142

Query: 141 ------KGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
                  GS+ R+E L L IAA V  +L NG L I GSQEVRVN E+R L V+G VRP+D
Sbjct: 143 SASSGGDGSVRRSESLTLRIAATVVDVLPNGILSIEGSQEVRVNFELRELLVSGYVRPED 202

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +   N ++YDKIA ARISYGG+G+ T++ +P IG Q+++ + P 
Sbjct: 203 ISRQNEITYDKIASARISYGGRGQITDVQQPRIGQQVLDAILPF 246


>gi|89069816|ref|ZP_01157151.1| flagellar L-ring protein precursor [Oceanicola granulosus HTCC2516]
 gi|89044617|gb|EAR50733.1| flagellar L-ring protein precursor [Oceanicola granulosus HTCC2516]
          Length = 242

 Score =  137 bits (346), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 79/185 (42%), Positives = 107/185 (57%), Gaps = 6/185 (3%)

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           + SLW     +L  D RA+  GDILTV I IDD+A   N T RSR+ S    +     + 
Sbjct: 58  AASLWTGERGSLLGDRRAVQRGDILTVVIEIDDRAEIQNSTSRSRSGSESLGIPQLLGIP 117

Query: 120 GQQTPQMNGN------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
            +  P +         ++      S G GS+SR E+L L +AA +  +L NG L ISGSQ
Sbjct: 118 QRVDPALPEGASLADAVSLTSNSFSDGDGSVSRNERLELRVAATILDVLPNGVLAISGSQ 177

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           EVRVN E+R L V+G VRP+D+   N ++YDKIA ARISYGG+G  +++ +P  G QL +
Sbjct: 178 EVRVNHELRELLVSGFVRPEDITRQNEITYDKIASARISYGGRGLISDVQQPRYGQQLAD 237

Query: 234 NLSPL 238
            L P 
Sbjct: 238 ILLPF 242


>gi|83312592|ref|YP_422856.1| flagellar basal body L-ring protein [Magnetospirillum magneticum
           AMB-1]
 gi|82947433|dbj|BAE52297.1| Flagellar basal body L-ring protein [Magnetospirillum magneticum
           AMB-1]
          Length = 263

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/248 (35%), Positives = 136/248 (54%), Gaps = 15/248 (6%)

Query: 5   SFIVLCYSSLLFGCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           +  ++   S L  C+  + +SE+   PQ SP+ +   ++   P      + S   + + S
Sbjct: 17  ALALVAAMSELSACNMLTRMSEVGSGPQTSPIQNPTQKSGYQPVSMPMPQPSAPPQNANS 76

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG--GFSL-- 118
           LWR    A FKD RA +VGDILTV + I D A        SR  S  +  SG  G  +  
Sbjct: 77  LWRPGARAFFKDQRAKDVGDILTVAVSIADSATLTTGLTNSRTGS-EKAGSGTTGSPISA 135

Query: 119 --FGQQTPQMNGNLNY------DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
             F QQ  ++  N+N           A +  G+ +R E + + +AA++T +L NGNL+IS
Sbjct: 136 MGFEQQLSKLLPNINLASLADLSSTSAVTNSGNTTRTESITMSMAAVITQVLPNGNLVIS 195

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G QE RVN E+R L++ GI+RP+D+ + NSVS +KIAEAR+ YGG+G  ++L +P  G Q
Sbjct: 196 GRQEFRVNYEMRELSIQGIIRPEDISSSNSVSSEKIAEARVYYGGRGMVSDLTQPRYGQQ 255

Query: 231 LIENLSPL 238
           + + + P 
Sbjct: 256 IFDIIFPF 263


>gi|110677665|ref|YP_680672.1| flagellar basal body L-ring protein [Roseobacter denitrificans OCh
           114]
 gi|109453781|gb|ABG29986.1| flagellar L-ring protein FlgH, putative [Roseobacter denitrificans
           OCh 114]
          Length = 243

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 139/242 (57%), Gaps = 14/242 (5%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS-YSLW 64
           F+ +  ++L+    + +  +   P  SP  S+  E+  M   G+  +   ST     SLW
Sbjct: 5   FLCVMTAALVMSGCARLDHLGKPPSFSP-ASATKEHTAMLSPGLPLRVDTSTPTDDASLW 63

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG---- 120
             +  +LF D RA+  GDILTV I ID++A   N T RSR+ S   +  G  SLFG    
Sbjct: 64  SGARQSLFGDRRAVQQGDILTVVIEIDEEAEISNATDRSRSGS---ESLGIPSLFGLPQR 120

Query: 121 --QQTPQ---MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
             ++ P    ++  ++ +    SSG GS+ R EKL L +AA +  +L NG L I+GSQE+
Sbjct: 121 IDRELPTGATLSDAVSINSSSNSSGDGSVKRNEKLTLRVAATIVDVLPNGVLSIAGSQEL 180

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           RVN E+R L V+G VRP+D+   N ++YDKIA AR+SYGG+G+ T++ +P  G Q ++ +
Sbjct: 181 RVNFEMRELLVSGYVRPEDISRKNEITYDKIATARVSYGGRGQITDVQQPRWGQQALDIV 240

Query: 236 SP 237
            P
Sbjct: 241 LP 242


>gi|83594177|ref|YP_427929.1| flagellar basal body L-ring protein [Rhodospirillum rubrum ATCC
           11170]
 gi|110816540|sp|Q2RQF3|FLGH_RHORT RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|83577091|gb|ABC23642.1| Flagellar L-ring protein [Rhodospirillum rubrum ATCC 11170]
          Length = 255

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 110/184 (59%), Gaps = 7/184 (3%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRI-DDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SLW     + FKD RA  VGD+LTV + I +++A F N   R+R N     L+      G
Sbjct: 72  SLWVPGARSFFKDQRAGEVGDLLTVIVDISNEKATFANNLSRTRGNKEGANLTSFLGFEG 131

Query: 121 QQTPQMNGNLN------YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                +   ++      +      +G GS++R+E +++ +AA+V  IL NGN +I+G QE
Sbjct: 132 TLADVLPDGVDPASLTSFGSDSKHTGNGSMARSETVSMRLAAVVLQILPNGNFVIAGKQE 191

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           VRVN E+R L VTG++RP+D+ + N++ + +IAEARISYGG+G  T+++ P  G Q+ + 
Sbjct: 192 VRVNGELRELTVTGVIRPEDIRSDNTIFWHQIAEARISYGGRGTVTDMVEPRYGQQVYDI 251

Query: 235 LSPL 238
           L P 
Sbjct: 252 LFPF 255


>gi|163738058|ref|ZP_02145474.1| flagellar L-ring protein [Phaeobacter gallaeciensis BS107]
 gi|161388674|gb|EDQ13027.1| flagellar L-ring protein [Phaeobacter gallaeciensis BS107]
          Length = 246

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 92/225 (40%), Positives = 122/225 (54%), Gaps = 24/225 (10%)

Query: 29  PQMSPMGSSLDENNRMPFLGIDFKNSDSTK-KSYSLWRDSHAALFKDSRALNVGDILTVD 87
           P  SP   S  E+  M F G+     +       SLW  S  +L  D RA   GDILTV 
Sbjct: 31  PTFSPANES-PEHVAMLFQGLPVNTQNQRPVDQASLWSGSRQSLLGDRRATKQGDILTVV 89

Query: 88  IRIDDQAVFDNQTGRSRNNS--------------LHRKLSGGFSLFGQQTPQMNGNLNYD 133
           I ID++A   N T RSR+ S              L RKL  G S        M   ++  
Sbjct: 90  IEIDEEAEISNDTKRSRSGSESLAVPQLLGLPQRLDRKLPEGAS--------MADAVDIG 141

Query: 134 GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQ 193
              +S GKGS+ R+EKL L +AA V  +L NG L ISG+QE+RVN E+R L VTG VRP 
Sbjct: 142 SSSSSGGKGSVKRSEKLELRVAATVVDVLPNGVLSISGTQELRVNFEMRELLVTGYVRPD 201

Query: 194 DVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           D+   N ++YDKIA AR+SYGG+G+ T++ +P  G Q+++ + P 
Sbjct: 202 DISRQNEITYDKIASARVSYGGRGQITDVQQPRYGQQVLDVILPF 246


>gi|254465003|ref|ZP_05078414.1| flagellar L-ring protein FlgH [Rhodobacterales bacterium Y4I]
 gi|206685911|gb|EDZ46393.1| flagellar L-ring protein FlgH [Rhodobacterales bacterium Y4I]
          Length = 246

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 111/191 (58%), Gaps = 22/191 (11%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS-------------- 107
           SLW  S  +L  D RA+  GDILTV I ID++A   N T RSR+ S              
Sbjct: 64  SLWSGSQQSLLGDRRAIKRGDILTVVIEIDEEAEISNDTQRSRSGSESLNMPQLLGLPQR 123

Query: 108 LHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           L RKL  G +            +      ++ GKGS+ R+EKL L +AA V  +L NG L
Sbjct: 124 LDRKLPEGAT--------SADAVELGSSSSAGGKGSVKRSEKLELRVAATVVDVLPNGVL 175

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            ISG+QE+RVN E+R L VTG VRPQD+   N ++YDKIA AR+SYGG+G+ T++ +P  
Sbjct: 176 AISGTQELRVNFELRELLVTGYVRPQDISRQNEITYDKIASARVSYGGRGQITDVQQPRY 235

Query: 228 GHQLIENLSPL 238
           G QL++ + P 
Sbjct: 236 GQQLLDAVLPF 246


>gi|163742546|ref|ZP_02149932.1| flagellar L-ring protein precursor H [Phaeobacter gallaeciensis
           2.10]
 gi|161384131|gb|EDQ08514.1| flagellar L-ring protein precursor H [Phaeobacter gallaeciensis
           2.10]
          Length = 232

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 92/225 (40%), Positives = 122/225 (54%), Gaps = 24/225 (10%)

Query: 29  PQMSPMGSSLDENNRMPFLGIDFKNSDSTK-KSYSLWRDSHAALFKDSRALNVGDILTVD 87
           P  SP   S  E+  M F G+     +       SLW  S  +L  D RA   GDILTV 
Sbjct: 17  PTFSPANES-PEHVAMLFQGLPVNTQNQRPVDQASLWSGSRQSLLGDRRATKQGDILTVV 75

Query: 88  IRIDDQAVFDNQTGRSRNNS--------------LHRKLSGGFSLFGQQTPQMNGNLNYD 133
           I ID++A   N T RSR+ S              L RKL  G S        M   ++  
Sbjct: 76  IEIDEEAEISNDTKRSRSGSESLAVPQLLGLPQRLDRKLPEGAS--------MADAVDIG 127

Query: 134 GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQ 193
              +S GKGS+ R+EKL L +AA V  +L NG L ISG+QE+RVN E+R L VTG VRP 
Sbjct: 128 SSSSSGGKGSVKRSEKLELRVAATVVDVLPNGVLSISGTQELRVNFEMRELLVTGYVRPD 187

Query: 194 DVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           D+   N ++YDKIA AR+SYGG+G+ T++ +P  G Q+++ + P 
Sbjct: 188 DISRQNEITYDKIASARVSYGGRGQITDVQQPRYGQQVLDVILPF 232


>gi|326404067|ref|YP_004284149.1| flagellar L-ring protein [Acidiphilium multivorum AIU301]
 gi|325050929|dbj|BAJ81267.1| flagellar L-ring protein [Acidiphilium multivorum AIU301]
          Length = 253

 Score =  134 bits (338), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 84/239 (35%), Positives = 133/239 (55%), Gaps = 18/239 (7%)

Query: 13  SLLFGC--HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA 70
           SLL GC   S+++ +   P M+P+ +     +  P          +  +  SLWR    A
Sbjct: 20  SLLEGCGTFSNLAYVGHAPPMTPITNPTKAPSWRPVSMPMPPLRRAPTEPDSLWRRGARA 79

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQT--GRSRNNSLHRKLSGGFSLFGQQT--PQM 126
            FKD RA  VGDI+T+ I I+D A   +QT  GR+ + SL     G  +LFG ++  P++
Sbjct: 80  FFKDQRASQVGDIITILININDAATLKDQTTLGRTGSESL-----GVPNLFGLESLIPRV 134

Query: 127 NGN-------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
            G        ++    G S+G G I R E ++L +A  +T +L +GN ++   QE+RVN 
Sbjct: 135 LGKSVNPSSLVSLSSAGNSTGTGQIQRNESVSLSLAGEITQVLPDGNFVVVARQEMRVNH 194

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           E+R L V+GI RPQD+  +N++  +++AEARISYGG+G  +    P  G Q+++++ P 
Sbjct: 195 ELRVLTVSGICRPQDISGNNTIQSNQLAEARISYGGRGIVSGEQSPRYGQQVLDDIVPF 253


>gi|89068733|ref|ZP_01156119.1| flagellar L-ring protein precursor [Oceanicola granulosus HTCC2516]
 gi|89045696|gb|EAR51758.1| flagellar L-ring protein precursor [Oceanicola granulosus HTCC2516]
          Length = 250

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 103/168 (61%), Gaps = 9/168 (5%)

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN--SLHRKLSGGF 116
           +S SLW       F D RA  VGDILT+DI IDD+A   N + R R+   S+    + G+
Sbjct: 62  ESASLWAPGARGFFGDQRATAVGDILTIDIEIDDEASLANASSRERDGEGSVAMPTALGY 121

Query: 117 S------LFGQQTPQMNGNL-NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
                  + G    +++  L        +SG G+I R E + L +AA+V  +L NGN+++
Sbjct: 122 ENHLANVIPGISQDELSDPLIGLRSETNASGSGTIRRNESIKLKVAAMVIQLLPNGNMVV 181

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +G QEV+VNDE+R L V GI+RPQD+  +N+V YDKIAEARISYGG+G
Sbjct: 182 AGRQEVKVNDELRELRVAGIIRPQDIQMNNTVPYDKIAEARISYGGEG 229


>gi|146278641|ref|YP_001168800.1| flagellar basal body L-ring protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556882|gb|ABP71495.1| flagellar L-ring protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 239

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 96/230 (41%), Positives = 119/230 (51%), Gaps = 20/230 (8%)

Query: 22  ISEITGIPQMSPMGSSLDENNRMPFLGI--DFKNSDSTKKSYSLWRDSHAALFKDSRALN 79
           ++E+   P  SP   +  + + M  L I     NS  T  S SLW    A+L  D RA  
Sbjct: 17  LAEVGKAPSFSPADETF-QYHAMYALPIPESLGNSGPTAGS-SLWAGDRASLLGDRRASR 74

Query: 80  VGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASS 139
            GDILTV I IDD+A   N TGRSR+      L    S FG   PQ       DG     
Sbjct: 75  RGDILTVAIEIDDRAEISNSTGRSRSGGESLGLP---SFFG--IPQRIDRHLPDGASMED 129

Query: 140 G-----------KGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
                        GS+ R EKL L +AA V   L NG L I G QEVRVN E+R L VTG
Sbjct: 130 AVSTSSSSSYSGDGSVRRKEKLTLRVAATVVEELPNGVLRIQGQQEVRVNYELRELVVTG 189

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            VRP D+   N ++YDKIAEARISYGG+G+ T++ +P  G Q+ + + P 
Sbjct: 190 YVRPGDISRQNEITYDKIAEARISYGGRGQITDVQQPRYGQQVADIILPF 239


>gi|144224|gb|AAA23035.1| basal body L-ring protein precursor [Caulobacter vibrioides]
          Length = 242

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 105/175 (60%), Gaps = 7/175 (4%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH---RKLSGGFSLFGQQTP-- 124
           A F D RA  VGDI+TV I IDD A     T  SR  ++    R L G  S  G+  P  
Sbjct: 69  AFFNDQRASRVGDIVTVMIDIDDSARTKKPTNSSRTANMKAGVRHLLGMESSLGKFLPGG 128

Query: 125 -QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                 L  +    ++G G  SR+EK++L IAA+V+ +L NGN++I G+QEVR N E+R 
Sbjct: 129 FDPASALETNSTTTNAGSGG-SRSEKISLTIAAVVSQLLPNGNMVIQGTQEVRTNAELRQ 187

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           L V GIVRP+D+ + N++ + +IAEARISYGG+G  + + + P G  L+E  SP 
Sbjct: 188 LTVAGIVRPEDISSANTIRHTQIAEARISYGGRGDISRVQKTPAGQSLVEKFSPF 242


>gi|23015790|ref|ZP_00055557.1| COG2063: Flagellar basal body L-ring protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 263

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 88/240 (36%), Positives = 131/240 (54%), Gaps = 15/240 (6%)

Query: 13  SLLFGCH--SSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA 70
           S L  C+  + +SE+   PQ SP+ +    +   P      + S   + + SLWR    A
Sbjct: 25  SELSACNMLTRMSEVGSGPQSSPISNPTQASGYQPVSMPMPQPSAPPQNANSLWRPGARA 84

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG--GFSLFG----QQTP 124
            FKD RA +VGDILTV + I D A        SR  S  +  SG  G S+       Q  
Sbjct: 85  FFKDQRAKDVGDILTVAVSISDSATLTTGLTNSRTGS-EKAGSGTTGSSITAVGLESQLA 143

Query: 125 QMNGNLNY------DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           ++  N+N           A +  G+ +R E + + +AA++T +L NGNL+ISG QE RVN
Sbjct: 144 KLLPNINLASLADLSSTSAVTNSGNTTRTESITMSMAAVITQVLPNGNLVISGRQEFRVN 203

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            E+R L++ GI+RP+D+ + NSVS +KIAEAR+ YGG+G  ++L +P  G Q+ + + P 
Sbjct: 204 YEMRELSIQGIIRPEDISSSNSVSSEKIAEARVYYGGRGMVSDLTQPRYGQQIFDIIFPF 263


>gi|254470268|ref|ZP_05083672.1| flagellar L-ring protein FlgH [Pseudovibrio sp. JE062]
 gi|211960579|gb|EEA95775.1| flagellar L-ring protein FlgH [Pseudovibrio sp. JE062]
          Length = 253

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 108/182 (59%), Gaps = 5/182 (2%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF----- 116
           SLWR  + A F+D RA  +GDI+TV++ I D+A F+N +  SR+++ +    G       
Sbjct: 72  SLWRTGNRAFFQDQRAKRIGDIVTVNVTISDEAAFENSSRSSRSDAKNSGAGGALGAAIN 131

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           +L    +   +   + +      G GSI R E L   +AA+VT +L N NL+I G QEVR
Sbjct: 132 TLALPASASADALASINSSDTFQGSGSIDRTESLKTTVAAVVTQVLPNSNLVIEGRQEVR 191

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           VN E+R L V G++RPQD+ + N+V   KIAEARI YGG+G+ +   +P  G Q+++ + 
Sbjct: 192 VNHEVRELIVAGVIRPQDIASDNTVESTKIAEARIGYGGRGQISVAQQPRYGSQVLDIVL 251

Query: 237 PL 238
           P 
Sbjct: 252 PF 253


>gi|162147476|ref|YP_001601937.1| flagellar basal body L-ring protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545585|ref|YP_002277814.1| flagellar basal body L-ring protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786053|emb|CAP55635.1| putative flagellar L-ring protein precursor [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533262|gb|ACI53199.1| flagellar L-ring protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 250

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 107/179 (59%), Gaps = 2/179 (1%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLWR    + FKD RA  VGD++T+ +++ D A   N T  + + S    +   F L G+
Sbjct: 72  SLWRPGSRSFFKDQRASQVGDLITIIVQVADNANIVNNTSAAGSGSEDFGIPSIFGLKGK 131

Query: 122 --QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                  +  LN     A++  G I+R E + L +   +T +L NGN ++   QEVRVN 
Sbjct: 132 VASHLSSSSALNTSSATANTATGRITRTEAVGLTLGGTITQVLPNGNFVVVARQEVRVNG 191

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           E+R L V+G+VRPQD+   N+V++D+IAEARISYGG+G+ T+L  P  G Q+++N+ P 
Sbjct: 192 ELRQLMVSGVVRPQDITEDNTVTHDRIAEARISYGGRGQLTKLQTPRYGQQILDNVLPF 250


>gi|56695098|ref|YP_165445.1| flagellar basal body L-ring protein [Ruegeria pomeroyi DSS-3]
 gi|81350864|sp|Q5LWX7|FLGH_SILPO RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|56676835|gb|AAV93501.1| flagellar L-ring protein FlgH [Ruegeria pomeroyi DSS-3]
          Length = 246

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 112/183 (61%), Gaps = 6/183 (3%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH---RKLSGGFSL 118
           SLW     +L  D RA+  GDILTV I ID++A   N T RSR+ S       L G    
Sbjct: 64  SLWSGGQNSLLGDQRAMKKGDILTVVIEIDEKAEISNDTNRSRSGSESLGVPHLLGLPQR 123

Query: 119 FGQQTPQ---MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
             ++ P+   M+  +  D   AS GKGS+ R EKL L +AA V  +L NG L I+GSQE+
Sbjct: 124 IDEKLPEGASMSNAVAVDSSSASGGKGSVKRKEKLTLRVAATVVDVLPNGVLSITGSQEL 183

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           RVN E+R L V+G VRP+D+   N ++YDKIA AR+SYGG+G+ T++ +P  G Q+++ +
Sbjct: 184 RVNFELRELLVSGYVRPEDISRQNEITYDKIASARVSYGGRGQITDVQQPRYGQQVLDMV 243

Query: 236 SPL 238
            P 
Sbjct: 244 LPF 246


>gi|304321135|ref|YP_003854778.1| flagellar L-ring protein precursor [Parvularcula bermudensis
           HTCC2503]
 gi|303300037|gb|ADM09636.1| flagellar L-ring protein precursor [Parvularcula bermudensis
           HTCC2503]
          Length = 231

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 128/246 (52%), Gaps = 23/246 (9%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEI--TGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M R SF +   +  +  C ++  ++    IP   P+ + L      P L           
Sbjct: 1   MTRSSFPLFIAALAVSACTTTNDQLPYAEIPTPEPIVADL------PALA---------P 45

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           ++ SLW     +LF + RA NVGDILTV + +D+QA   N   R+R N     ++  F +
Sbjct: 46  RNASLWNQEPQSLFGNRRARNVGDILTVIVSVDEQAEIQNSLARNRTNQEDFSVNALFGI 105

Query: 119 FGQQTPQMNGNLNYDGG------GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
             Q   Q+ G+  +           ++G GSI+R E++ L +AA V   L NG+L++ GS
Sbjct: 106 DQQFQDQLPGDATFSPAVGVTRQATAAGDGSITRQERITLRLAAQVIEQLPNGHLVVVGS 165

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           Q +RVN E+R L + G+VRP+D+   N++++DKIA A I Y G+G+ +    P  G +++
Sbjct: 166 QRIRVNQEVRDLRLQGVVRPEDITRDNTITHDKIAAADIVYTGQGQISRTTNPKPGSRVL 225

Query: 233 ENLSPL 238
           + + P 
Sbjct: 226 DFIVPF 231


>gi|255263180|ref|ZP_05342522.1| flagellar L-ring protein [Thalassiobium sp. R2A62]
 gi|255105515|gb|EET48189.1| flagellar L-ring protein [Thalassiobium sp. R2A62]
          Length = 246

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 88/246 (35%), Positives = 130/246 (52%), Gaps = 19/246 (7%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRM-PFLGIDFKNSDSTKKSYSL 63
           S  +L    ++ GC + +  +   P+++P+ S+++    M P L      +     + SL
Sbjct: 8   SKFILPIFLIMSGC-ARMESVGQEPEITPVRSTIEHTAMMTPSLPQTLVQTPPVANA-SL 65

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           W     +LF D RA   GDILTV I IDD+A   N + R+R+ S +  +    SLFG   
Sbjct: 66  WSGGRESLFGDKRAATRGDILTVVIEIDDKAEISNSSNRARSGSENLSVP---SLFG--I 120

Query: 124 PQMNGNLNYDGGGASSGKGSIS-----------RAEKLNLLIAAIVTAILENGNLIISGS 172
           PQ       +G   S      S           R EKL L +AA V  +L NG L I G+
Sbjct: 121 PQRVDQSLPEGATLSEAVSLNSSSASSGNGSVSRNEKLTLRVAATVVDVLPNGVLSIQGT 180

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           QEVRVN E+R L V+G VRP+D+   N ++YDKIA AR+SYGG+G+ +++ +P  G Q+ 
Sbjct: 181 QEVRVNFELRELLVSGFVRPKDITRQNEITYDKIASARVSYGGRGQISDMQQPRYGQQIA 240

Query: 233 ENLSPL 238
           + + P 
Sbjct: 241 DIILPF 246


>gi|163794154|ref|ZP_02188127.1| Flagellar L-ring protein [alpha proteobacterium BAL199]
 gi|159180768|gb|EDP65287.1| Flagellar L-ring protein [alpha proteobacterium BAL199]
          Length = 251

 Score =  131 bits (329), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 143/245 (58%), Gaps = 10/245 (4%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSD---STKK 59
           R  F  +  ++ L GC S++  +  I Q   M    D      +  +         +T++
Sbjct: 8   RPLFATIAVAAALSGC-SAVDRLANIGQAPEMSRIEDPTRGAGYQPVSMPMPAPVVATRQ 66

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           + SLW++   A FKD RA ++GDI+TV + I D+A  DN T R+R NS   +L+G F   
Sbjct: 67  ANSLWQEGSRAFFKDQRASDIGDIITVVVTIADKAAVDNTTTRTRTNSDAAQLNGLFGYE 126

Query: 120 GQQT---PQMNGNLNY-DGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
           G  T   P+     N+ D G ++S  G G + R E++NL +A ++T  L NGN+++ G Q
Sbjct: 127 GSLTSVFPEAVTGGNFLDLGSSTSNVGAGKVDREEEINLRVAGVITQKLPNGNMVVYGRQ 186

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           EVRVN E+R + V G++R  D+ + N++SYD++AEARISYGG+G+ T++ +P  G Q+++
Sbjct: 187 EVRVNFEVREVVVGGVIRAADITSSNTISYDQMAEARISYGGRGQITDVQQPRFGSQVLD 246

Query: 234 NLSPL 238
            + P 
Sbjct: 247 VIMPF 251


>gi|119384849|ref|YP_915905.1| flagellar basal body L-ring protein [Paracoccus denitrificans
           PD1222]
 gi|119374616|gb|ABL70209.1| flagellar L-ring protein [Paracoccus denitrificans PD1222]
          Length = 250

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/182 (42%), Positives = 107/182 (58%), Gaps = 6/182 (3%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL--- 118
           SLW  S  AL  D RA   GDILTV I IDD+A   N +GRSR+++ +  ++    L   
Sbjct: 68  SLWAVSQNALVADRRASQRGDILTVVIEIDDRAEIQNSSGRSRSSADNVGIASMMGLPQR 127

Query: 119 FGQQTPQ---MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
             +  P+   M+         +  G G+ISR +KL L +AA V   L NG L I G+QEV
Sbjct: 128 IDEILPEGASMDKLAEAKASSSYKGSGNISRRDKLTLRVAATVVDRLPNGVLRIQGTQEV 187

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           RVN E+R L V G VRP D+   N ++YD+IA ARISYGG+G+ +++ +P  G QL + +
Sbjct: 188 RVNYEVRELTVNGFVRPSDIGRRNEIAYDRIAGARISYGGRGQISDVQQPRYGQQLADIV 247

Query: 236 SP 237
            P
Sbjct: 248 LP 249


>gi|260574399|ref|ZP_05842403.1| flagellar L-ring protein [Rhodobacter sp. SW2]
 gi|259023295|gb|EEW26587.1| flagellar L-ring protein [Rhodobacter sp. SW2]
          Length = 239

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 123/225 (54%), Gaps = 24/225 (10%)

Query: 29  PQMSPMGSSLDEN----NRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDIL 84
           P  SP+  S   N    N +P    +    D+   + SLW    A+LF D RA   GDIL
Sbjct: 24  PAFSPLEGSYQHNAMYSNPIP----ESTEPDAASDASSLWTGGRASLFGDRRAGRRGDIL 79

Query: 85  TVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ-----------MNGNLNYD 133
           TV I IDD+A   N + RSR++S +  +    SL G   PQ           M   ++  
Sbjct: 80  TVVIEIDDKAEISNSSDRSRSSSENMGIP---SLLG--IPQRLNSALPAGASMADAVSAT 134

Query: 134 GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQ 193
           G  +  G GS++R EKL L +AA V   L NG L I G QEVRVN E+R L VTG VRP 
Sbjct: 135 GSSSFQGDGSVARKEKLTLRVAATVVEELPNGVLRIEGQQEVRVNFELRELIVTGYVRPV 194

Query: 194 DVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           D+   N ++YDKIA ARISYGG+G+ T++ +P +G Q+ + L P 
Sbjct: 195 DISRQNEITYDKIAGARISYGGRGQITDVQQPRLGQQVADILLPF 239


>gi|84502381|ref|ZP_01000517.1| flagellar L-ring protein precursor [Oceanicola batsensis HTCC2597]
 gi|84389193|gb|EAQ01990.1| flagellar L-ring protein precursor [Oceanicola batsensis HTCC2597]
          Length = 257

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 120/219 (54%), Gaps = 24/219 (10%)

Query: 17  GCHSSI----SEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALF 72
           GC S        I+G+ +MSP         ++P    +   +    +  SLW+      F
Sbjct: 24  GCASDPFDRDPRISGV-EMSPHVMPEVARVQVPMPPPEVPRTPERGEQSSLWQRGSGGFF 82

Query: 73  KDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN--------------NSLHRKLSGGFSL 118
            D RA  VGDILT+ I IDDQA   N T R R+              + LH+ L G   +
Sbjct: 83  ADQRATKVGDILTITIEIDDQAQLSNSTDRERSGNSEFTKPQFFGYASKLHKILPG---V 139

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
              Q P  +  +       +SG GSI+R E ++L +AA+V  +L NGN++++G QEV+VN
Sbjct: 140 GAGQVP--DPLVQSSSSTTASGSGSIARNETISLKVAALVVQMLPNGNMVVAGRQEVKVN 197

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +E+R L V GI+RP+D+  +N++ Y+KIAEARI+YGG+G
Sbjct: 198 EELRELRVAGIIRPEDIATNNTIPYEKIAEARITYGGEG 236


>gi|163744351|ref|ZP_02151711.1| flagellar L-ring protein precursor H [Oceanibulbus indolifex
           HEL-45]
 gi|161381169|gb|EDQ05578.1| flagellar L-ring protein precursor H [Oceanibulbus indolifex
           HEL-45]
          Length = 256

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 90/236 (38%), Positives = 125/236 (52%), Gaps = 28/236 (11%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPM---GSSLDENNR----MPFLGIDFKNSD 55
           R S ++   +  L GC +S       PQ SP+   G ++ E  R    MP + ++     
Sbjct: 7   RPSVLMFGAALALTGCDTS-PHFDRDPQPSPIVVSGETIPEVARVQVPMPAVALEPPRRG 65

Query: 56  STKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
           S K S  L+     ALF D RA ++GDI+TV I IDD+A   N T R R  +     S G
Sbjct: 66  SAKAS--LFSARSEALFADQRADDIGDIVTVVISIDDRAQLRNSTDREREGAS----SIG 119

Query: 116 FSLF------------GQQTPQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAI 161
           F  F            G     +      + G AS  SG G+ISR E++ L +AA+V   
Sbjct: 120 FPTFFGYGAKIAAILPGISAADLPSGDVVEIGSASEASGSGAISRNERIELKVAALVIDK 179

Query: 162 LENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           L NG ++++G QE+ VN E+R L + GIVRP D+   N++SYDKIAEARI+YGG+G
Sbjct: 180 LPNGTVVVAGRQEIMVNQELRELRMAGIVRPADIRDDNTISYDKIAEARIAYGGRG 235


>gi|259418147|ref|ZP_05742066.1| flagellar L-ring protein FlgH [Silicibacter sp. TrichCH4B]
 gi|259347053|gb|EEW58867.1| flagellar L-ring protein FlgH [Silicibacter sp. TrichCH4B]
          Length = 223

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 111/188 (59%), Gaps = 16/188 (8%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW  S A+L  D RA   GDILTV I I+++A   N T RSRN+S   ++     L   
Sbjct: 41  SLWSGSRASLLGDRRATKKGDILTVVIEINEKASISNDTKRSRNSSESMQVPQLLGL--- 97

Query: 122 QTPQMNGNLNYDGGGAS-----------SGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
             PQ       DG  ++            G GS+SR+EKL L +AA V  +L NG L IS
Sbjct: 98  --PQRLDERLPDGASSADLIDLGSNSSSGGSGSVSRSEKLELRVAATVVDVLPNGVLAIS 155

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           GSQE+RVN E+R L V+G VRP D+   N V+YDKIA AR+SYGG+G+ T++ +P  G Q
Sbjct: 156 GSQELRVNFELRELLVSGYVRPDDISRQNEVTYDKIASARVSYGGRGQITDVQQPRYGQQ 215

Query: 231 LIENLSPL 238
           +++ + P 
Sbjct: 216 VLDAVLPF 223


>gi|99082798|ref|YP_614952.1| flagellar basal body L-ring protein [Ruegeria sp. TM1040]
 gi|99039078|gb|ABF65690.1| Flagellar L-ring protein precursor [Ruegeria sp. TM1040]
          Length = 245

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 91/235 (38%), Positives = 135/235 (57%), Gaps = 13/235 (5%)

Query: 13  SLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY---SLWRDSHA 69
           SL+ GC + +  +   P  +P   +  E+  M + G+    S  T ++    SLW  S  
Sbjct: 15  SLVGGC-ARMDHLGKPPSFTPANET-QEHVAMLYQGLPV--SSQTPRAVDNASLWSGSRG 70

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL---FGQQTPQM 126
           +L  D RA   GDILTV I I+++A   N T RSRN+S   ++     L     ++ P+ 
Sbjct: 71  SLLGDRRATKKGDILTVVIEINEKASISNDTQRSRNSSESLQVPQLLGLPQRLDERLPEG 130

Query: 127 NGN---LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
             +   ++     +S G GS+SR+EKL L +AA V  +L NG L ISGSQE+RVN E+R 
Sbjct: 131 ASSADLVDLGSTSSSGGSGSVSRSEKLELRVAATVVDVLPNGVLAISGSQELRVNFELRE 190

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           L V+G VRP D+   N V+YDKIA AR+SYGG+G+ T++ +P  G Q+++ + P 
Sbjct: 191 LLVSGYVRPDDISRQNEVTYDKIASARVSYGGRGQITDVQQPRYGQQVLDAVLPF 245


>gi|254486395|ref|ZP_05099600.1| flagellar L-ring protein FlgH [Roseobacter sp. GAI101]
 gi|214043264|gb|EEB83902.1| flagellar L-ring protein FlgH [Roseobacter sp. GAI101]
          Length = 242

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 129/247 (52%), Gaps = 29/247 (11%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPF--LGIDFKNSDSTKKSYS 62
           +F   C  +   G   + SE        PM S+  E+N M +  L I         +S S
Sbjct: 12  AFSAACARTDHMGSTPTFSE--------PMQSA--EHNAMVYEALPIRLAPVRLVDRS-S 60

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
           LW  +  +L  D RA+  GDI+TV I I++ A   NQT RSR+ S    +    +L G  
Sbjct: 61  LWSGTRNSLLGDRRAMQRGDIMTVVIEINENAEISNQTDRSRSGSESLSVP---NLLG-- 115

Query: 123 TPQMNGNLNYDGGGASSGKG-----------SISRAEKLNLLIAAIVTAILENGNLIISG 171
            PQ       DG  ++   G           S+ R E L L +AA V  +L NG L ISG
Sbjct: 116 IPQRLDEKLPDGASSADLVGLSSSSNSSGNGSVKRKENLTLRVAATVVDVLPNGVLSISG 175

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           +QE+RVN E+R L VTG VR +D+   N ++YDKIA AR+SYGG+G+ +++ +P IG Q+
Sbjct: 176 TQELRVNFELRELLVTGFVRSEDISRQNEITYDKIASARVSYGGRGQISDMQQPRIGQQV 235

Query: 232 IENLSPL 238
           ++ + P 
Sbjct: 236 LDAVLPF 242


>gi|83944160|ref|ZP_00956616.1| Flagellar L-ring protein flgH [Sulfitobacter sp. EE-36]
 gi|83955140|ref|ZP_00963796.1| flagellar L-ring protein precursor [Sulfitobacter sp. NAS-14.1]
 gi|83840469|gb|EAP79642.1| flagellar L-ring protein precursor [Sulfitobacter sp. NAS-14.1]
 gi|83845027|gb|EAP82908.1| Flagellar L-ring protein flgH [Sulfitobacter sp. EE-36]
          Length = 245

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 108/188 (57%), Gaps = 26/188 (13%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW +S   LF+D RA +VGD++TV I IDD+A   N TGRSR++S            G 
Sbjct: 71  SLWSNSTPRLFQDRRAGDVGDLVTVLIDIDDRAQLQNATGRSRSSST-----------GV 119

Query: 122 QTPQMNGNLNYDGGGAS------------SGKGSISRAEKLNLLIAAIVTAILENGNLII 169
             P +   LN+D    S             G+GSI R E + L +AA+V   L NGN +I
Sbjct: 120 DDPDI---LNFDTSTDSGQLIGLSSSSSSEGEGSIRRNETIRLRVAALVIQTLPNGNFVI 176

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
           +G QEV+VN+E+R L + GI+R  D++  N++ YDKIAEARI+YGG+G+ + +     G 
Sbjct: 177 AGRQEVKVNNELRELRIAGIIRQSDINVGNTIDYDKIAEARITYGGRGQISTVQTARYGQ 236

Query: 230 QLIENLSP 237
             +E   P
Sbjct: 237 DALEVFLP 244


>gi|114800335|ref|YP_758989.1| flagellar L-ring protein FlgH [Hyphomonas neptunium ATCC 15444]
 gi|114740509|gb|ABI78634.1| flagellar L-ring protein FlgH [Hyphomonas neptunium ATCC 15444]
          Length = 239

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 106/190 (55%), Gaps = 6/190 (3%)

Query: 55  DSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
           D   ++ SLW  +  AL    RA  VGD+LTV + ++DQA   +   R+R++S    +  
Sbjct: 50  DPNIQNASLWETAPTALLSMRRAKEVGDLLTVVVEMNDQASLQSSLSRNRDSSDDMNVEA 109

Query: 115 GFSLFGQQTPQMNGNLNYDGG------GASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
            F L       + G  +   G       + +G G+++RAEK+   +AA V  +  NGNLI
Sbjct: 110 LFGLPEWANGVLPGGASLSPGVDVSRNSSQNGSGAVNRAEKVTFTLAARVIGVEPNGNLI 169

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G Q+ RV++E+R L V+G++R QD+   N+V+YDKIA+A+++Y   G  +      IG
Sbjct: 170 IHGYQQTRVSNEVRYLTVSGVIRAQDITRMNAVTYDKIADAKLAYVSNGDASSATDRKIG 229

Query: 229 HQLIENLSPL 238
            ++I+ + P 
Sbjct: 230 TKIIDRVVPF 239


>gi|159045794|ref|YP_001534588.1| flagellar basal body L-ring protein [Dinoroseobacter shibae DFL 12]
 gi|157913554|gb|ABV94987.1| flagellar basal body L-ring protein [Dinoroseobacter shibae DFL 12]
          Length = 242

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 105/200 (52%), Gaps = 20/200 (10%)

Query: 52  KNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK 111
           +  D   +  SLW  +  +L  D RA   GDILTV I IDD+A   N + RSR+ S    
Sbjct: 50  RTIDRAPERASLWSGTRNSLLGDRRAGQNGDILTVVIEIDDRAEISNSSERSRSGSETLA 109

Query: 112 LSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSIS-------------RAEKLNLLIAAIV 158
           +   F L  +  P++         GAS G                  R EKL L +AA V
Sbjct: 110 IDDFFGLPQRIDPRLPE-------GASLGSAVGVSSNGSSSGDGSVSRREKLTLRVAATV 162

Query: 159 TAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
             ++ NG   I G+QEVRVN E+R L VTG VRP+D+   N ++YDKIA ARISY G+G+
Sbjct: 163 VGVMPNGVFEIQGTQEVRVNFELRELIVTGFVRPEDISRQNEITYDKIASARISYAGRGQ 222

Query: 219 TTELLRPPIGHQLIENLSPL 238
            T++ +P  G Q+ + + P 
Sbjct: 223 ITDVQQPRYGQQIADIILPF 242


>gi|308273546|emb|CBX30148.1| hypothetical protein N47_D29570 [uncultured Desulfobacterium sp.]
          Length = 240

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 99/190 (52%), Gaps = 9/190 (4%)

Query: 58  KKSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS--G 114
           K   SLW +S  + LF D RA  VGD++ V I  D +A  +  T  +R++S + KL   G
Sbjct: 51  KSEGSLWSESEGSFLFPDRRARRVGDLVIVRIVEDPEAELNANTSTNRSSSANAKLEFLG 110

Query: 115 GFSLFGQQTPQMNGNLNYDG------GGASSGKGSISRAEKLNLLIAAIVTAILENGNLI 168
                 Q+ P +  N   D       G    G+GS  R   +   ++A+V  +  NGN++
Sbjct: 111 YMKALAQKNPNLAQNPGTDDLITASLGTKFDGQGSSDRDGHVKAYVSAVVLQVFPNGNML 170

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           ISG +EV+VN E   + ++GIVR +D+   N VS   +AEA+ISY GKG   +  RP   
Sbjct: 171 ISGRREVKVNSETEYITLSGIVRAEDISTANEVSSAYVAEAKISYSGKGPVADKQRPGWL 230

Query: 229 HQLIENLSPL 238
             +I+ + P 
Sbjct: 231 MGVIDYVWPF 240


>gi|255609652|ref|XP_002539077.1| Flagellar L-ring protein precursor, putative [Ricinus communis]
 gi|223508849|gb|EEF23307.1| Flagellar L-ring protein precursor, putative [Ricinus communis]
          Length = 125

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 78/127 (61%), Gaps = 2/127 (1%)

Query: 31  MSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRI 90
           MSP+GS L +  + P +    K      + YSLW DS AALFKD+RALNVGDILTV I+I
Sbjct: 1   MSPIGSGL-QYAQTPQMSQYPKRPHQVAQGYSLWNDSQAALFKDARALNVGDILTVTIKI 59

Query: 91  DDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKL 150
           DD+A +DN+T R+R N      +    +FG Q P  N +       ++  KG + R+E++
Sbjct: 60  DDKANWDNETNRNRTNKSDMNWNITAKIFGWQ-PSTNADATSGSDTSTDAKGKMQRSEQI 118

Query: 151 NLLIAAI 157
           NLL+AA+
Sbjct: 119 NLLVAAV 125


>gi|163733145|ref|ZP_02140589.1| flagellar L-ring protein precursor H [Roseobacter litoralis Och
           149]
 gi|161393680|gb|EDQ18005.1| flagellar L-ring protein precursor H [Roseobacter litoralis Och
           149]
          Length = 158

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 88  IRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL---FGQQTP---QMNGNLNYDGGGASSGK 141
           I ID++A   N T RSR+ S    +   F +     +Q P    ++  ++ +    SSG 
Sbjct: 2   IEIDEEAEISNATDRSRSGSESLGIPNLFGVPQRIDRQLPAGATLSDAVSINSSSNSSGD 61

Query: 142 GSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSV 201
           GS+ R EKL L +AA +  +L NG L I+GSQE+RVN E+R L V+G VRP+D+   N +
Sbjct: 62  GSVKRNEKLTLRVAATIVDVLPNGVLSIAGSQELRVNFEMRELLVSGYVRPEDISRQNEI 121

Query: 202 SYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +YDKIA AR+SYGG+G+ T++ +P  G Q ++ + P
Sbjct: 122 TYDKIATARVSYGGRGQITDVQQPRWGQQALDIVLP 157


>gi|225849137|ref|YP_002729301.1| flagellar L-ring protein FlgH [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644708|gb|ACN99758.1| flagellar L-ring protein FlgH [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 223

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 111/237 (46%), Gaps = 24/237 (10%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           +VL  S+ + GC S   E                 N +P    D      ++ + SL+  
Sbjct: 6   LVLILSAFVIGCASKKDEYA------------KPYNPVP---PDIPQEKVSRTAGSLYTG 50

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF---SLFGQQT 123
           S+  LF DS+A NVGDI+T+ +          QT    N     K+S G    ++ G+Q 
Sbjct: 51  SYNNLFTDSKAFNVGDIITIKVV----ETIAGQTASGTNTQEQSKMSLGVPSPTIMGKQV 106

Query: 124 PQMN--GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
           P       +  +   +  G  S +R+ KL   I+A VT +  NGNL I G + V+VND+ 
Sbjct: 107 PNKTPIAGITENNSDSYKGTASTNRSSKLIATISARVTKVYPNGNLFIVGKKVVKVNDDY 166

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           ++L ++GIV+P D+   NSV   +I++  + Y G+G   +  +P    Q ++ + P 
Sbjct: 167 QTLVISGIVKPTDILQDNSVDSSRISDMYVEYNGEGYIADSTKPGWLAQFLKKIWPF 223


>gi|51246535|ref|YP_066419.1| flagellar L-ring protein precursor (FlgH) [Desulfotalea
           psychrophila LSv54]
 gi|81641310|sp|Q6AJR8|FLGH_DESPS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|50877572|emb|CAG37412.1| related to flagellar L-ring protein precursor (FlgH) [Desulfotalea
           psychrophila LSv54]
          Length = 231

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 113/220 (51%), Gaps = 31/220 (14%)

Query: 11  YSSLLF-----GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           Y S LF     GC+S    +  IP+       L+E   M         S +T+++ SLW 
Sbjct: 9   YLSCLFLLALSGCNSKRPPLVEIPE------PLEELQTM---------SPATRQAGSLWD 53

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
            +  +LF D +A NVGDI+TV I     A  +  T   +++S+   +    +LFG +   
Sbjct: 54  SNQNSLFSDRKASNVGDIVTVLIEEKSSASKNASTKTGKDSSIGASIP---NLFGLEKSS 110

Query: 126 MNGNLNYDGG---GAS-----SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           +  N + D     GAS      G GS SR+  L+  ++  V     NG L I G +EV V
Sbjct: 111 IIANNHIDMNNLIGASFKNDFKGAGSTSRSGTLSAALSTQVIVKYPNGQLKIRGGKEVMV 170

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           N+E++ + +TGI+RP D+ A N+++ DKI  ARISY GKG
Sbjct: 171 NNEVQVIYLTGIIRPVDITAANTINSDKILNARISYTGKG 210


>gi|258404729|ref|YP_003197471.1| flagellar L-ring protein [Desulfohalobium retbaense DSM 5692]
 gi|257796956|gb|ACV67893.1| flagellar L-ring protein [Desulfohalobium retbaense DSM 5692]
          Length = 229

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 78/244 (31%), Positives = 115/244 (47%), Gaps = 21/244 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           MY+Y  IV C  +L  GC          PQ  P  ++       P   +  K   +++ S
Sbjct: 1   MYKY-IIVFCVFALACGCAPKHE-----PQWGPEANA-------PQKVVPQKPQRASQGS 47

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
             LW    A LF D++A   GDI+TV I    QA  D  T   R +S+   ++  F +  
Sbjct: 48  --LWNTGEANLFSDNKAQAPGDIVTVSISEQAQASKDATTDTGRTSSVDAGINNLFGIPN 105

Query: 121 QQTPQMNGNL---NYDGGGASS---GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
            Q    N N+   N  G   ++   G G  SR   L+  IA  V   L NGNL I G + 
Sbjct: 106 SQALLSNPNVDLKNLVGANFNNSFVGSGETSRNANLSATIATQVIEQLPNGNLRIFGRKR 165

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           V VN+E   + ++GIVRP+D+ A N V    + +A I+Y G+G  ++  +P    +LI+N
Sbjct: 166 VMVNNEEEFIGLSGIVRPEDISAQNVVDSSYVLDAEITYTGRGAISDKQKPGWLMRLIDN 225

Query: 235 LSPL 238
           + P 
Sbjct: 226 VWPF 229


>gi|253702430|ref|YP_003023619.1| flagellar L-ring protein [Geobacter sp. M21]
 gi|251777280|gb|ACT19861.1| flagellar L-ring protein [Geobacter sp. M21]
          Length = 229

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/172 (38%), Positives = 96/172 (55%), Gaps = 9/172 (5%)

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           S SLW+DS   L +D +A   GDI+TV I  +  A     TG SR +S+    +G   L 
Sbjct: 48  SGSLWQDSSTGLAEDLKARRRGDIITVVISENASASKKASTGTSRGSSIS---AGIPKLL 104

Query: 120 GQQT------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
           G +T        ++  LN   G    G GS SR E L   I+A V  ++ NGNL+I G +
Sbjct: 105 GLETTGIRNWADLSDLLNASFGSKFDGSGSTSRQETLQATISAKVVDVIPNGNLLIEGRR 164

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            V+VN+E + + +TG VR +DV A N++S   IA+ARI+Y GKG  ++  +P
Sbjct: 165 NVKVNNEDQIIVLTGTVRGRDVSADNTISSALIADARIAYSGKGIISDRQKP 216


>gi|77918758|ref|YP_356573.1| flagellar biosynthesis, basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Pelobacter
           carbinolicus DSM 2380]
 gi|77544841|gb|ABA88403.1| flagellar biosynthesis, basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Pelobacter
           carbinolicus DSM 2380]
          Length = 231

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 66/189 (34%), Positives = 98/189 (51%), Gaps = 19/189 (10%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW +   +LF+D++A  VGDI+TV I     A     T   R++S+   L+  F + G 
Sbjct: 50  SLWTEGRGSLFRDNKARRVGDIVTVAIYEQASASKQASTATGRSSSMSAGLTNLFGIEGN 109

Query: 122 QTPQMNGNLN------------YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
                 GNLN            Y+   A  G GS SR E L   + A V   L NGNL I
Sbjct: 110 I-----GNLNKFIDPTSLIDTSYEN--AFDGSGSTSRKEDLVATLTAQVIEELPNGNLCI 162

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
           +G + V VN E + + + GI+RP+D+ A N VS   I +A+I+Y GKG  ++  RP    
Sbjct: 163 AGGKTVTVNREDQIILLEGIIRPEDISARNVVSSKHILDAKIAYTGKGVISDKQRPGWMT 222

Query: 230 QLIENLSPL 238
           ++++++ P 
Sbjct: 223 RVLDHIWPF 231


>gi|297570289|ref|YP_003691633.1| flagellar L-ring protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296926204|gb|ADH87014.1| flagellar L-ring protein [Desulfurivibrio alkaliphilus AHT2]
          Length = 235

 Score = 95.1 bits (235), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 94/170 (55%), Gaps = 6/170 (3%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL--FGQQTPQMNG 128
           L++D+RA  VGDIL V +        +  T   R++S++  +S  F L  F  +   +N 
Sbjct: 70  LYRDNRAREVGDILLVRVVETSSGRKNATTIAERDSSINAGISSFFGLDNFVGERSSINA 129

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
            +N D      G+G  SR   +   I+A V      GNL+I G QEVRVN+E + + ++G
Sbjct: 130 GINTD----FEGRGRTSRDSDVTATISARVVDKTMEGNLVIRGYQEVRVNNETQFIILSG 185

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +VRP D++A NSV+ D+IA+ARI Y GKG   +  RP    + ++ + P 
Sbjct: 186 LVRPDDINASNSVNSDRIADARIEYSGKGLLADKQRPGWLSRAVQAIWPF 235


>gi|110816534|sp|Q3A5F4|FLGH_PELCD RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 227

 Score = 95.1 bits (235), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 66/189 (34%), Positives = 98/189 (51%), Gaps = 19/189 (10%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW +   +LF+D++A  VGDI+TV I     A     T   R++S+   L+  F + G 
Sbjct: 46  SLWTEGRGSLFRDNKARRVGDIVTVAIYEQASASKQASTATGRSSSMSAGLTNLFGIEGN 105

Query: 122 QTPQMNGNLN------------YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
                 GNLN            Y+   A  G GS SR E L   + A V   L NGNL I
Sbjct: 106 I-----GNLNKFIDPTSLIDTSYEN--AFDGSGSTSRKEDLVATLTAQVIEELPNGNLCI 158

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
           +G + V VN E + + + GI+RP+D+ A N VS   I +A+I+Y GKG  ++  RP    
Sbjct: 159 AGGKTVTVNREDQIILLEGIIRPEDISARNVVSSKHILDAKIAYTGKGVISDKQRPGWMT 218

Query: 230 QLIENLSPL 238
           ++++++ P 
Sbjct: 219 RVLDHIWPF 227


>gi|308050021|ref|YP_003913587.1| flagellar L-ring protein [Ferrimonas balearica DSM 9799]
 gi|307632211|gb|ADN76513.1| flagellar L-ring protein [Ferrimonas balearica DSM 9799]
          Length = 232

 Score = 94.7 bits (234), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 93/174 (53%), Gaps = 6/174 (3%)

Query: 62  SLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+R  +  AL++D RA  VGDILTVD+    QA     T  S+++SL    S GF    
Sbjct: 59  SLYRKGYNLALYQDRRAYRVGDILTVDLEEKTQASKKADTSTSKDSSLQGSGSYGFGSST 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                  G     GG   SG GS S+  +L   I   V+ +L NG L+I G + +R+N  
Sbjct: 119 GSGQAQLG-----GGRDFSGNGSSSQQNQLTGAITVTVSGVLPNGVLVIRGEKWLRLNQG 173

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
              + + G+VRP+DVD  N +S  +IA+ARISYGG+G   ++  P  G +   +
Sbjct: 174 DEYIRLVGLVRPEDVDQANRISSQRIADARISYGGRGTLADVNAPGWGMRFFND 227


>gi|46578930|ref|YP_009738.1| flagellar basal body L-ring protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603469|ref|YP_967869.1| flagellar basal body L-ring protein [Desulfovibrio vulgaris DP4]
 gi|81567114|sp|Q72EQ4|FLGH_DESVH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|166214820|sp|A1VG76|FLGH_DESVV RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|46448342|gb|AAS94997.1| flagellar L-ring protein FlgH [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563698|gb|ABM29442.1| flagellar L-ring protein [Desulfovibrio vulgaris DP4]
 gi|311232788|gb|ADP85642.1| flagellar L-ring protein [Desulfovibrio vulgaris RCH1]
          Length = 238

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 123/255 (48%), Gaps = 34/255 (13%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R +    C   L+ GC+++  + + +P ++P  + ++        G            
Sbjct: 1   MIRKTLAASCAVLLMAGCNAARQQASPLPPVAPPQTYVEPEQAAANPG------------ 48

Query: 61  YSLWRDSHAAL-FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
            S++ D+ A L F DSRA  VGDI+ V I +++    +     S  +S +    G +  F
Sbjct: 49  -SMFNDAEADLMFSDSRARRVGDIVLVKI-VENAKAKNKADTTSERDSTNNYTVGAY--F 104

Query: 120 GQQTPQMNGNLNYDGG-------------GASS---GKGSISRAEKLNLLIAAIVTAILE 163
           GQ +  +N  +N  G              G+ S   GKG   R   +   IAA V  ++ 
Sbjct: 105 GQDSASIN-PMNPVGAFGGKVGTNALLQTGSKSKLDGKGETKRENTVTATIAARVVRVMP 163

Query: 164 NGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELL 223
            G L + G++E RVNDE + + ++G+VR +DV + NSV   ++A++RI+Y GKG   +  
Sbjct: 164 GGLLQVEGARETRVNDETQYIVLSGLVRSRDVASDNSVMSTQLADSRIAYYGKGVLADKQ 223

Query: 224 RPPIGHQLIENLSPL 238
           RP    +L++NL P 
Sbjct: 224 RPGWFSRLMDNLWPF 238


>gi|317051357|ref|YP_004112473.1| flagellar L-ring protein [Desulfurispirillum indicum S5]
 gi|316946441|gb|ADU65917.1| flagellar L-ring protein [Desulfurispirillum indicum S5]
          Length = 221

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 100/186 (53%), Gaps = 5/186 (2%)

Query: 55  DSTKKSYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
           D + ++ SLW D++     F D +A  + DI+TV +     A        SR++S++   
Sbjct: 39  DRSVQNGSLWSDTNVTSIYFLDQKARRINDIITVRVVESSSASNSGNVATSRDSSVNM-- 96

Query: 113 SGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
            G  S+ G++   +N  +  + G + +G G + +A+ +   ++  +  +L NGN+++ G 
Sbjct: 97  -GVTSVLGKERGSLNPAVQANAGNSFAGSGQLQKADNITATVSTRIVKVLNNGNMVLRGK 155

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +E+ +++E + L V+G++RP+D+DA N+V    +A+A+I Y G G      +P  G   +
Sbjct: 156 REIMIDNEKQMLFVSGVIRPEDIDADNTVMSSALADAQIMYTGSGALAASRKPGWGTTFL 215

Query: 233 ENLSPL 238
             + P 
Sbjct: 216 NTIWPF 221


>gi|118581851|ref|YP_903101.1| flagellar L-ring protein [Pelobacter propionicus DSM 2379]
 gi|118504561|gb|ABL01044.1| flagellar L-ring protein [Pelobacter propionicus DSM 2379]
          Length = 225

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 116/235 (49%), Gaps = 21/235 (8%)

Query: 8   VLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS 67
           +L  ++LL GC +  +++          ++ D+  ++P    D+          S+W+ S
Sbjct: 8   ILLATALLSGCVTQTADV--------RTTTFDQ--QLPRPQADYSRG-------SIWQAS 50

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL----FGQQT 123
            A L +D +A   GDI+T+ I     A  + +T  SR+ +++  +     L    F +  
Sbjct: 51  SAGLVEDLKARRKGDIITIVITETANASKEAKTDTSRDTTINAGIPNFLGLENAGFLKNN 110

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
             ++  +N +      G GS SR E LN  I+A V  +L N NL+I G + V+VN+E + 
Sbjct: 111 MDLSKLINANVASEYEGSGSTSRKETLNATISAKVIDVLPNSNLLIEGRRNVKVNNEDQI 170

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           + + G VRP D+   N V+   IA+ARISY GKG  ++   P     +++ L P 
Sbjct: 171 IIIEGTVRPSDIGPDNVVNSIYIADARISYSGKGIISDRQSPGWLMNIVDKLWPF 225


>gi|218778844|ref|YP_002430162.1| flagellar L-ring protein [Desulfatibacillum alkenivorans AK-01]
 gi|218760228|gb|ACL02694.1| Flagellar biosynthesis, basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein
           [Desulfatibacillum alkenivorans AK-01]
          Length = 242

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 97/183 (53%), Gaps = 6/183 (3%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH---RKLSGGFS 117
           SLW D   +  F D RA  VGD++T+ I     A    +T  +R++S+      L+G  +
Sbjct: 60  SLWVDPGGSQFFGDRRARQVGDLVTIRITETPTASLTAKTTTTRDSSVSADVTDLAGYMT 119

Query: 118 LFGQQTPQMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
                   + G+     G   S  G+G+  R+  +   ++  V  ++ NGNL ISGS+ +
Sbjct: 120 WLEAANKNLKGDSLLSAGYKPSFTGQGTNDRSGSVTAYVSGRVVGVMANGNLQISGSRAI 179

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           +VN+E + + ++GIVRP+D+D  N V    IA+ARI Y GKG   +   P  G ++++++
Sbjct: 180 KVNNETQYMTISGIVRPEDIDPSNVVQSTYIADARIEYYGKGVIADKQIPGWGTRVLDHV 239

Query: 236 SPL 238
            P 
Sbjct: 240 WPF 242


>gi|197120121|ref|YP_002140548.1| flagellar L-ring lipoprotein FlgH [Geobacter bemidjiensis Bem]
 gi|197089481|gb|ACH40752.1| flagellar L-ring lipoprotein FlgH [Geobacter bemidjiensis Bem]
          Length = 230

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 93/172 (54%), Gaps = 9/172 (5%)

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           S SLW+ S   L +D +A   GDI+TV I  +  A     TG SR +S+    +G   L 
Sbjct: 49  SGSLWQASSTGLAEDMKARRRGDIITVVISENASASKKASTGTSRGSSIS---AGIPKLL 105

Query: 120 GQQTPQMNGN------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
           G +T  +         LN        G GS SR E L   I+A V  ++ NGNL+I G +
Sbjct: 106 GLETTAIKNWADLSDLLNASFSSKFDGSGSTSRQETLQATISAKVVDVIPNGNLLIEGRR 165

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            V+VN+E + + +TG VR +DV A N++S   IA+A+I+Y GKG  ++  +P
Sbjct: 166 NVKVNNEDQIIILTGTVRGRDVSADNTISSALIADAKIAYSGKGIISDRQKP 217


>gi|291280518|ref|YP_003497353.1| flagellar L-ring protein FlgH [Deferribacter desulfuricans SSM1]
 gi|290755220|dbj|BAI81597.1| flagellar L-ring protein FlgH [Deferribacter desulfuricans SSM1]
          Length = 238

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 122/248 (49%), Gaps = 26/248 (10%)

Query: 2   YRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK-S 60
           +  S I+L +  + +GC   +  +T +P       S D    +     +++   + KK S
Sbjct: 6   FTISLIILSF--MFYGCAKKV--VTEVP-------STDYKKEIE----EYRKYQAQKKPS 50

Query: 61  YSLWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG---- 114
            SLW D  ++   F D +   VGDI+ V I     A   N T  S++ S    ++     
Sbjct: 51  PSLWTDMGNYGTFFLDYKGRKVGDIVIVKIVESSSATNSNTTKTSKSTSYKTGITNLLGL 110

Query: 115 ----GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
               G   F     Q + N++     + +GKG   +++++   IAA V  +L +GNL+I 
Sbjct: 111 PTNLGMKNFLNSGNQFDPNIDASTSNSFNGKGQKQKSDQVTATIAARVIDVLPSGNLVIE 170

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G +E+ V+ E + ++V G++R +D+DA N+V    IA+A+I+Y GKG  +++ +      
Sbjct: 171 GHREIIVDQEKQIISVKGVIRQKDIDATNTVLSTAIADAQITYTGKGMLSDVNKKGWLAN 230

Query: 231 LIENLSPL 238
           +I+ + P 
Sbjct: 231 VIDWVWPF 238


>gi|224370758|ref|YP_002604922.1| FlgH [Desulfobacterium autotrophicum HRM2]
 gi|223693475|gb|ACN16758.1| FlgH [Desulfobacterium autotrophicum HRM2]
          Length = 234

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 69/226 (30%), Positives = 110/226 (48%), Gaps = 9/226 (3%)

Query: 15  LFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR-DSHAALFK 73
           L GC  S +  +    + P G+S D+    P      K +       SLW  DS A  F+
Sbjct: 16  LTGCMGSTTNRSSSGALLPQGTS-DQPVLQP------KYAVVPPSEGSLWTSDSRARFFE 68

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL-NY 132
           D++A  VGD + VDI  +  +  D  T  SR   ++  +S  F +         G L   
Sbjct: 69  DTKASMVGDTVIVDIVENTSSQMDVNTETSRETGVNVGISNLFGVTRGFGATGAGKLVGA 128

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
           D      G+    R+  +   IAA +T IL NGNL + G + ++VN E++ ++V+G++RP
Sbjct: 129 DYSNDFKGEAKNDRSGSITASIAARITEILPNGNLSLFGRRAMKVNGEVQYISVSGVLRP 188

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            D+ A N V    +A++RI Y GKG   +   P  G ++++N+ P 
Sbjct: 189 GDIMADNRVKSTYLADSRIEYSGKGVLADKQNPGWGTRIMDNIWPF 234


>gi|95929876|ref|ZP_01312617.1| flagellar L-ring protein [Desulfuromonas acetoxidans DSM 684]
 gi|95134172|gb|EAT15830.1| flagellar L-ring protein [Desulfuromonas acetoxidans DSM 684]
          Length = 233

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 93/189 (49%), Gaps = 11/189 (5%)

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           K   SLW   + +LF D+RA  VGDILTV I    +A     T   R  S    ++   S
Sbjct: 48  KTPGSLWTTGNGSLFVDNRASRVGDILTVAIYEQAEASKQATTSTGRTTSASADIT---S 104

Query: 118 LFGQQTPQMNGNLNYDGGGASS--------GKGSISRAEKLNLLIAAIVTAILENGNLII 169
           LFG ++   N N N D     S        G GS +R E L   +   V  +L NG L I
Sbjct: 105 LFGLESNLANLNSNIDPANLVSAGYTNDFQGSGSTTRKEDLVATLTTRVVEVLPNGTLRI 164

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
           SGS+ V VN E + ++++GIVR +D+   N +    + +A I Y GKG   +  +P    
Sbjct: 165 SGSKSVTVNHERQLIHLSGIVRQEDITPENLIDSKYVLDANIVYTGKGVIDDKQKPGWLL 224

Query: 230 QLIENLSPL 238
           +L++ ++P 
Sbjct: 225 RLLDTVTPF 233


>gi|157165376|ref|YP_001466900.1| flagellar basal body L-ring protein [Campylobacter concisus 13826]
 gi|112800285|gb|EAT97629.1| flagellar L-ring protein FlgH [Campylobacter concisus 13826]
          Length = 235

 Score = 88.6 bits (218), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 94/186 (50%), Gaps = 11/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG-FSLFG 120
           SL+      LF D +A+NV DI+T  I I + A   +   +S N      L GG F+   
Sbjct: 52  SLFGKGDNPLFSDRKAMNVNDIVT--IVISENASQISSGSKSTNKDSTISLGGGVFTAGA 109

Query: 121 QQTPQMNGNLN--------YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
                +  NLN          GG   +G G+ +R+EK    I+A +  IL NGN  I GS
Sbjct: 110 APLSTVADNLNKYGDIGFKAGGGNKFTGSGTSNRSEKFTATISARIIKILNNGNYFIEGS 169

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +E+ +N E + + V+G++RP D+  +N +    IA+A+I Y  +G   +  + P G +L+
Sbjct: 170 RELLINGEKQIMQVSGVIRPYDISQNNEIDSKYIADAKILYKTEGELDKSTKKPWGTRLM 229

Query: 233 ENLSPL 238
           E + P 
Sbjct: 230 EAIWPF 235


>gi|153951340|ref|YP_001398367.1| flagellar basal body L-ring protein [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|166214818|sp|A7H4D7|FLGH_CAMJD RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|152938786|gb|ABS43527.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 232

 Score = 88.6 bits (218), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 118/246 (47%), Gaps = 22/246 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++   FGC +++      PQ+S    +  E        +  K S++ + +
Sbjct: 1   MKKVLFYVLPFA--FFGCSATVD-----PQISMKPPAYVEE-------LAPKQSNNVESA 46

Query: 61  Y-SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR---KLSGGF 116
             SL+      LF D +A+NV D++TV I+             SR N+ +     L+G  
Sbjct: 47  PGSLFGKGDNPLFSDKKAMNVNDLVTVIIQESTTQSTQANKATSRTNTSNLDGGTLTGSS 106

Query: 117 SLFGQQTPQMNG--NLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
            +      ++N   N+ +    ++  +G GS SR E  N  I+  V  IL NGN  I GS
Sbjct: 107 GVVASALDKVNAYSNIGFQTNSSNNYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGS 166

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++I
Sbjct: 167 RELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVI 226

Query: 233 ENLSPL 238
           E + P 
Sbjct: 227 EAIWPF 232


>gi|223041237|ref|ZP_03611486.1| flagellar L-ring protein FlgH [Campylobacter rectus RM3267]
 gi|222877496|gb|EEF12628.1| flagellar L-ring protein FlgH [Campylobacter rectus RM3267]
          Length = 233

 Score = 88.6 bits (218), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 94/184 (51%), Gaps = 7/184 (3%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK---LSGGFSL 118
           SL+      LF D +A+NV DI+TV I          +   S+N++++      S G + 
Sbjct: 50  SLFGRGDNPLFADRKAMNVNDIVTVVISERANQSSSGKHDTSKNSTINLGGGLFSAGSAP 109

Query: 119 FGQQTPQMN--GNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                 Q+N  GN+ +  G  +  +G GS  RAE     I+A +  +LENGN  I GS+E
Sbjct: 110 LSTLATQLNKVGNIGFSAGTKNEFTGAGSSVRAEAFTTTISARIIKVLENGNYFIEGSRE 169

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + +N E + + ++G++RP D+   N +    IA+A+I Y  +G      R P G +L+E 
Sbjct: 170 LLINGEKQIMQLSGVIRPYDISNANEIDSRYIADAKILYKTEGDLDRATRKPWGTKLMEA 229

Query: 235 LSPL 238
           + P 
Sbjct: 230 IWPF 233


>gi|57236990|ref|YP_178791.1| flagellar basal body L-ring protein [Campylobacter jejuni RM1221]
 gi|157414975|ref|YP_001482231.1| flagellar basal body L-ring protein [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|218562326|ref|YP_002344105.1| flagellar basal body L-ring protein [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|315124190|ref|YP_004066194.1| flagellar L-ring protein precursor [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|14548049|sp|Q9PPM0|FLGH_CAMJE RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|81353802|sp|Q5HV94|FLGH_CAMJR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|172047100|sp|A8FLB7|FLGH_CAMJ8 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|57165794|gb|AAW34573.1| flagellar L-ring protein FlgH [Campylobacter jejuni RM1221]
 gi|112360032|emb|CAL34824.1| putative flagellar L-ring protein precursor [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|157385939|gb|ABV52254.1| putative flagellar L-ring protein precursor [Campylobacter jejuni
           subsp. jejuni 81116]
 gi|307747612|gb|ADN90882.1| Flagellar L-ring protein [Campylobacter jejuni subsp. jejuni M1]
 gi|315017912|gb|ADT66005.1| flagellar L-ring protein precursor [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|315058150|gb|ADT72479.1| Flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           S3]
 gi|315926801|gb|EFV06175.1| flagellar L-ring family protein [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 232

 Score = 88.6 bits (218), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 118/246 (47%), Gaps = 22/246 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++   FGC +++      PQ+S    +  E        +  K S++ + +
Sbjct: 1   MKKVLFYVLPFA--FFGCSATVD-----PQISMKPPAYVEE-------LAPKQSNNVESA 46

Query: 61  Y-SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR---KLSGGF 116
             SL+      LF D +A+NV D++TV I+             SR N+ +     L+G  
Sbjct: 47  PGSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGSS 106

Query: 117 SLFGQQTPQMNG--NLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
            +      ++N   N+ +    ++  +G GS SR E  N  I+  V  IL NGN  I GS
Sbjct: 107 GVVANALNKVNAYSNIGFQTNSSNNYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGS 166

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++I
Sbjct: 167 RELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVI 226

Query: 233 ENLSPL 238
           E + P 
Sbjct: 227 EAIWPF 232


>gi|86153207|ref|ZP_01071411.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|85842933|gb|EAQ60144.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           HB93-13]
          Length = 232

 Score = 88.6 bits (218), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 118/246 (47%), Gaps = 22/246 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL +  + FGC +++      PQ+S    +  E        +  K S++ + +
Sbjct: 1   MKKVLFYVLPF--VFFGCSATVD-----PQISMKPPAYVEE-------LAPKQSNNVESA 46

Query: 61  Y-SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR---KLSGGF 116
             SL+      LF D +A+NV D++TV I+             SR N+ +     L+G  
Sbjct: 47  PGSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGSS 106

Query: 117 SLFGQQTPQMNG--NLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
            +      ++N   N+ +    ++  +G GS SR E  N  I+  V  IL NGN  I GS
Sbjct: 107 GVVANALNKVNAYSNIGFQTNSSNKYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGS 166

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++I
Sbjct: 167 RELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVI 226

Query: 233 ENLSPL 238
           E + P 
Sbjct: 227 EAIWPF 232


>gi|90577347|ref|ZP_01233158.1| flagellar L-ring protein precursor [Vibrio angustum S14]
 gi|90440433|gb|EAS65613.1| flagellar L-ring protein precursor [Vibrio angustum S14]
          Length = 222

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 105/214 (49%), Gaps = 20/214 (9%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
            ++LC+ S + GC  ++ E    P          E N   F   D   S    K  SL+R
Sbjct: 5   LMLLCFLSFVSGC--AVREEFIPP----------EPNDAAFAPPDLDYSLPEAKHGSLYR 52

Query: 66  DSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG-GFSLFGQQT 123
            +++  LF+D RA  VGD+LTV++    Q+     T   +++S+       G   F   +
Sbjct: 53  HNYSMTLFQDRRAYRVGDVLTVELDEQTQSSKKANTKFGKSSSIEFAAPTLGNKTFDDLS 112

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
             ++G+  +DG  AS+      +  KL   I   V  +L NG L+I G + +R+N     
Sbjct: 113 ASVSGDRGFDGTAAST------QGNKLQGAITVTVHKVLPNGVLMIRGEKWIRLNQGDEY 166

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           + +TG+VR  DV+ HN VS  +I +ARI+Y G+G
Sbjct: 167 IRLTGVVRVDDVNRHNQVSSQRIGDARITYSGRG 200


>gi|121612803|ref|YP_001000383.1| flagellar basal body L-ring protein [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167005328|ref|ZP_02271086.1| flagellar basal body L-ring protein [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|283956097|ref|ZP_06373584.1| putative flagellar L-ring protein precursor [Campylobacter jejuni
           subsp. jejuni 1336]
 gi|166214819|sp|A1VZ42|FLGH_CAMJJ RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|87249515|gb|EAQ72475.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|283792417|gb|EFC31199.1| putative flagellar L-ring protein precursor [Campylobacter jejuni
           subsp. jejuni 1336]
          Length = 232

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 118/246 (47%), Gaps = 22/246 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++   FGC +++      PQ+S    +  E        +  K S++ + +
Sbjct: 1   MKKVLFYVLPFA--FFGCSATVD-----PQISMKPPAYVEE-------LAPKQSNNVESA 46

Query: 61  Y-SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR---KLSGGF 116
             SL+      LF D +A+NV D++TV I+             SR N+ +     L+G  
Sbjct: 47  PGSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGSS 106

Query: 117 SLFGQQTPQMNG--NLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
            +      ++N   N+ +    ++  +G GS SR E  N  I+  V  IL NGN  I GS
Sbjct: 107 GVVANALNKVNAYSNIGFQTNSSNKYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGS 166

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++I
Sbjct: 167 RELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVI 226

Query: 233 ENLSPL 238
           E + P 
Sbjct: 227 EAIWPF 232


>gi|154174210|ref|YP_001408222.1| flagellar basal body L-ring protein [Campylobacter curvus 525.92]
 gi|153793061|gb|EAT99529.2| flagellar L-ring protein FlgH [Campylobacter curvus 525.92]
          Length = 235

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 94/187 (50%), Gaps = 13/187 (6%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SL+      LF D +A+NV DI+TV I    +    + TG  +++       GG      
Sbjct: 52  SLFGRGENPLFSDRKAMNVNDIVTVVI---SETATQSSTGSKKSSRDSTTSLGGGVFTAG 108

Query: 122 QTP------QMN--GNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
             P      Q+N   ++ +  GG +   G G+ SR E+    I+A +  IL NGN  I G
Sbjct: 109 AAPLSTVANQLNKYSDIGFKAGGENKFEGSGTTSRNERFTATISARIIKILNNGNYFIEG 168

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           S+E+ VN E + + V+G++RP D+  +N +    IA+A+I Y  +G   +  + P G +L
Sbjct: 169 SREILVNGEKQVIQVSGVIRPYDISQNNQIDSKYIADAKILYKTEGDVDKSTKKPWGTRL 228

Query: 232 IENLSPL 238
           +E + P 
Sbjct: 229 MEAIWPF 235


>gi|86149820|ref|ZP_01068049.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|85839638|gb|EAQ56898.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           CF93-6]
          Length = 232

 Score = 88.2 bits (217), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 118/246 (47%), Gaps = 22/246 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL +  + FGC +++      PQ+S    +  E        +  K S++ + +
Sbjct: 1   MKKVLFYVLPF--VFFGCSATVD-----PQISMKPPAYVEE-------LAPKQSNNIESA 46

Query: 61  Y-SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR---KLSGGF 116
             SL+      LF D +A+NV D++TV I+             SR N+ +     L+G  
Sbjct: 47  PGSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGSS 106

Query: 117 SLFGQQTPQMNG--NLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
            +      ++N   N+ +    ++  +G GS SR E  N  I+  V  IL NGN  I GS
Sbjct: 107 GVVANALNKVNAYSNIGFQTNSSNNYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGS 166

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++I
Sbjct: 167 RELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVI 226

Query: 233 ENLSPL 238
           E + P 
Sbjct: 227 EAIWPF 232


>gi|86151632|ref|ZP_01069846.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|88596875|ref|ZP_01100111.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|148926655|ref|ZP_01810336.1| putative flagellar L-ring protein precursor [Campylobacter jejuni
           subsp. jejuni CG8486]
 gi|85841261|gb|EAQ58509.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|88190564|gb|EAQ94537.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|145845174|gb|EDK22269.1| putative flagellar L-ring protein precursor [Campylobacter jejuni
           subsp. jejuni CG8486]
 gi|284925943|gb|ADC28295.1| flagellar basal body L-ring protein [Campylobacter jejuni subsp.
           jejuni IA3902]
          Length = 232

 Score = 88.2 bits (217), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 118/246 (47%), Gaps = 22/246 (8%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++   FGC +++      PQ+S    +  E        +  K S++ + +
Sbjct: 1   MKKVLFYVLPFA--FFGCSATVD-----PQISMKPPAYVEE-------LAPKQSNNIESA 46

Query: 61  Y-SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR---KLSGGF 116
             SL+      LF D +A+NV D++TV I+             SR N+ +     L+G  
Sbjct: 47  PGSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGSS 106

Query: 117 SLFGQQTPQMNG--NLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
            +      ++N   N+ +    ++  +G GS SR E  N  I+  V  IL NGN  I GS
Sbjct: 107 GVVANALNKVNAYSNIGFQTNSSNNYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGS 166

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++I
Sbjct: 167 RELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVI 226

Query: 233 ENLSPL 238
           E + P 
Sbjct: 227 EAIWPF 232


>gi|218887606|ref|YP_002436927.1| flagellar basal body L-ring protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|226701917|sp|B8DQY1|FLGH_DESVM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|218758560|gb|ACL09459.1| flagellar L-ring protein [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 238

 Score = 88.2 bits (217), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 75/258 (29%), Positives = 121/258 (46%), Gaps = 40/258 (15%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMS-PMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R      C   LL GC+++  + + +P ++ P   +  E              D+   
Sbjct: 1   MKRRLLAAGCAMLLLSGCNAARQQPSPVPPVTQPQAYAEPE--------------DTAAN 46

Query: 60  SYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGF 116
             SL+ +S +  LF D+RA  VGDI+ V +   D+A    D    ++  N L     G  
Sbjct: 47  PGSLYSESDSEFLFSDNRARRVGDIVLVKVVETDKAKNKADTTADKTSTNEL-----GVS 101

Query: 117 SLFGQQTPQMNGNLNYDG------------GGASSGK----GSISRAEKLNLLIAAIVTA 160
           + FGQ +  +N  +N  G            G +S+ K    G   R   +   IAA V  
Sbjct: 102 AFFGQSSASIN-PINPAGPFSGAVGANPILGTSSTSKHSATGETKRESTVTTTIAARVLR 160

Query: 161 ILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTT 220
           +L  G + + G++E RVNDE + + V+G+VR +DV + NSV+  ++A ARI Y GKG   
Sbjct: 161 VLPGGLMEVEGARETRVNDETQYIVVSGLVRARDVSSDNSVTSSQMANARIEYYGKGTLA 220

Query: 221 ELLRPPIGHQLIENLSPL 238
           +  +P    +L++N+ P 
Sbjct: 221 DKQKPGWFTRLMDNVWPF 238


>gi|148266114|ref|YP_001232820.1| flagellar L-ring protein [Geobacter uraniireducens Rf4]
 gi|146399614|gb|ABQ28247.1| flagellar L-ring protein [Geobacter uraniireducens Rf4]
          Length = 229

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 95/185 (51%), Gaps = 11/185 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           S+W+DS +    D +A   GD +TV I     A     TG +R +S+    +G  +L G 
Sbjct: 48  SIWQDSSSGFADDFKARKRGDTVTVVINEQSSASKQATTGTTRGSSIS---AGIPNLLGL 104

Query: 122 QTP--------QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
           +T          +N  ++        G G  +R E LN  I A V  +L NGNL+I G +
Sbjct: 105 ETNVTGIKNWMDLNKLISASFDSKFDGSGKTTRQENLNATITAKVVDVLGNGNLLIEGKR 164

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
            V+VN+E + + +TG VRP+D+ + N V+   +A+ARI+Y GKG  ++  +P     L +
Sbjct: 165 NVKVNNEDQVIVLTGTVRPRDISSDNVVNSIYVADARINYSGKGIISDRQKPGWLMGLFD 224

Query: 234 NLSPL 238
            + P 
Sbjct: 225 TIWPF 229


>gi|302343759|ref|YP_003808288.1| flagellar L-ring protein [Desulfarculus baarsii DSM 2075]
 gi|301640372|gb|ADK85694.1| flagellar L-ring protein [Desulfarculus baarsii DSM 2075]
          Length = 227

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 94/183 (51%), Gaps = 11/183 (6%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SL+  + + +F D RA NVGDI+ V+I  + +A   N T   R +     +S  F  + Q
Sbjct: 50  SLFVATRSDMFTDLRARNVGDIIVVEIVENSKAAKKNDTKAERKSDYDIGVSS-FMGYEQ 108

Query: 122 QTP------QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
             P       +  N N      S  K  +++ + +   I   V  +L NGN+I+ GS+E+
Sbjct: 109 DLPGSDPSKLIGANFN----SKSDAKAQLTKEDTMTSSIGCTVVEVLNNGNMIVKGSREL 164

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           +VN E + + + G VRPQDV + N+V   ++A+A I Y G+G  T+   P    +L++ +
Sbjct: 165 QVNGETQYIVLQGTVRPQDVTSENTVYSTQLADATIHYTGRGVLTDKQTPGWLARLLDQV 224

Query: 236 SPL 238
            P 
Sbjct: 225 WPF 227


>gi|315931885|gb|EFV10840.1| flagellar L-ring family protein [Campylobacter jejuni subsp. jejuni
           327]
          Length = 232

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/257 (29%), Positives = 117/257 (45%), Gaps = 44/257 (17%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++   FGC +++      PQ+S    +  E        +  K S++ + +
Sbjct: 1   MKKVLFYVLPFA--FFGCSATVD-----PQISMKPPAYVEE-------LAPKQSNNVESA 46

Query: 61  Y-SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG---- 115
             SL+      LF D +A+NV D++TV I+             SR N+   KL GG    
Sbjct: 47  PGSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNT--SKLGGGALTG 104

Query: 116 --------------FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAI 161
                         +S  G QT   N + NY      +G GS SR E     I+  V  I
Sbjct: 105 SSGVVANALNKVNAYSNIGFQT---NSSNNY------TGTGSQSRNESFKTTISTRVIKI 155

Query: 162 LENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           L NGN  I GS+E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G    
Sbjct: 156 LSNGNYFIEGSRELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDR 215

Query: 222 LLRPPIGHQLIENLSPL 238
             R P G ++IE + P 
Sbjct: 216 STRKPWGSKVIEAIWPF 232


>gi|222053734|ref|YP_002536096.1| flagellar L-ring protein [Geobacter sp. FRC-32]
 gi|221563023|gb|ACM18995.1| flagellar L-ring protein [Geobacter sp. FRC-32]
          Length = 230

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 96/191 (50%), Gaps = 11/191 (5%)

Query: 43  RMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGR 102
           R P      + +  T  S S+W+DS   + +D +A   GD LTV I     A     TG 
Sbjct: 30  RTPTFDEQMQQAKPTYTSGSIWQDSSTGITEDLKARRRGDTLTVVITEQASASKQATTGT 89

Query: 103 SRNNSLHRKLSGGFSLFGQQTP--------QMNGNLNYDGGGASSGKGSISRAEKLNLLI 154
           SR +++    +G  +L G +T          ++  LN        G G  +R E L   I
Sbjct: 90  SRGSTIS---AGIPNLMGLETNITGISNWMDLSNLLNASYDSKYDGSGKTTREENLRATI 146

Query: 155 AAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYG 214
            A V  ++ NGNL+I G + V+VN+E + + +TG VR +D+ + N V+   IA+ARI+Y 
Sbjct: 147 TAKVIDVIGNGNLLIEGKRNVKVNNEDQIIVLTGTVRTRDISSDNVVNSIYIADARINYS 206

Query: 215 GKGRTTELLRP 225
           GKG  ++  RP
Sbjct: 207 GKGVISDRQRP 217


>gi|46398395|gb|AAS91883.1| flagelle L-ring protein [Legionella pneumophila]
          Length = 230

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 106/231 (45%), Gaps = 35/231 (15%)

Query: 1   MYRYSFIVLCYSS-LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R++    C ++ LLFGC +      G           D  +  P   +     +  K 
Sbjct: 1   MNRFNIATTCLATVLLFGCEALHPPAPG-----------DNPDYAPTYPVTPDPKELRKV 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR-------- 110
           S +++    A  LF+  RA + GDILTV + I+      N T   R N   +        
Sbjct: 50  SGAIYSSETALPLFETPRARHPGDILTVYL-IEKTDAQKNATTTQRKNDTEKITNKLFLG 108

Query: 111 ---KLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
               L  G+S+          + + D     +G+G   +  KL   I+  V  +L NGN+
Sbjct: 109 RPISLGSGYSM----------DFDLDNQRQFNGEGRSIQNNKLAGSISVTVAKVLANGNM 158

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
           ++ G + VR+N     + ++GIVRPQD+ A N+++ D+IA ARISYGG G+
Sbjct: 159 VVQGEKWVRINQGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQ 209


>gi|88911315|sp|Q748F4|FLGH_GEOSL RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|298507076|gb|ADI85799.1| flagellar L-ring lipoprotein FlgH [Geobacter sulfurreducens KN400]
          Length = 226

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 113/248 (45%), Gaps = 32/248 (12%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R +  ++C +  L GC    +E+                 R P      + +  +  +
Sbjct: 1   MKRLAMSIICLA--LAGCAVEKTEV-----------------RTPTFDEQLRPAPPSYAN 41

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK------LSG 114
            S+W+ S   L  D +A + GDI+TV I     A  +  T   R   +         L  
Sbjct: 42  GSIWQASTTGLAVDHKARSRGDIITVLIVEQASASKEATTDTERKAEVSASVPYLMGLEK 101

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
             +LF + T   N N N   G +++    G G+ +R E L   + A +T +L NGN +I 
Sbjct: 102 SSTLFSKLT---NANPNNLLGASTNSKYEGSGATTRKENLLATMTAKITDVLPNGNFLIE 158

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G + V+VN+E + L + G +RP+DV   N++S   IA+ARISY G G  ++  RP     
Sbjct: 159 GRRNVKVNNEDQILVLQGTIRPRDVSPDNTISSTMIADARISYTGNGVISDRQRPGWLMN 218

Query: 231 LIENLSPL 238
           +++ + P 
Sbjct: 219 ILDYIWPF 226


>gi|255322201|ref|ZP_05363347.1| flagellar L-ring protein FlgH [Campylobacter showae RM3277]
 gi|255300574|gb|EET79845.1| flagellar L-ring protein FlgH [Campylobacter showae RM3277]
          Length = 233

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 94/186 (50%), Gaps = 11/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SL+      LF D +A+NV DI+TV I          +   S+N+++   L GG    G 
Sbjct: 50  SLFGRGDNPLFADRKAMNVNDIVTVVISERANQSSSGKHDTSKNSTIS--LGGGIFTAGS 107

Query: 122 Q-----TPQMN--GNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
                   Q+N  G++ +  G  +  +G GS  RAE     I+A +  +LENGN  I GS
Sbjct: 108 APLSTLATQLNKAGDIGFSAGNKNEFTGAGSSVRAEAFTTTISARIIKVLENGNYFIEGS 167

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +E+ +N E + + ++G++RP D+   N +    IA+A+I Y  +G      R P G +L+
Sbjct: 168 RELLINGEKQIMQLSGVIRPYDISNANEIDSRYIADAKILYKTEGDVDRATRKPWGTKLM 227

Query: 233 ENLSPL 238
           E + P 
Sbjct: 228 EAIWPF 233


>gi|302037630|ref|YP_003797952.1| flagellar L-ring protein FlgH [Candidatus Nitrospira defluvii]
 gi|300605694|emb|CBK42027.1| Flagellar L-ring protein FlgH [Candidatus Nitrospira defluvii]
          Length = 238

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 98/186 (52%), Gaps = 9/186 (4%)

Query: 62  SLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG-GFSL 118
           SLW++ +  A L++D RA+ +GDI+T+ I    +      T   R++++   + G G   
Sbjct: 53  SLWQEENGRAYLYEDLRAMRIGDIITILIVEKHKGSKSADTNAERDSTISNGIGGTGMGY 112

Query: 119 FGQQTPQMNGN----LNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
            G    ++ G        D    S   GKG+ +R + L   I+AIVT +L NG+L + G 
Sbjct: 113 LGIPGIRLGGEAKRGFGVDATAKSKFGGKGATNREDTLTGTISAIVTEVLPNGDLRVEGR 172

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +EV VN E + + + GIVR  DV+  N+V    IA+A+I Y G G   ++ RP    +++
Sbjct: 173 REVTVNSERQIMTIGGIVRRVDVNTKNTVQSSAIADAKIEYSGLGVVDDVQRPGWLVRIL 232

Query: 233 ENLSPL 238
           + + P 
Sbjct: 233 DWVYPF 238


>gi|46398379|gb|AAS91875.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398381|gb|AAS91876.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398391|gb|AAS91881.1| flagelle L-ring protein [Legionella pneumophila]
          Length = 230

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 106/231 (45%), Gaps = 35/231 (15%)

Query: 1   MYRYSFIVLCYSS-LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R +  V C ++ LLFGC +      G           D  +  P   +     +  K 
Sbjct: 1   MNRLNIAVSCLATALLFGCEALHPPAPG-----------DNPDYAPTYPVTPDPKELRKV 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR-------- 110
           S +++    A  LF+  RA + GDILTV + I+      N T   R N   +        
Sbjct: 50  SGAIYSSETALPLFETPRARHPGDILTVFL-IEKTDAQKNATTTQRKNDTTKITNKLFLG 108

Query: 111 ---KLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
               L  G+S+          + + D     +G+G   +  KL   I+  V  +L NGN+
Sbjct: 109 RPISLGSGYSM----------DFDLDNQRQFNGEGRSIQNNKLAGSISVTVAKVLANGNM 158

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
           II G + VR+N     + ++GIVRPQD+ A N+++ D+IA ARISYGG G+
Sbjct: 159 IIQGEKWVRINQGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQ 209


>gi|268679671|ref|YP_003304102.1| flagellar L-ring protein [Sulfurospirillum deleyianum DSM 6946]
 gi|268617702|gb|ACZ12067.1| flagellar L-ring protein [Sulfurospirillum deleyianum DSM 6946]
          Length = 237

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 93/187 (49%), Gaps = 10/187 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS--LHRKLSGGFSLF 119
           SL+      LF D +A++V DI+T+ I          +   S+ +S  L+  +  G    
Sbjct: 51  SLFGQGDNPLFADLKAMHVNDIVTITITEQTVQTSSGKKALSKESSSDLNAGVIAGVPFG 110

Query: 120 G------QQTPQMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
           G       +    + NL ++ G  +S  G GS SR E     I+A +  +L NGN  I G
Sbjct: 111 GVVGNVADKIATKSANLGFNAGSTNSFTGTGSTSRNESFTTTISARIIKVLNNGNYFIEG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           S+E+ +N E + + V+G++RP D+D +N++    IA+A+I Y  +G   +    P G + 
Sbjct: 171 SRELLINGEKQLIQVSGVIRPYDIDQYNNIDSKYIADAKILYKTEGDIDQTTTKPWGSKF 230

Query: 232 IENLSPL 238
           +E + P 
Sbjct: 231 METIWPF 237


>gi|46398401|gb|AAS91886.1| flagelle L-ring protein [Legionella pneumophila]
          Length = 230

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 106/231 (45%), Gaps = 35/231 (15%)

Query: 1   MYRYSFIVLCYSS-LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R +  V C ++ LLFGC +      G           D  +  P   +     +  K 
Sbjct: 1   MNRLNIAVSCLATALLFGCEALHPPAPG-----------DNPDYAPTYPVTPDPKELRKA 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR-------- 110
           S +++    A  LF+  RA + GDILTV + I+      N T   R N   +        
Sbjct: 50  SGAIYSSETALPLFETPRARHPGDILTVYL-IEKTDAQKNATTTQRKNDTTKITNKLFLG 108

Query: 111 ---KLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
               L  G+S+          + + D     +G+G   +  KL   I+  V  +L NGN+
Sbjct: 109 RPISLGSGYSM----------DFDLDNQRQFNGEGRSIQNNKLAGSISVTVAKVLANGNM 158

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
           ++ G + VR+N     + ++GIVRPQD+ A N+++ D+IA ARISYGG G+
Sbjct: 159 VVQGEKWVRINQGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQ 209


>gi|222823644|ref|YP_002575218.1| flagellar L-ring protein FlgH [Campylobacter lari RM2100]
 gi|222538866|gb|ACM63967.1| flagellar L-ring protein FlgH [Campylobacter lari RM2100]
          Length = 233

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 96/195 (49%), Gaps = 10/195 (5%)

Query: 52  KNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK 111
           +N+++     SL+      LF D +A+NV D++TV IR +           S+NN+++  
Sbjct: 41  QNNNTQSNPGSLFGKGDNPLFSDKKAMNVNDLVTVVIRENATQNSQGSKATSKNNNVN-- 98

Query: 112 LSGGFSLFGQQTPQMNG------NLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILE 163
           L GG    G    +         N+ Y     S   G GS +R+E     I+A V  +L 
Sbjct: 99  LGGGQVTTGAGLSKARDFINDYTNIGYTTASTSQYQGTGSQTRSENFQTTISARVIKVLS 158

Query: 164 NGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELL 223
           NGN  I GS+E+ +N E + + ++G++RP D+   N +    IA+A+I Y  +G   +  
Sbjct: 159 NGNYFIEGSRELLINGEKQIIQLSGVIRPYDISQDNMIDSKYIADAKILYKTEGDIDKST 218

Query: 224 RPPIGHQLIENLSPL 238
           R P G + +E + P 
Sbjct: 219 RKPWGTKFMETIWPF 233


>gi|283953947|ref|ZP_06371476.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           414]
 gi|283794552|gb|EFC33292.1| flagellar L-ring protein FlgH [Campylobacter jejuni subsp. jejuni
           414]
          Length = 232

 Score = 85.9 bits (211), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 114/255 (44%), Gaps = 40/255 (15%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++   FGC +++      PQ+S    +  E        +  K S++ + +
Sbjct: 1   MKKVLFYVLPFA--FFGCSATVD-----PQISMKPPAYVEE-------LAPKQSNNVESA 46

Query: 61  Y-SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS------ 113
             SL+      LF D +A+NV D++TV I+             SR N+ +          
Sbjct: 47  PGSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGTLTGSS 106

Query: 114 ----------GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILE 163
                       +S  G QT   N   NY      +G GS SR E  N  I+  V  IL 
Sbjct: 107 GLVANALNKVNAYSNIGFQTNSTN---NY------TGTGSQSRNESFNTTISTRVIKILS 157

Query: 164 NGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELL 223
           NGN  I GS+E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      
Sbjct: 158 NGNYFIEGSRELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRST 217

Query: 224 RPPIGHQLIENLSPL 238
           R P G ++IE + P 
Sbjct: 218 RKPWGSKVIEAIWPF 232


>gi|52841454|ref|YP_095253.1| flagellar basal body L-ring protein [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|148358809|ref|YP_001250016.1| flagellar L-ring protein FlgH [Legionella pneumophila str. Corby]
 gi|296106854|ref|YP_003618554.1| flagellar L-ring protein precursor FlgH [Legionella pneumophila
           2300/99 Alcoy]
 gi|81377650|sp|Q5ZW65|FLGH_LEGPH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|166214822|sp|A5IBC0|FLGH_LEGPC RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|46398375|gb|AAS91873.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398377|gb|AAS91874.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398385|gb|AAS91878.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398393|gb|AAS91882.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398397|gb|AAS91884.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398399|gb|AAS91885.1| flagelle L-ring protein [Legionella pneumophila]
 gi|52628565|gb|AAU27306.1| flagellar L-ring protein FlgH [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|148280582|gb|ABQ54670.1| flagellar L-ring protein FlgH [Legionella pneumophila str. Corby]
 gi|295648755|gb|ADG24602.1| flagellar L-ring protein precursor FlgH [Legionella pneumophila
           2300/99 Alcoy]
          Length = 230

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 106/231 (45%), Gaps = 35/231 (15%)

Query: 1   MYRYSFIVLCYSS-LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R +  V C ++ LLFGC +      G           D  +  P   +     +  K 
Sbjct: 1   MNRLNIAVSCLATALLFGCEALHPPAPG-----------DNPDYAPTYPVTPDPKELRKV 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR-------- 110
           S +++    A  LF+  RA + GDILTV + I+      N T   R N   +        
Sbjct: 50  SGAIYSSETALPLFETPRARHPGDILTVYL-IEKTDAQKNATTTQRKNDTTKITNKLFLG 108

Query: 111 ---KLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
               L  G+S+          + + D     +G+G   +  KL   I+  V  +L NGN+
Sbjct: 109 RPISLGSGYSM----------DFDLDNQRQFNGEGRSIQNNKLAGSISVTVAKVLANGNM 158

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
           ++ G + VR+N     + ++GIVRPQD+ A N+++ D+IA ARISYGG G+
Sbjct: 159 VVQGEKWVRINQGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQ 209


>gi|54294166|ref|YP_126581.1| flagellar basal body L-ring protein [Legionella pneumophila str.
           Lens]
 gi|54297185|ref|YP_123554.1| flagellar basal body L-ring protein [Legionella pneumophila str.
           Paris]
 gi|81368773|sp|Q5WX68|FLGH_LEGPL RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|81370716|sp|Q5X5U0|FLGH_LEGPA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|46398383|gb|AAS91877.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398387|gb|AAS91879.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398389|gb|AAS91880.1| flagelle L-ring protein [Legionella pneumophila]
 gi|46398403|gb|AAS91887.1| flagelle L-ring protein [Legionella pneumophila]
 gi|53750970|emb|CAH12381.1| flagellar L-ring protein precursor FlgH [Legionella pneumophila
           str. Paris]
 gi|53753998|emb|CAH15469.1| flagellar L-ring protein precursor FlgH [Legionella pneumophila
           str. Lens]
 gi|307609980|emb|CBW99509.1| flagellar L-ring protein precursor FlgH [Legionella pneumophila
           130b]
          Length = 230

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 106/231 (45%), Gaps = 35/231 (15%)

Query: 1   MYRYSFIVLCYSS-LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R +  V C ++ LLFGC +      G           D  +  P   +     +  K 
Sbjct: 1   MNRLNIAVSCLATALLFGCEALHPPAPG-----------DNPDYAPTYPVTPDPKELRKV 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR-------- 110
           S +++    A  LF+  RA + GDILTV + I+      N T   R N   +        
Sbjct: 50  SGAIYSSETALPLFETPRARHPGDILTVFL-IEKTDAQKNATTTQRKNDTTKITNKLFLG 108

Query: 111 ---KLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
               L  G+S+          + + D     +G+G   +  KL   I+  V  +L NGN+
Sbjct: 109 RPISLGSGYSM----------DFDLDNQRQFNGEGRSIQNNKLAGSISVTVAKVLANGNM 158

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
           ++ G + VR+N     + ++GIVRPQD+ A N+++ D+IA ARISYGG G+
Sbjct: 159 VVQGEKWVRINQGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQ 209


>gi|85859198|ref|YP_461400.1| flagellar L-ring protein [Syntrophus aciditrophicus SB]
 gi|85722289|gb|ABC77232.1| flagellar L-ring protein [Syntrophus aciditrophicus SB]
          Length = 238

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 99/187 (52%), Gaps = 13/187 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           S+W    A+  LF D +A  + DI+T+ I    Q      T  SR++      +G  + +
Sbjct: 55  SIWPGESASNMLFADKKARYINDIVTILINEASQGGNKATTNTSRDSD---SAAGIDAFW 111

Query: 120 GQQTPQMNGNLNYDG----GGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
           G     ++ N+N       GG+SS    G G+ +R  +L   + A V  +L+NGNL+I G
Sbjct: 112 GLDQSILSRNVNMGSKIKIGGSSSSTLKGTGNTTRGGQLKGTVTARVVRVLDNGNLVIEG 171

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            +++ +N+E + L ++GI+RP+D+   N +    IA+ARI Y GKG   + +RP    ++
Sbjct: 172 RRQLTINEEDQYLIISGIIRPEDITTENCIFSQYIADARIVYAGKGIINDKMRPGWATRI 231

Query: 232 IENLSPL 238
           ++ + P 
Sbjct: 232 VDWVWPF 238


>gi|108868295|sp|Q2LT21|FLGH_SYNAS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 232

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 99/187 (52%), Gaps = 13/187 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           S+W    A+  LF D +A  + DI+T+ I    Q      T  SR++      +G  + +
Sbjct: 49  SIWPGESASNMLFADKKARYINDIVTILINEASQGGNKATTNTSRDSD---SAAGIDAFW 105

Query: 120 GQQTPQMNGNLNYDG----GGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
           G     ++ N+N       GG+SS    G G+ +R  +L   + A V  +L+NGNL+I G
Sbjct: 106 GLDQSILSRNVNMGSKIKIGGSSSSTLKGTGNTTRGGQLKGTVTARVVRVLDNGNLVIEG 165

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            +++ +N+E + L ++GI+RP+D+   N +    IA+ARI Y GKG   + +RP    ++
Sbjct: 166 RRQLTINEEDQYLIISGIIRPEDITTENCIFSQYIADARIVYAGKGIINDKMRPGWATRI 225

Query: 232 IENLSPL 238
           ++ + P 
Sbjct: 226 VDWVWPF 232


>gi|120597308|ref|YP_961882.1| flagellar basal body L-ring protein [Shewanella sp. W3-18-1]
 gi|120557401|gb|ABM23328.1| flagellar L-ring protein [Shewanella sp. W3-18-1]
          Length = 220

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 106/215 (49%), Gaps = 19/215 (8%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
           +   +LC++ LL GC S I +    P                   ID+   D+  K  SL
Sbjct: 2   HWLWLLCFA-LLSGCMSHIPDQETKPGTKEWAPP----------EIDYSLPDA--KDGSL 48

Query: 64  WRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
           +R  +   LFKD RA   GDILTV +   D+  + ++   ++ N       G     G++
Sbjct: 49  YRPGYMLTLFKDKRAFREGDILTVAL---DEKTYSSKKADTKTNKEQDIGMGLKGNIGEK 105

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           T   +G  ++  G   +G GS ++  +L+  I   V+ +L NG L+I G + +R+N    
Sbjct: 106 TADADGKTSFSRG--FNGAGSSTQQNQLSGSITVTVSKVLPNGTLLIRGEKWLRLNQGDE 163

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            L + GI+R  D+  +N++S  +IA+ARI YGG+G
Sbjct: 164 YLRLLGIIRTDDIGNNNTISSQRIADARIIYGGQG 198


>gi|57167699|ref|ZP_00366839.1| flagellar L-ring protein FlgH [Campylobacter coli RM2228]
 gi|57020821|gb|EAL57485.1| flagellar L-ring protein FlgH [Campylobacter coli RM2228]
          Length = 232

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 112/255 (43%), Gaps = 40/255 (15%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++   FGC +++      PQ+S    +  E        +  K S++ + S
Sbjct: 1   MKKVLFYVLPFA--FFGCSATVD-----PQISMKPPAYVEE-------LAPKQSNNVETS 46

Query: 61  Y-SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS------ 113
             SL+      LF D +A+NV D++TV I+             SR N+ +          
Sbjct: 47  PGSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGGS 106

Query: 114 ----------GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILE 163
                       +S  G QT   N   NY G G  S      R E  N  I+  V  IL 
Sbjct: 107 GLLGTAIDKVNAYSNIGFQTNSTN---NYQGTGTQS------RNESFNTTISTRVIKILS 157

Query: 164 NGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELL 223
           NGN  I GS+E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      
Sbjct: 158 NGNYFIEGSRELLINGEKQIIQLSGVIRPYDIGQDNTIDSRYIADAKILYKTEGEVDRST 217

Query: 224 RPPIGHQLIENLSPL 238
           R P G ++IE + P 
Sbjct: 218 RKPWGSKVIEAIWPF 232


>gi|118474322|ref|YP_891989.1| flagellar basal body L-ring protein [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118413548|gb|ABK81968.1| flagellar L-ring protein FlgH [Campylobacter fetus subsp. fetus
           82-40]
          Length = 234

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 97/188 (51%), Gaps = 14/188 (7%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG------ 115
           SL+      LF D +A+NV DI+TV I+  + A   ++  ++        LSGG      
Sbjct: 50  SLFGRGDNPLFSDRKAMNVNDIVTVVIQ--ETANQTSKADKTTKKDSTTSLSGGTFTTPS 107

Query: 116 ---FSLFGQQTPQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
               S       +++G + +  GGA+  SG G+ +R E  N  ++A +  IL NGN  I 
Sbjct: 108 NSALSGIANDINKISG-IGFSAGGANNYSGSGTSTRNETFNTTVSARIIKILNNGNYFIE 166

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           GS+E+ +N+E + + ++G++RP D+  +N +    I++A+I Y  +G        P G +
Sbjct: 167 GSKEILINNEKQIMQISGVIRPYDISQNNQIESRYISDAKILYKTEGDLQRATSKPWGTK 226

Query: 231 LIENLSPL 238
           ++E + P 
Sbjct: 227 VLETIWPF 234


>gi|319790432|ref|YP_004152065.1| flagellar L-ring protein [Thermovibrio ammonificans HB-1]
 gi|317114934|gb|ADU97424.1| flagellar L-ring protein [Thermovibrio ammonificans HB-1]
          Length = 231

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 94/181 (51%), Gaps = 17/181 (9%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGR-SRNNSLHRKLSGGFS-----LFGQ 121
           ++ LF D +A  VGD++T+        V++N +G  S  N   +K S   S     LFG+
Sbjct: 58  YSNLFSDPKAHKVGDVVTI-------TVYENLSGSGSVQNDTSKKSSYNLSVSKPILFGR 110

Query: 122 QTPQMNGN--LNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
             P  + +  + +    + S  GKGS SR+ KL   I+A V  +  NG+L I G + V++
Sbjct: 111 PFPGRSKDPLVGFSTAPSKSFAGKGSTSRSAKLIATISARVVKVYPNGDLYIVGKKVVKI 170

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           ND+   L ++GIVRP+D+   N+V   KIA+  + Y GKG   +  RP    + +  + P
Sbjct: 171 NDDEEVLRISGIVRPEDIGPDNTVPSSKIADMYVEYNGKGYFNQESRPGWLARFLAKIWP 230

Query: 238 L 238
            
Sbjct: 231 F 231


>gi|305433205|ref|ZP_07402361.1| flagellar L-ring protein FlgH [Campylobacter coli JV20]
 gi|304443906|gb|EFM36563.1| flagellar L-ring protein FlgH [Campylobacter coli JV20]
          Length = 232

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 112/255 (43%), Gaps = 40/255 (15%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M +  F VL ++   FGC +++      PQ+S    +  E        +  K S++ + S
Sbjct: 1   MKKVLFYVLPFA--FFGCSATVD-----PQISMKPPAYVEE-------LAPKQSNNVETS 46

Query: 61  Y-SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS------ 113
             SL+      LF D +A+NV D++TV I+             SR N+ +          
Sbjct: 47  PGSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGGS 106

Query: 114 ----------GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILE 163
                       +S  G QT   N   NY G G  S      R E  N  I+  V  IL 
Sbjct: 107 GLLGTAIDKVNAYSNIGFQTNSAN---NYQGTGTQS------RNESFNTTISTRVIKILS 157

Query: 164 NGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELL 223
           NGN  I GS+E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G      
Sbjct: 158 NGNYFIEGSRELLINGEKQIIQLSGVIRPYDIGQDNTIDSRYIADAKILYKTEGEVDRST 217

Query: 224 RPPIGHQLIENLSPL 238
           R P G ++IE + P 
Sbjct: 218 RKPWGSKVIEAIWPF 232


>gi|146294547|ref|YP_001184971.1| flagellar basal body L-ring protein [Shewanella putrefaciens CN-32]
 gi|145566237|gb|ABP77172.1| flagellar L-ring protein [Shewanella putrefaciens CN-32]
          Length = 220

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 106/215 (49%), Gaps = 19/215 (8%)

Query: 4   YSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSL 63
           +   +LC++ LL GC S I +    P                   ID+   D+  K  SL
Sbjct: 2   HWLWLLCFA-LLSGCMSHIPDQETKPGTKEWAPP----------EIDYSLPDA--KDGSL 48

Query: 64  WRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
           +R  +   LFKD RA   GDILTV +   D+  + ++   ++ N       G     G++
Sbjct: 49  YRPGYMLTLFKDKRAFREGDILTVAL---DEKTYSSKKADTKTNKEQDIGMGLKGNVGEK 105

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           T   +G  ++  G   +G GS ++  +L+  I   V+ +L NG L+I G + +R+N    
Sbjct: 106 TADADGKTSFSRG--FNGAGSSTQQNQLSGSITVTVSKVLPNGTLLIRGEKWLRLNQGDE 163

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            L + GI+R  D+  +N++S  +IA+ARI YGG+G
Sbjct: 164 YLRLLGIIRTDDIGNNNTISSQRIADARIIYGGQG 198


>gi|255021357|ref|ZP_05293405.1| Flagellar L-ring protein FlgH [Acidithiobacillus caldus ATCC 51756]
 gi|254969220|gb|EET26734.1| Flagellar L-ring protein FlgH [Acidithiobacillus caldus ATCC 51756]
          Length = 245

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 94/182 (51%), Gaps = 5/182 (2%)

Query: 62  SLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
           ++W+D ++ +LF D+RA  VGD++TV I+ +  A  +  T  + ++SL   L+  F +  
Sbjct: 64  AIWQDGTNVSLFSDNRANRVGDLITVLIQENSSASNNTNTAINTSDSLSAALTNFFGITP 123

Query: 119 -FGQQTPQ-MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            FG    +  + ++    G    G G+ +++      + A V  ++ NGNL+I GS+EV 
Sbjct: 124 AFGSVAGKAFSPSMGATSGQKYGGTGATTQSNTFTATLEATVVRVMGNGNLVIEGSKEVM 183

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     + V G+VR  DV   N+V   +IA+AR+ Y G G      R P   +   +L 
Sbjct: 184 LNGGHEFIRVAGVVRAADVTPQNTVYSTQIADARVEYSGDGTIYSAARMPWLARFFLSLW 243

Query: 237 PL 238
           P 
Sbjct: 244 PF 245


>gi|89072312|ref|ZP_01158891.1| flagellar L-ring protein precursor [Photobacterium sp. SKA34]
 gi|89051844|gb|EAR57296.1| flagellar L-ring protein precursor [Photobacterium sp. SKA34]
          Length = 222

 Score = 84.7 bits (208), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 92/180 (51%), Gaps = 8/180 (4%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDN 98
           E N   F   D   S    K  SL+R +++  LF+D RA  VGD+LTV++    Q+    
Sbjct: 27  EPNDAAFAPPDLDYSLPEAKHGSLYRHNYSMTLFQDRRAYRVGDVLTVELDEQTQSSKKA 86

Query: 99  QTGRSRNNSLHRKLSG-GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
            T   +++S+       G   F   +  ++G+  +DG  AS+      +  KL   I   
Sbjct: 87  NTKFGKSSSIEFAAPTLGNKTFDDLSASVSGDRGFDGTAAST------QGNKLQGAITVT 140

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NG L+I G + +R+N     + +TG+VR  DV+ HN VS  +I +ARI+Y G+G
Sbjct: 141 VHKVLPNGVLMIRGEKWIRLNQGDEYIRLTGVVRVDDVNRHNQVSSQRIGDARITYSGRG 200


>gi|315638552|ref|ZP_07893728.1| flagellar L-ring protein FlgH [Campylobacter upsaliensis JV21]
 gi|315481396|gb|EFU72024.1| flagellar L-ring protein FlgH [Campylobacter upsaliensis JV21]
          Length = 232

 Score = 84.7 bits (208), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 93/196 (47%), Gaps = 31/196 (15%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDD-QAVFDNQTGRSRNNSLHRKLSGG----- 115
           SL+      LF D +A+NV D++TV I+    Q+   N+T    NN+    L GG     
Sbjct: 49  SLFGKGDNPLFSDKKAMNVNDLVTVIIQESTTQSTQANKTTSRTNNA---NLGGGALVGS 105

Query: 116 -------------FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAIL 162
                        +S  G QT   N   NY      +G G+ SR E  N  I+  V  IL
Sbjct: 106 TGAVNQVLNKVNSYSNIGFQTNSTN---NY------TGTGTQSRNESFNTTISTRVIKIL 156

Query: 163 ENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
            NGN  I GS+E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G     
Sbjct: 157 SNGNYFIEGSRELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRS 216

Query: 223 LRPPIGHQLIENLSPL 238
            R P G + IE + P 
Sbjct: 217 TRKPWGSKFIEAVWPF 232


>gi|261885251|ref|ZP_06009290.1| flagellar basal body L-ring protein [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 208

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 97/188 (51%), Gaps = 14/188 (7%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG------ 115
           SL+      LF D +A+NV DI+TV I+  + A   ++  ++        LSGG      
Sbjct: 24  SLFGRGDNPLFSDRKAMNVNDIVTVVIQ--ETANQTSKADKTTKKDSTTSLSGGTFTTPA 81

Query: 116 ---FSLFGQQTPQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
               S       +++G + +  GGA+  SG G+ +R E  N  ++A +  IL NGN  I 
Sbjct: 82  NSALSGIANDINKISG-IGFSAGGANNYSGSGTSTRNETFNTTVSARIIKILNNGNYFIE 140

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           GS+E+ +N+E + + ++G++RP D+  +N +    I++A+I Y  +G        P G +
Sbjct: 141 GSKEILINNEKQIMQISGVIRPYDISQNNQIESRYISDAKILYKTEGDLQRATSKPWGTK 200

Query: 231 LIENLSPL 238
           ++E + P 
Sbjct: 201 VLETIWPF 208


>gi|57242591|ref|ZP_00370528.1| flagellar L-ring protein FlgH [Campylobacter upsaliensis RM3195]
 gi|57016520|gb|EAL53304.1| flagellar L-ring protein FlgH [Campylobacter upsaliensis RM3195]
          Length = 232

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 93/196 (47%), Gaps = 31/196 (15%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIR-IDDQAVFDNQTGRSRNNSLHRKLSGG----- 115
           SL+      LF D +A+NV D++TV I+    Q+   N+T    NN+    L GG     
Sbjct: 49  SLFGKGDNPLFSDKKAMNVNDLVTVIIQESTTQSTQANKTTSRTNNA---NLGGGALVGS 105

Query: 116 -------------FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAIL 162
                        +S  G QT   N   NY      +G G+ SR E  N  I+  V  IL
Sbjct: 106 TGAVNQVLNRVNSYSNIGFQTNSTN---NY------TGTGTQSRNESFNTTISTRVIKIL 156

Query: 163 ENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
            NGN  I GS+E+ +N E + + ++G++RP D+   N++    IA+A+I Y  +G     
Sbjct: 157 SNGNYFIEGSRELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRS 216

Query: 223 LRPPIGHQLIENLSPL 238
            R P G + IE + P 
Sbjct: 217 TRKPWGSKFIEAVWPF 232


>gi|315930292|gb|EFV09394.1| flagellar L-ring family protein [Campylobacter jejuni subsp. jejuni
           305]
          Length = 207

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 92/184 (50%), Gaps = 7/184 (3%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR---KLSGGFSL 118
           SL+      LF D +A+NV D++TV I+             SR N+ +     L+G   +
Sbjct: 24  SLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGSSGV 83

Query: 119 FGQQTPQMNG--NLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                 ++N   N+ +    ++  +G GS SR E  N  I+  V  IL NGN  I GS+E
Sbjct: 84  VANALNKVNAYSNIGFQTNSSNNYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGSRE 143

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++IE 
Sbjct: 144 LLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGSKVIEA 203

Query: 235 LSPL 238
           + P 
Sbjct: 204 IWPF 207


>gi|114777907|ref|ZP_01452821.1| hypothetical protein SPV1_05779 [Mariprofundus ferrooxydans PV-1]
 gi|114551694|gb|EAU54246.1| hypothetical protein SPV1_05779 [Mariprofundus ferrooxydans PV-1]
          Length = 231

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 114/241 (47%), Gaps = 18/241 (7%)

Query: 3   RYSFIVLCYSSLLFG-CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           R +  +LC + ++ G C   + ++    Q   +  +L               S+ T  S 
Sbjct: 4   RTAICLLCIAPVILGGCMPRVDKVADAQQKQVVNQAL------------ATPSEDTSSSG 51

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQA---VFDNQTGRS-RNNSLHRKLSGGFS 117
           SLW    A L  DS+A  VGD++TV +     A   +   Q+ +S R+  L   +  G +
Sbjct: 52  SLWAGGGAGLISDSKASRVGDLVTVLVSESASATRSLGSKQSKKSARDTGLTANIKYGGA 111

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           L G      +G++      +  G GS + ++ L   + ++VT +  NGN+ I G +++ +
Sbjct: 112 L-GNADVNPSGSIGMTNSKSFDGSGSTNSSDTLTASVTSVVTTVYPNGNMRIIGKRQLVI 170

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N E + +  +G++RP D+   N+++  K+A+A ISYGG G   +        + ++N+ P
Sbjct: 171 NHEPQEITFSGVIRPVDIAPDNTITSAKVAQADISYGGTGSLADTAHEGWLSKTLDNIWP 230

Query: 238 L 238
            
Sbjct: 231 F 231


>gi|46398373|gb|AAS91872.1| flagelle L-ring protein [Legionella pneumophila]
          Length = 230

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 106/231 (45%), Gaps = 35/231 (15%)

Query: 1   MYRYSFIVLCYSS-LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R +  V C ++ LLFGC +      G           D  +  P   +     +  K 
Sbjct: 1   MNRLNIAVSCLATALLFGCEALHPPAPG-----------DNPDYAPTYPVTPDPKELRKV 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR-------- 110
           S +++    A  LF+  +A + GDILTV + I+      N T   R N   +        
Sbjct: 50  SGAIYSSETALPLFETPKARHPGDILTVFL-IEKTDAQKNATTTQRKNDTTKITNKLFLG 108

Query: 111 ---KLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
               L  G+S+          + + D     +G+G   +  KL   I+  V  +L NGN+
Sbjct: 109 RPISLGSGYSM----------DFDLDNQRQFNGEGRSIQNNKLAGSISVTVAKVLANGNM 158

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
           ++ G + VR+N     + ++GIVRPQD+ A N+++ D+IA ARISYGG G+
Sbjct: 159 VVQGEKWVRINQGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQ 209


>gi|39998139|ref|NP_954090.1| flagellar L-ring protein FlgH [Geobacter sulfurreducens PCA]
 gi|39985085|gb|AAR36440.1| flagellar L-ring protein FlgH [Geobacter sulfurreducens PCA]
          Length = 221

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 100/206 (48%), Gaps = 13/206 (6%)

Query: 43  RMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGR 102
           R P      + +  +  + S+W+ S   L  D +A + GDI+TV I     A  +  T  
Sbjct: 19  RTPTFDEQLRPAPPSYANGSIWQASTTGLAVDHKARSRGDIITVLIVEQASASKEATTDT 78

Query: 103 SRNNSLHRK------LSGGFSLFGQQTPQMNGNLNYDGGGASS----GKGSISRAEKLNL 152
            R   +         L    +LF + T   N N N   G +++    G G+ +R E L  
Sbjct: 79  ERKAEVSASVPYLMGLEKSSTLFSKLT---NANPNNLLGASTNSKYEGSGATTRKENLLA 135

Query: 153 LIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARIS 212
            + A +T +L NGN +I G + V+VN+E + L + G +RP+DV   N++S   IA+ARIS
Sbjct: 136 TMTAKITDVLPNGNFLIEGRRNVKVNNEDQILVLQGTIRPRDVSPDNTISSTMIADARIS 195

Query: 213 YGGKGRTTELLRPPIGHQLIENLSPL 238
           Y G G  ++  RP     +++ + P 
Sbjct: 196 YTGNGVISDRQRPGWLMNILDYIWPF 221


>gi|205355529|ref|ZP_03222300.1| putative flagellar L ring protein precursor [Campylobacter jejuni
           subsp. jejuni CG8421]
 gi|205346763|gb|EDZ33395.1| putative flagellar L ring protein precursor [Campylobacter jejuni
           subsp. jejuni CG8421]
          Length = 207

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 92/184 (50%), Gaps = 7/184 (3%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR---KLSGGFSL 118
           SL+      LF D +A+NV D++TV I+             SR N+ +     L+G   +
Sbjct: 24  SLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTGSSGV 83

Query: 119 FGQQTPQMNG--NLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                 ++N   N+ +    ++  +G GS SR E  N  I+  V  IL NGN  I GS+E
Sbjct: 84  VANALNKVNAYSNIGFQTNSSNNYTGTGSQSRNESFNTTISTRVIKILSNGNYFIEGSRE 143

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           + +N E + + ++G++RP D+   N++    IA+A+I Y  +G      R P G ++IE 
Sbjct: 144 LLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWGGKVIEA 203

Query: 235 LSPL 238
           + P 
Sbjct: 204 IWPF 207


>gi|126176153|ref|YP_001052302.1| flagellar basal body L-ring protein [Shewanella baltica OS155]
 gi|304412505|ref|ZP_07394111.1| flagellar L-ring protein [Shewanella baltica OS183]
 gi|307307164|ref|ZP_07586902.1| flagellar L-ring protein [Shewanella baltica BA175]
 gi|125999358|gb|ABN63433.1| flagellar L-ring protein [Shewanella baltica OS155]
 gi|304349147|gb|EFM13559.1| flagellar L-ring protein [Shewanella baltica OS183]
 gi|306910403|gb|EFN40834.1| flagellar L-ring protein [Shewanella baltica BA175]
          Length = 220

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 102/210 (48%), Gaps = 19/210 (9%)

Query: 9   LCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSH 68
           LC++ LL GC S I +    P                   ID+   D+  K  SL+R   
Sbjct: 7   LCFA-LLSGCMSHIPDKETKPGTKEWAPP----------EIDYSLPDA--KDGSLYRPGF 53

Query: 69  A-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
              LFKD RA   GDILTV +   D+  + ++   ++ N       G     G Q+   +
Sbjct: 54  MLTLFKDKRAFREGDILTVAL---DEKTYSSKKADTKTNKEQDMGMGLTGNIGSQSANAD 110

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
           G  ++  G   +G GS ++  +L+  I   V+ +L NG L+I G + +R+N     L + 
Sbjct: 111 GKTSFSRG--FNGAGSSTQQNQLSGSITVTVSKVLPNGTLLIRGEKWLRLNQGDEYLRLL 168

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           GI+R  D+  +N++S  +IA+ARI YGG+G
Sbjct: 169 GIIRTDDIGNNNTISSQRIADARIIYGGQG 198


>gi|330447906|ref|ZP_08311554.1| flagellar L-ring protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492097|dbj|GAA06051.1| flagellar L-ring protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 222

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 92/180 (51%), Gaps = 8/180 (4%)

Query: 40  ENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDN 98
           E N   F   D   S    K  SL+R +++  LF+D RA  VGD+LTV +    Q+    
Sbjct: 27  EPNDAAFAPPDLDYSLPEAKHGSLYRHNYSMTLFQDRRAYRVGDVLTVLLNEQTQSSKKA 86

Query: 99  QTGRSRNNSLHRKLSG-GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
            T   +++S+   +   G   F   +  ++G+  +DG  AS+      +  KL   I   
Sbjct: 87  NTKFGKSSSIDFAVPTLGNKAFDDLSASVSGDRGFDGAAAST------QGNKLQGAITVT 140

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NG L+I G + +R+N     + +TG+VR  DV+ HN VS  +I +ARI+Y G+G
Sbjct: 141 VHKVLPNGVLMIRGEKWIRLNQGDEYIRLTGVVRVDDVNRHNQVSSQRIGDARITYSGRG 200


>gi|167626158|ref|YP_001676452.1| flagellar basal body L-ring protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167356180|gb|ABZ78793.1| flagellar L-ring protein [Shewanella halifaxensis HAW-EB4]
          Length = 224

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 104/214 (48%), Gaps = 28/214 (13%)

Query: 14  LLFGCHSSISE---ITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA 70
           LL GC + I E     G P+ +P     + +  +P    D +N    +  + L       
Sbjct: 15  LLSGCVAHIPEPDTAPGKPEWAPP----EIDYSLP----DAENGSVYRPGFML------T 60

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP---QMN 127
           LFKD RA   GDILTV          D +T  S+        SGG S+ GQ T     + 
Sbjct: 61  LFKDKRAYREGDILTV--------ALDEKTYSSKRADTKTSKSGGVSIDGQGTTGTSSIA 112

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
           G+   + G + +G GS ++  +L+  I   V  +L NG L+I G + +R+N     L + 
Sbjct: 113 GSGEANMGRSFNGTGSSTQQNQLSGSITVTVAKVLPNGALLIRGEKWLRLNQGDEYLRLL 172

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G++R  D+D  N++S  +IA+ARI YGG+G  ++
Sbjct: 173 GLIRADDIDNDNTISSQRIADARIIYGGQGAISD 206


>gi|189426328|ref|YP_001953505.1| flagellar L-ring protein [Geobacter lovleyi SZ]
 gi|226701925|sp|B3EAV2|FLGH_GEOLS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|189422587|gb|ACD96985.1| flagellar L-ring protein [Geobacter lovleyi SZ]
          Length = 224

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 114/240 (47%), Gaps = 26/240 (10%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           ++V     LL GC    +E+     +SP   S D+  + P    ++ N        S+W+
Sbjct: 4   YLVALSGLLLSGCVVQQTEV-----VSP---SFDQQLKSP--APNYSNG-------SIWQ 46

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
            S   L +D +A  VGDI+T+ +     A     T   R++ +   +     L  +++  
Sbjct: 47  ASSIGLTEDGKARRVGDIVTIIVTETASASKQAATATGRSSQISAGIPNMLGL--EESKI 104

Query: 126 MNGN-------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           +  N       LN        G GS SR E L+  I+A V  +L N NL I G + VRVN
Sbjct: 105 ITSNFADLSKLLNASASSKFDGSGSTSRKETLSATISAKVIDVLPNSNLKIEGRRNVRVN 164

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +E + + V G +R +D+ A N+++   +A+A+ISY G+G  ++  +P     +++ L P 
Sbjct: 165 NEDQIVTVKGTIRQRDITAENTINSIYVADAQISYAGEGIISDRQKPGWLMNVLDKLWPF 224


>gi|68164543|gb|AAY87272.1| predicted flagellar basal body L-ring protein [uncultured bacterium
           BAC17H8]
          Length = 229

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 113/238 (47%), Gaps = 19/238 (7%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSS--LDENNRMPFLGIDFKNSDSTKKSYS 62
           + ++LC + +  GC + +     +P   P+  S  +      P  GI             
Sbjct: 7   AILLLCAAGIASGCSTYVENEASLP-FEPIYPSAHVTPEGEAPTGGI------------- 52

Query: 63  LWRDSHAALFK-DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF-SLFG 120
            ++ +   LF  D RA +VGDILTV +     A        ++N++    L  G  +LF 
Sbjct: 53  -FKSNGGGLFASDIRARDVGDILTVALNETFAATKAQTAASAKNDAFGVTLPTGLPNLFT 111

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
               +    LN     + +G GS +++  L  L+   VT + +NGN+ I+G +++ +N+ 
Sbjct: 112 GGYDKNAAGLNAGTARSFAGSGSAAQSNSLTGLLTVTVTRVFDNGNMEIAGQKKLTLNNG 171

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + +TG++RP+D+ A N+V  ++IA+A I Y G G   +  R     + + N+SPL
Sbjct: 172 DEYVRLTGLIRPEDISATNTVQSNRIADAEIVYVGAGEIADSSRQGWLSRTLRNVSPL 229


>gi|322421660|ref|YP_004200883.1| flagellar L-ring protein [Geobacter sp. M18]
 gi|320128047|gb|ADW15607.1| flagellar L-ring protein [Geobacter sp. M18]
          Length = 233

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 115/224 (51%), Gaps = 27/224 (12%)

Query: 9   LCYSSLLF-GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDS 67
           LC   L F GC    +E+      +P   + DE  ++P   +++        S SLW+ S
Sbjct: 17  LCLPLLWFPGCAHQSAEVA-----TP---TFDE--QIPAPQMNYA-------SGSLWQAS 59

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT---- 123
              L +D +A   GDI+TV I  +  A     T  SR++S+    +G   L G +T    
Sbjct: 60  STGLAEDLKARRRGDIVTVVISENASASKKAATATSRDSSIS---AGIPKLLGLETTGIK 116

Query: 124 --PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
               +   L+   G +  G GS SR E L   I+A V  ++ NGNL+I G + VRVN+E 
Sbjct: 117 NWADLAKLLSASYGSSFDGAGSTSRQETLQATISAKVVDVVPNGNLLIEGRRNVRVNNED 176

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           + + +TG VR +D+ A N+++   +A+A+I+Y GKG  ++  +P
Sbjct: 177 QIIVLTGTVRGRDISADNTINSALVADAQIAYSGKGIISDRQKP 220


>gi|197122911|ref|YP_002134862.1| flagellar L-ring protein [Anaeromyxobacter sp. K]
 gi|226701912|sp|B4UG41|FLGH_ANASK RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|196172760|gb|ACG73733.1| flagellar L-ring protein [Anaeromyxobacter sp. K]
          Length = 229

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 84/160 (52%), Gaps = 11/160 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           S WR+  AA  L+ D+RAL V D++ V  RI++ A       RS +  L R+     S+ 
Sbjct: 56  STWREGRAASMLYTDARALRVNDLVVV--RIEEIA----DAKRSADTDLTRRSELNASIE 109

Query: 120 GQQTPQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
              T  ++      GG  +   G GS +R E+L   + A+V  +L NGNL I G + V V
Sbjct: 110 AFLT-SLDAPYALKGGATTGFKGLGSTARTERLTATVPAVVRKVLPNGNLFIEGHRVVLV 168

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           N E +   ++G+VRP D+D  N V    +A+A I + G+G
Sbjct: 169 NAEEQHFYISGVVRPIDIDQENGVKSSMVADAEIEFTGRG 208


>gi|91794992|ref|YP_564643.1| flagellar basal body L-ring protein [Shewanella denitrificans
           OS217]
 gi|91716994|gb|ABE56920.1| flagellar L-ring protein [Shewanella denitrificans OS217]
          Length = 219

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 96/171 (56%), Gaps = 10/171 (5%)

Query: 49  IDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS 107
           +D+   D+  K  SL+R  +   LFKD RA   GDILTV +   D+  + ++   ++ N 
Sbjct: 35  VDYSLPDA--KDGSLYRPGYMLTLFKDKRAYREGDILTVAL---DEKTYSSKKADTKTNK 89

Query: 108 LHRKLSGGFS-LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGN 166
             + +S G S   G +  + NGN + + G   SG GS ++  +L+  I   V+ +L NG 
Sbjct: 90  -QQGMSLGLSGSAGSEDVKTNGNASLNRG--FSGMGSSTQQNQLSGSITVTVSKVLPNGT 146

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           L+I G + +R+N     L + G++R  D+D  N++S  +IA+ARI YGG+G
Sbjct: 147 LLIRGEKWLRLNQGDEYLRLLGLIRADDIDNTNTISSQRIADARIIYGGQG 197


>gi|94267696|ref|ZP_01290965.1| Flagellar L-ring protein [delta proteobacterium MLMS-1]
 gi|93451898|gb|EAT02629.1| Flagellar L-ring protein [delta proteobacterium MLMS-1]
          Length = 242

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 91/180 (50%), Gaps = 18/180 (10%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL----------FG 120
           L++D RA ++GDI+ V +           T   R +SL   L+  F L          F 
Sbjct: 69  LYRDGRARDIGDIVQVRVVETSSGQKSADTSTDRGSSLSGGLTSFFGLENWVNERSSKFA 128

Query: 121 QQTPQMNGNLN--YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                M+  +N  ++GGG +S      R   +   I+A +     +GNL+I G QEVRVN
Sbjct: 129 LTPNAMDARMNNEFEGGGDTS------RDSDVTATISARIVDKTMDGNLVIRGYQEVRVN 182

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +E + + ++G+VRP D+ + N+V  ++IA+ARI Y GKG   +  RP    + ++ + P 
Sbjct: 183 NETQFIILSGLVRPDDITSDNAVLSNRIADARIEYSGKGELADKQRPGWLSRTVDAVWPF 242


>gi|78221654|ref|YP_383401.1| flagellar L-ring protein [Geobacter metallireducens GS-15]
 gi|110816530|sp|Q39YJ8|FLGH_GEOMG RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|78192909|gb|ABB30676.1| Flagellar L-ring protein [Geobacter metallireducens GS-15]
          Length = 226

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 108/236 (45%), Gaps = 34/236 (14%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R +  +LC +  L GC    +E+                 R P           +  S
Sbjct: 1   MKRLAVSILCLA--LAGCAIEKAEV-----------------RTPSFDEQLPAPQPSYAS 41

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
            S+W+ + A + +D +A   GDI+TV I  +  A     T   R  S+   +     L  
Sbjct: 42  GSIWQAASAGIAEDHKARRKGDIITVVIVENASASKQATTDTDRKASISASIPYLMGLEK 101

Query: 119 ----FGQQTPQMNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLII 169
                G+ T    GNL     GAS+     G G+ +R E L   ++A +  +L NGN +I
Sbjct: 102 QKLILGKLTGADLGNLL----GASTDSTFGGSGATTRKENLVATMSAKIIDVLPNGNFLI 157

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            G + V+VN+E + + + G VRP+DV   N+V+   IA+ARI+Y G+G  ++  RP
Sbjct: 158 EGRRNVKVNNEDQIIILQGTVRPRDVSPDNTVNSSLIADARITYTGEGVISDRQRP 213


>gi|188997555|ref|YP_001931806.1| flagellar L-ring protein [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932622|gb|ACD67252.1| flagellar L-ring protein [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 223

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 93/184 (50%), Gaps = 13/184 (7%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF---SL 118
           SL+  S+  LF DS+A  VGD++T+ + +++ A    QT  + N    +K+        L
Sbjct: 46  SLYTGSYNNLFSDSKAFTVGDVITIKV-VENIA---GQTASNTNTQEQQKMDLNVPSPKL 101

Query: 119 FGQ----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
            G+    +TP     +         G  S +R   L   I+A VT +  NGNL I G + 
Sbjct: 102 MGKDLINKTPI--AGITEQNSDTHKGSASTNRKSTLIATISARVTKVYPNGNLFIVGKKV 159

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           V+VND+ ++L ++GIV+P D+   NSV   +I++  + Y G+G   +  RP    Q ++ 
Sbjct: 160 VKVNDDYQTLVISGIVKPTDIMQDNSVDSSRISDMYVEYNGEGYMADSSRPGWLAQFLKR 219

Query: 235 LSPL 238
           + P 
Sbjct: 220 IWPF 223


>gi|94263285|ref|ZP_01287101.1| Flagellar L-ring protein [delta proteobacterium MLMS-1]
 gi|93456368|gb|EAT06492.1| Flagellar L-ring protein [delta proteobacterium MLMS-1]
          Length = 242

 Score = 82.4 bits (202), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 90/174 (51%), Gaps = 6/174 (3%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL---FGQQTPQMN 127
           L++D RA ++GDI+ V +           T   R +SL   L+  F L     +++ +  
Sbjct: 69  LYRDGRARDIGDIVQVRVVETSSGQKSADTSTDRGSSLSGGLTSFFGLENWVNERSSKFA 128

Query: 128 GNLNYDGGGASS---GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
              N    G S+   G G  SR   +   I+A +     +GNL+I G QEVRVN+E + +
Sbjct: 129 LTPNAMDAGMSNEFEGSGDTSRDSDVTATISARIVDKTMDGNLVIRGYQEVRVNNETQFI 188

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            ++G+VRP D+ + N+V  ++IA+ARI Y GKG   +  RP    + ++ + P 
Sbjct: 189 ILSGLVRPDDITSDNAVLSNRIADARIEYSGKGELADKQRPGWLSRTVDAVWPF 242


>gi|224825167|ref|ZP_03698273.1| flagellar L-ring protein [Lutiella nitroferrum 2002]
 gi|224602838|gb|EEG09015.1| flagellar L-ring protein [Lutiella nitroferrum 2002]
          Length = 227

 Score = 82.4 bits (202), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 77/163 (47%), Gaps = 4/163 (2%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-FGQ---Q 122
           S+  +F D     VGD LTV I          QT   R +SL   +  G  L F     +
Sbjct: 52  SYQPIFADRVPARVGDTLTVTIEEKTTTAASEQTTGKRTSSLSNSMGAGLQLPFVPDYLE 111

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                 +L+ DG   S GKG+   +      I   V  +L NGNL++SG ++VR+N +  
Sbjct: 112 KKLAGASLSADGSATSGGKGTNQASSSFVSSITVTVIDVLANGNLMVSGEKQVRLNGDTE 171

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            + ++G+V P+D+   N+VS  K+A+ARI    KG       P
Sbjct: 172 YIRLSGVVNPRDIKTGNTVSSTKVADARIEQQSKGNNRSFAEP 214


>gi|325295401|ref|YP_004281915.1| Flagellar L-ring protein [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065849|gb|ADY73856.1| Flagellar L-ring protein [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 233

 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 89/174 (51%), Gaps = 9/174 (5%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN- 129
           LF D++A  VGDI+TV I          Q+   + ++    ++   +LFG++ P  NG  
Sbjct: 63  LFADTKARRVGDIVTVKIYEVLTGYGSTQSQSGKKSTFDINVNNP-TLFGKKIP--NGTK 119

Query: 130 ---LNYDGGGA--SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
              LN+    +   SG+G+  R  KL   I+A V  +  NGNL I G + V++ND+ + L
Sbjct: 120 DPLLNFSTKPSIDFSGQGTTKRDAKLIATISARVVKVYPNGNLYIVGEKIVKINDDTQIL 179

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            ++GIV+P D+   NSV   KIA   + Y GKG   +  +P    + +  + P 
Sbjct: 180 KISGIVKPTDIAPDNSVPSSKIANMYVEYNGKGYIADNQKPGWLARFLIKIWPF 233


>gi|218670415|ref|ZP_03520086.1| flagellar basal body L-ring protein [Rhizobium etli GR56]
          Length = 57

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/57 (64%), Positives = 45/57 (78%)

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           R +NV GIVRPQDV+A N +SYDKIAEARISYGG+GR  E+ +PP G Q ++  SPL
Sbjct: 1   RIMNVAGIVRPQDVNADNQISYDKIAEARISYGGRGRLMEVQQPPRGQQAVDLFSPL 57


>gi|313682863|ref|YP_004060601.1| flagellar l-ring protein [Sulfuricurvum kujiense DSM 16994]
 gi|313155723|gb|ADR34401.1| flagellar L-ring protein [Sulfuricurvum kujiense DSM 16994]
          Length = 238

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 102/188 (54%), Gaps = 13/188 (6%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG-FSLFG 120
           SL+    + LF D +A++V D++TV   I + A   N   ++ + +    L+GG F+  G
Sbjct: 53  SLFGQGDSPLFSDHKAMHVNDVVTV--VISETASSSNVGKKALSEADTLGLNGGVFTSAG 110

Query: 121 QQTP------QMNG--NLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
             +       ++NG  N+ + GG  SS  G GS ++       ++A +  ++ NGN  I+
Sbjct: 111 ANSTVNSAVNKLNGLSNIGFTGGSTSSYAGSGSATKNASFTTTVSARIVKVMSNGNYFIT 170

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G +E+ V+D+ + + ++G++RP D+D +N ++  KI++A+I Y  +G      +   G +
Sbjct: 171 GRREIMVDDQKQIMQLSGVIRPYDIDQNNQINSAKISDAKILYANEGDVDRSTQRGWGSK 230

Query: 231 LIENLSPL 238
           L+E + P 
Sbjct: 231 LVEAVWPF 238


>gi|320354344|ref|YP_004195683.1| flagellar L-ring protein [Desulfobulbus propionicus DSM 2032]
 gi|320122846|gb|ADW18392.1| flagellar L-ring protein [Desulfobulbus propionicus DSM 2032]
          Length = 246

 Score = 81.6 bits (200), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 114/243 (46%), Gaps = 23/243 (9%)

Query: 3   RYSFIVLCYSSLLF-GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           R + ++L  ++L+  GC S+  E+      SP+   L+E    P +      S  T    
Sbjct: 20  RMAMVLLLAATLVTAGCGSTSQEV------SPVTEPLEE----PVVDDARPQSPGT---- 65

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
            LW         D +A  VGDI+TV I  + +A  +  T   R++S+   +S  F L  +
Sbjct: 66  -LWNGDEGNWLADVKARRVGDIVTVIIEEEAKASKEATTDTDRSSSISAGISSFFGL-EK 123

Query: 122 QTPQMNGNLNYDG------GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
              + N NL          G   SG G  +R+E L   +   V  +  NGNL I G + V
Sbjct: 124 SLEEKNSNLETSALVEASSGNQFSGGGKTTRSENLVATLTTQVVEVYPNGNLKIRGGKSV 183

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
            VN+E + + +TGIVR  DV A N+V+   I  A+ISY GKG  ++  +P    ++ ++ 
Sbjct: 184 TVNNENQIIYLTGIVRSYDVTADNTVNSGNILNAQISYTGKGAVSDKQKPGWMMRIFDHT 243

Query: 236 SPL 238
            P 
Sbjct: 244 WPF 246


>gi|296135670|ref|YP_003642912.1| flagellar L-ring protein [Thiomonas intermedia K12]
 gi|295795792|gb|ADG30582.1| flagellar L-ring protein [Thiomonas intermedia K12]
          Length = 237

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 91/182 (50%), Gaps = 10/182 (5%)

Query: 62  SLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           ++W+  ++ +LF+DSRA  VGD++TV I+ +  A     T  ++++ +   LS   S FG
Sbjct: 61  AIWQPGTNVSLFEDSRAHRVGDLITVLIQENANATKSTNTTVNKSDDVSAGLS---SFFG 117

Query: 121 QQTPQMNGNLNYDGGGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           +  P   G  +   G  SS    G G+ S++      + A V  ++ NGN+ ISG +EV 
Sbjct: 118 K--PFTVGGYSPSMGLTSSTKFGGNGATSQSNTFTTTLQATVVQVMSNGNMQISGQKEVM 175

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     + V G+VR  DV   N+V   +IA AR+ Y G G      + P       +L 
Sbjct: 176 LNGGHEYIRVAGVVRAADVSPQNTVLSTQIANARVEYSGTGDVYAAAKVPWLASFFLSLW 235

Query: 237 PL 238
           P 
Sbjct: 236 PF 237


>gi|294339840|emb|CAZ88203.1| putative Flagellar L-ring protein precursor (Basal body L-ring
           protein) FlgH [Thiomonas sp. 3As]
          Length = 237

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 91/182 (50%), Gaps = 10/182 (5%)

Query: 62  SLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           ++W+  ++ +LF+DSRA  VGD++TV I+ +  A     T  ++++ +   LS   S FG
Sbjct: 61  AIWQPGTNVSLFEDSRAHRVGDLITVLIQENANATKSTNTTVNKSDDVSAGLS---SFFG 117

Query: 121 QQTPQMNGNLNYDGGGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           +  P   G  +   G  SS    G G+ S++      + A V  ++ NGN+ ISG +EV 
Sbjct: 118 K--PFTVGGYSPSMGLTSSTKFGGNGATSQSNTFTTTLQATVVQVMSNGNMQISGQKEVM 175

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     + V G+VR  DV   N+V   +IA AR+ Y G G      + P       +L 
Sbjct: 176 LNGGHEYIRVAGVVRAADVSPQNTVLSTQIANARVEYSGTGDVYAAAKVPWLASFFLSLW 235

Query: 237 PL 238
           P 
Sbjct: 236 PF 237


>gi|188592120|ref|YP_001796718.1| flagellar basal body l-ring protein [Cupriavidus taiwanensis LMG
           19424]
 gi|226701916|sp|B2AI82|FLGH_CUPTR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|170938494|emb|CAP63481.1| FlgH: Flagellar L-ring protein ; signal peptide [Cupriavidus
           taiwanensis LMG 19424]
          Length = 229

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 90/188 (47%), Gaps = 17/188 (9%)

Query: 60  SYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHR 110
           S S+++ S+A   LF+D R  NVGDILT+ I  +  A  ++ T  SR        +S+ R
Sbjct: 50  SGSIFQSSYAGNPLFEDRRPRNVGDILTILITENVNASKNSGTNTSRTGNAALAFDSVPR 109

Query: 111 KLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
            L G   LFG        N N +G       G  S A   N  I   V  +L NGNL++S
Sbjct: 110 ALGG---LFGTSQ-----NANINGANTMKASGGASAANTFNGTITVTVLEVLANGNLVVS 161

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G +++ +N     +  +G+V P+ +   N+V   ++A+ARI Y  KG   E        +
Sbjct: 162 GEKQMAINQGAEFIRFSGVVNPRTITGDNAVLSTQVADARIEYTAKGVIDEAQNMGWLQR 221

Query: 231 LIENLSPL 238
              N+SP 
Sbjct: 222 FFLNVSPF 229


>gi|260767926|ref|ZP_05876860.1| flagellar L-ring protein FlgH [Vibrio furnissii CIP 102972]
 gi|260615956|gb|EEX41141.1| flagellar L-ring protein FlgH [Vibrio furnissii CIP 102972]
          Length = 223

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 112/220 (50%), Gaps = 22/220 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M + S + L    +L GC        G  + +P   S DE    P   +D+  S    +S
Sbjct: 1   MAKLSKVGLLSVLILAGC-------AGRDEFTP--PSPDEEKYGPPT-LDY--SLPAAQS 48

Query: 61  YSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQA--VFDNQTGRSRNNSLHRKLSGGFS 117
            SL+R  +A  LF+D RA  VGD+LTV +  + Q+    D Q G++ +  L   + GG +
Sbjct: 49  GSLYRHQYAMTLFQDRRAYRVGDVLTVLLAEETQSKKSADTQYGKTSSVGLSAPVVGGKT 108

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           +  +    ++G+ ++DG  +SS      +  KL   I   V+ +L NG + I G + +R+
Sbjct: 109 V-DKLAASIDGDRSFDGSASSS------QGNKLEGAITVTVSEVLPNGVIRIRGEKWIRL 161

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           N     + +TGIVR  D+  +N VS  +I +ARI+Y G+G
Sbjct: 162 NQGDEFIRLTGIVRVDDISRNNQVSSQRIGDARITYSGRG 201


>gi|149189839|ref|ZP_01868119.1| flagellar L-ring protein precursor [Vibrio shilonii AK1]
 gi|148836325|gb|EDL53282.1| flagellar L-ring protein precursor [Vibrio shilonii AK1]
          Length = 224

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 84/159 (52%), Gaps = 10/159 (6%)

Query: 62  SLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGFSL 118
           SL+R  +   LF+D RA  VGD+LT+ +  + Q+    D + G++          GG + 
Sbjct: 51  SLYRHQYNLTLFQDRRAYRVGDVLTILLVEETQSSKKADTKFGKTSKVDFGAATVGG-NT 109

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           F +    +NG+  +DG  ASS      +  KL   I   V  ++ NG L ISG + +R+N
Sbjct: 110 FDETAVGLNGSRAFDGSAASS------QGNKLEGAITVTVHEVMPNGVLKISGEKWIRLN 163

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
                + VTGI+R  DVD +N V   +I +ARI+Y G+G
Sbjct: 164 QGDEFIRVTGIIRADDVDRYNQVFSHRIGDARITYSGRG 202


>gi|315179629|gb|ADT86543.1| flagellar L-ring protein FlgH [Vibrio furnissii NCTC 11218]
          Length = 212

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 91/162 (56%), Gaps = 10/162 (6%)

Query: 59  KSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQA--VFDNQTGRSRNNSLHRKLSGG 115
           +S SL+R  +A  LF+D RA  VGD+LTV +  + Q+    D Q G++ +  L   + GG
Sbjct: 36  QSGSLYRHQYAMTLFQDRRAYRVGDVLTVLLAEETQSKKSADTQYGKTSSVGLSAPVVGG 95

Query: 116 FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
            ++  +    ++G+ ++DG  +SS      +  KL   I   V+ +L NG + I G + +
Sbjct: 96  KTV-DKLAASIDGDRSFDGSASSS------QGNKLEGAITVTVSEVLPNGVIRIRGEKWI 148

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           R+N     + +TGIVR  D+  +N VS  +I +ARI+Y G+G
Sbjct: 149 RLNQGDEFIRLTGIVRVDDISRNNQVSSQRIGDARITYSGRG 190


>gi|145297457|ref|YP_001140298.1| lateral flagellar L-ring protein, LfgH [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142850229|gb|ABO88550.1| lateral flagellar L-ring protein, LfgH [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 223

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 109/221 (49%), Gaps = 28/221 (12%)

Query: 1   MYRYSFIVLCYSSLLFGC--HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M+RY ++VL    LL GC  +   +   G  + +P           P L +  +  D   
Sbjct: 5   MWRYLWVVL----LLGGCATYELKAPEPGDEKWAP---------SRPKLSVSARGEDG-- 49

Query: 59  KSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL-SGGF 116
              SL+R D    LF+D RA  +GDILTV +    Q+     T  S+N+S++    S G 
Sbjct: 50  ---SLYRGDYMMTLFQDRRAYRIGDILTVVLEERTQSSKKANTSMSKNSSMNVPAPSIGG 106

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            +       ++ + ++DGG  SS + +++ +      I   V  ++ NG L I G + +R
Sbjct: 107 KVRSDWGASLSADRDFDGGATSSQQNTLAGS------ITVTVAEVMPNGVLGIRGEKWIR 160

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +N     + + G+VR +D+D  N +S  +IA+ARI+Y G+G
Sbjct: 161 LNQGDEYIRLGGMVRVEDIDQSNRISSQRIADARITYAGRG 201


>gi|74101661|gb|AAZ99751.1| FlgHL [Aeromonas hydrophila]
          Length = 223

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 109/221 (49%), Gaps = 28/221 (12%)

Query: 1   MYRYSFIVLCYSSLLFGC--HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M+RY ++VL    LL GC  +   +   G  + +P           P L +  +  D   
Sbjct: 5   MWRYLWVVL----LLGGCATYELKAPEPGDEKWAP---------SRPKLSVSARGEDG-- 49

Query: 59  KSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL-SGGF 116
              SL+R D    LF+D RA  +GDILTV +    Q+     T  S+N+S++    S G 
Sbjct: 50  ---SLYRGDYMMTLFQDRRAYRIGDILTVVLEERTQSSKKANTSMSKNSSMNVPAPSIGG 106

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            +       ++ + ++DGG  SS + +++ +      I   V  ++ NG L I G + +R
Sbjct: 107 KVRSDWGASLSADRDFDGGATSSQQNTLAGS------ITVTVAEVMPNGVLGIRGEKWIR 160

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +N     + + G+VR +D+D  N +S  +IA+ARI+Y G+G
Sbjct: 161 LNQGDEYIRLGGMVRVEDIDQSNRISSQRIADARITYAGRG 201


>gi|237752556|ref|ZP_04583036.1| flagellar basal body L-ring protein [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376045|gb|EEO26136.1| flagellar basal body L-ring protein [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 235

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 94/181 (51%), Gaps = 16/181 (8%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LF D RA+ + D++TV I    QA   +   ++ N + +  L+G    FG  + Q  GN+
Sbjct: 58  LFSDRRAMQLNDLVTVIINQTAQAT--STANKNLNETSNATLTGPGITFGGPS-QTIGNI 114

Query: 131 -----NYDGGGASSGK--------GSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                N  G G S+G+        GS +R E     IAA +  +L+NGN  I GS+EV +
Sbjct: 115 TNQLNNITGFGISTGQNTSTFQGAGSQNRQEAFTTTIAARIIKVLQNGNYFIEGSREVLI 174

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N E + ++++G+VRP D+   N++    IA+A+I Y  +G          G +L+E++ P
Sbjct: 175 NGEKQVIHLSGVVRPNDIARDNTIESRFIADAKIMYDTQGELKRNTEKGWGTKLLESVWP 234

Query: 238 L 238
            
Sbjct: 235 F 235


>gi|254496890|ref|ZP_05109738.1| flagelle L-ring protein [Legionella drancourtii LLAP12]
 gi|254353909|gb|EET12596.1| flagelle L-ring protein [Legionella drancourtii LLAP12]
          Length = 224

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 110/221 (49%), Gaps = 21/221 (9%)

Query: 1   MYRYSFIVLCYSSLLFG-CHSSISEITGI-PQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           M  ++F+V+ +S L+ G C +    + G  P  +P   +  +  ++             +
Sbjct: 1   MRLFNFLVVGFSVLVLGGCDAINPPVQGKNPDYAPTYPAAPDPKQL------------RR 48

Query: 59  KSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           +S +++    A  LF+ +RA + GDILTV +  +  A  +    + +N+S     S  F 
Sbjct: 49  ESGAIYHPETALPLFETARARHEGDILTVYLLENTNASKNATLQQMKNDSNVMTNSATFG 108

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
                T  MN NLN       +G     +  +L   I+  V  +L NGNL++ G + V++
Sbjct: 109 ----DTYSMNINLNNQR--QFNGSAQAVQNNQLAGSISVTVAKVLSNGNLVVQGEKWVKI 162

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
           N     + ++GIVRPQD+ A NS + D++A ARISYGG G+
Sbjct: 163 NQGEEYVRLSGIVRPQDIKADNSTTSDRVANARISYGGTGQ 203


>gi|258592558|emb|CBE68867.1| Flagellar L-ring protein (Basal body L-ring protein) (fragment)
           [NC10 bacterium 'Dutch sediment']
          Length = 204

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 89/171 (52%), Gaps = 7/171 (4%)

Query: 57  TKKSYSLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
           T    SLWRD     LF D++A +VGDI+TV +          +T   + ++    LS  
Sbjct: 26  TASGESLWRDIGSGFLFVDTKAQHVGDIVTVLVTESSSLNRQTETNTKKESTNSANLSSL 85

Query: 116 FSL-FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
           F L  G +T        ++G     G GSI+R++++   + A V  +L +GNLII G + 
Sbjct: 86  FGLPLGDKT-----QYAFEGANEHKGSGSITRSDEVTARVVARVVKVLPSGNLIIEGRRA 140

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           VR NDE + + ++G++R  D+   N++   +IA+A I   GKG   E  RP
Sbjct: 141 VRANDESQYVAISGVIRQVDITPANTILSTQIADAEIVLEGKGALAEKQRP 191


>gi|220934397|ref|YP_002513296.1| flagellar L-ring protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995707|gb|ACL72309.1| flagellar L-ring protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 229

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 84/147 (57%), Gaps = 5/147 (3%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LF+D +A  VGDILTV +    QA     T  S+ +S++       ++  +  P+++ ++
Sbjct: 66  LFEDYKARRVGDILTVRLAERTQARKSANTSTSKESSVNMPTP---TVLNRTIPELSTSI 122

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
             +G  +  G G  +++ +L+  I  +V  +L NGNL++ G + +R+N     + + GIV
Sbjct: 123 --EGSRSFDGAGDSAQSNQLDGSITVMVAEVLPNGNLVVQGEKWIRINQGQEFIRLRGIV 180

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKG 217
           RP DV A N++   +IA A+++YGG G
Sbjct: 181 RPVDVRADNTILSTQIANAQVAYGGSG 207


>gi|289523330|ref|ZP_06440184.1| flagellar L-ring protein FlgH [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503022|gb|EFD24186.1| flagellar L-ring protein FlgH [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 190

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 90/174 (51%), Gaps = 8/174 (4%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW+D  A L+ D R   VGDI+TV   +D+    +++        +   +  G  +F  
Sbjct: 24  SLWQDG-ANLYADPRPSRVGDIVTV--IVDESLSANDEANTDLTKEIDHGVDDGTGIF-D 79

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
              +   + N D     SG  S  R   LN  ++ +VT + ENGNL+I G ++++ +DE 
Sbjct: 80  FIRRFGVSANTD----MSGDTSTERDYSLNTTVSCMVTEVQENGNLVIEGYRDLKTHDET 135

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
             L + G++RP+DV   N++S  K+A   +   GKG  + + +P +  Q+++ L
Sbjct: 136 LKLTLRGVIRPKDVSYDNTISSTKMANPELFVEGKGSLSRVQKPGLITQILQAL 189


>gi|237755439|ref|ZP_04584064.1| flagellar L-ring protein FlgH [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237692403|gb|EEP61386.1| flagellar L-ring protein FlgH [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 224

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 92/184 (50%), Gaps = 13/184 (7%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF---SL 118
           SL+  ++  LF DS+A  VGDI+T+ + +++ A    QT  + N    +K+        L
Sbjct: 47  SLYTGTYNNLFSDSKAFTVGDIITIRV-VENIA---GQTASNTNTQEQQKMDLNVPSPKL 102

Query: 119 FGQ----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
            G+    +TP     +         G  S +R   L   I+A VT +  NGNL I G + 
Sbjct: 103 MGKDLINKTPI--AGITEQNSDTYKGSASTNRKSTLIATISARVTKVYPNGNLFIVGKKV 160

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           V+VND+ ++L ++GIV+P D+   NSV   +I++  + Y G+    +  RP    Q ++ 
Sbjct: 161 VKVNDDYQTLVISGIVKPTDIMQDNSVDSSRISDMYVEYNGRSYMADSSRPGWLAQFLKR 220

Query: 235 LSPL 238
           + P 
Sbjct: 221 IWPF 224


>gi|86157775|ref|YP_464560.1| flagellar L-ring protein [Anaeromyxobacter dehalogenans 2CP-C]
 gi|110816523|sp|Q2IQP0|FLGH_ANADE RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|85774286|gb|ABC81123.1| flagellar L-ring protein [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 229

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 83/160 (51%), Gaps = 11/160 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           S WR+  AA  L+ D+RAL   D++ V  RI++ A       RS +  L R+     S+ 
Sbjct: 56  STWREGRAASMLYTDARALRENDLVVV--RIEEIA----DAKRSADTDLTRRSELNASIE 109

Query: 120 GQQTPQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
              T  ++      GG  S   G GS +R E+L   + A+V  +L NGNL I G + V V
Sbjct: 110 AFLT-SLSTPYALKGGADSGFKGLGSTARTERLTATVPAVVRKVLPNGNLFIEGHRVVLV 168

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           N E +   ++G+VRP D+D  N V    +A+A I + G+G
Sbjct: 169 NAEEQHFYISGVVRPIDIDQENGVKSSMVADAEIEFTGRG 208


>gi|331005446|ref|ZP_08328825.1| Flagellar L-ring protein FlgH [gamma proteobacterium IMCC1989]
 gi|330420722|gb|EGG95009.1| Flagellar L-ring protein FlgH [gamma proteobacterium IMCC1989]
          Length = 190

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 86/172 (50%), Gaps = 10/172 (5%)

Query: 62  SLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+ DS + +L  D + L+ GDI+TV +     A     T   R+  +   L+G      
Sbjct: 24  SLYSDSNYVSLHSDKKKLSQGDIVTVLVYEQASASTSAGTDTERDTEISGTLTG------ 77

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                       D G   SG GSISR  KL   ++  V ++L +G+++I G Q +  NDE
Sbjct: 78  ---TNKTRRAGLDIGSDFSGGGSISREGKLIASVSVKVKSVLSSGDMVIKGQQLIEFNDE 134

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
            + +N+ G +RP D+   N+V   +IA+ARI+Y G G   +  +P    +L+
Sbjct: 135 TQFINIEGTIRPSDISPDNTVLSTRIADARITYKGDGLLGKQQQPGFFSKLM 186


>gi|220917703|ref|YP_002493007.1| flagellar L-ring protein [Anaeromyxobacter dehalogenans 2CP-1]
 gi|254789276|sp|B8JD92|FLGH_ANAD2 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|219955557|gb|ACL65941.1| flagellar L-ring protein [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 229

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 83/160 (51%), Gaps = 11/160 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           S WR+  AA  L+ D+RAL   D++ V  RI++ A       RS +  L R+     S+ 
Sbjct: 56  STWREGRAASMLYTDARALRENDLVVV--RIEEIA----DAKRSADTDLTRRSELNASIE 109

Query: 120 GQQTPQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
              T  ++      GG  +   G GS +R E+L   + A+V  +L NGNL I G + V V
Sbjct: 110 AFLT-SLDTPYALKGGATTGFKGLGSTARTERLTATVPAVVRKVLPNGNLFIEGHRVVLV 168

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           N E +   ++G+VRP D+D  N V    +A+A I + G+G
Sbjct: 169 NAEEQHFYISGVVRPIDIDQENGVKSSMVADAEIEFTGRG 208


>gi|117926377|ref|YP_866994.1| flagellar L-ring protein [Magnetococcus sp. MC-1]
 gi|117610133|gb|ABK45588.1| flagellar L-ring protein [Magnetococcus sp. MC-1]
          Length = 232

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 87/179 (48%), Gaps = 11/179 (6%)

Query: 62  SLWRDS-HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SLW       LF D++A  VGD++TV++     A  +  T   R       L G   LFG
Sbjct: 51  SLWNSGGRNTLFADAKARFVGDLITVNVSESSSAKKNAMTELKREADSEVALGG---LFG 107

Query: 121 QQTPQMNGNLN--YDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
                  G L+   D    +S     G+G+ SR       I   VT +L NGNL I G +
Sbjct: 108 LTEALQKGGLSKLVDSNSTTSNQNHKGEGTTSRDSTFTATITCQVTEVLSNGNLRIEGRR 167

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           ++ VN E + + ++G++RP+D+   NSV+  +IA+ARI Y G+G   +  +P    Q  
Sbjct: 168 DITVNHENQFIILSGVIRPEDISNTNSVNSAQIADARIDYSGEGVLDDQQQPSWLQQFF 226


>gi|291288377|ref|YP_003505193.1| flagellar L-ring protein [Denitrovibrio acetiphilus DSM 12809]
 gi|290885537|gb|ADD69237.1| flagellar L-ring protein [Denitrovibrio acetiphilus DSM 12809]
          Length = 239

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 104/189 (55%), Gaps = 20/189 (10%)

Query: 52  KNSDSTKKSYSLWRDSHA--ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH 109
           K  ++ K S SLW ++ A  +LF D +  +VGDI+ ++I     A   N T  S++ S  
Sbjct: 43  KQQEARKPSPSLWMEASAKGSLFLDYKGRHVGDIIIINIVESTSASNSNSTSTSKSQSAS 102

Query: 110 RKLSGGFSLFGQQTPQMNGNLNYDGGGAS-------------SGKGSISRAEKLNLLIAA 156
             L+    L     P   G  N  G G +             +G GS ++A+ +   IAA
Sbjct: 103 STLTNLMGL-----PANLGVTNLLGTGNALDLNNSLDSSSSFAGNGSKTKADTIQGTIAA 157

Query: 157 IVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGK 216
            VT +L +GNL+I G +E+ V++E +++ ++GIVR +D+DA N+VS   IA+A+I+Y G+
Sbjct: 158 RVTDVLPSGNLVIEGHRELIVDNEKQTITLSGIVRQKDLDASNTVSSTSIADAKIAYSGQ 217

Query: 217 GRTTELLRP 225
           G  ++  +P
Sbjct: 218 GMLSDSNKP 226


>gi|224419002|ref|ZP_03657008.1| flagellar basal body L-ring protein [Helicobacter canadensis MIT
           98-5491]
 gi|253827948|ref|ZP_04870833.1| flagellar L-ring protein precursor [Helicobacter canadensis MIT
           98-5491]
 gi|313142515|ref|ZP_07804708.1| flagellar L-ring protein [Helicobacter canadensis MIT 98-5491]
 gi|253511354|gb|EES90013.1| flagellar L-ring protein precursor [Helicobacter canadensis MIT
           98-5491]
 gi|313131546|gb|EFR49163.1| flagellar L-ring protein [Helicobacter canadensis MIT 98-5491]
          Length = 244

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 90/184 (48%), Gaps = 22/184 (11%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF--------SLFGQQ 122
           LF D RA+ + D++TV I    QA        S N +L+   SG F              
Sbjct: 67  LFSDRRAMQLNDLVTVIINQTAQA------SSSANKNLNENSSGTFGGPSLSYAGSSSSI 120

Query: 123 TPQMNGNLNYDGGGAS--------SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
              +NG  N  G G +        +G G+ +R E     IAA +  +L+NGN  I GS+E
Sbjct: 121 GSIVNGINNATGFGINLGNNTSTYAGTGTQNRQETFTTTIAARIIKVLQNGNYFIEGSRE 180

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           V +N E + ++++G+VRP D+  +N++    IA+A+I Y  +G   +      G +LIE+
Sbjct: 181 VLINGEKQIIHLSGVVRPTDIARNNTIESQYIADAKIMYDTQGELKKSTEKGWGTKLIES 240

Query: 235 LSPL 238
           + P 
Sbjct: 241 VWPF 244


>gi|294084415|ref|YP_003551173.1| flagellar L-ring protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663988|gb|ADE39089.1| flagellar L-ring protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 226

 Score = 79.3 bits (194), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 93/187 (49%), Gaps = 22/187 (11%)

Query: 63  LWRDSHAALFK-DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS--------LHRKLS 113
           ++  +   LF  D RA NVGDILTV +     A        ++ +S        L   L+
Sbjct: 51  IFEKTKGGLFATDRRARNVGDILTVSLSESFSATKSQTAASAKTDSFGVTLPTALPNILT 110

Query: 114 GGFSLFGQQTPQMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
           GG+S           +    GG A S  G GS +++  L+  ++  V  + +NGN+ I G
Sbjct: 111 GGYS-----------DAGLTGGAARSFSGSGSAAQSNSLSGFLSVTVMRVFDNGNMEIKG 159

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            +++ +N+    + +TG+VRPQD+ A N V  ++IA+A+I+Y G G T +  R     + 
Sbjct: 160 QKKLNLNNGDEYVRLTGLVRPQDISASNLVLSNRIADAQITYVGAGETADSARQGWLSKT 219

Query: 232 IENLSPL 238
           +  +SP 
Sbjct: 220 LRTISPF 226


>gi|269792755|ref|YP_003317659.1| flagellar L-ring protein [Thermanaerovibrio acidaminovorans DSM
           6589]
 gi|269100390|gb|ACZ19377.1| flagellar L-ring protein [Thermanaerovibrio acidaminovorans DSM
           6589]
          Length = 192

 Score = 79.3 bits (194), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 89/174 (51%), Gaps = 8/174 (4%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLWR+    LF D R   VGDI+TV  R+++     ++   S + + +  ++ G  +   
Sbjct: 26  SLWREG-TDLFADRRPSRVGDIVTV--RVNETTDTKDEGKSSTSKTDNSGMNAGTGIL-- 80

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                    +  G   S+G     R   ++  I+ +VT +L  GNL+I G ++V   +E 
Sbjct: 81  ---DFIKAFSIGGSSNSAGNSKTERKHNVSTQISCVVTEVLPGGNLVILGQRDVVTQEEK 137

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
             ++ +G++RP+DV+  N +S  ++A A I   GKG  + + RP I  Q+I+ L
Sbjct: 138 LKVSFSGVIRPEDVEPGNVISSSRVANAEIRVEGKGAVSRVQRPGIFTQIIQAL 191


>gi|56460249|ref|YP_155530.1| flagellar basal body L-ring protein [Idiomarina loihiensis L2TR]
 gi|81363527|sp|Q5R0P9|FLGH_IDILO RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|56179259|gb|AAV81981.1| Flagellar basal body L-ring protein [Idiomarina loihiensis L2TR]
          Length = 224

 Score = 79.3 bits (194), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 85/160 (53%), Gaps = 8/160 (5%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL++D++A  L+ D +A  +GDI+TV +R    A     T  S+ ++         + FG
Sbjct: 47  SLFQDAYADNLYSDIKARRLGDIITVTLREQTTASKTATTETSKESTAELAAP---TAFG 103

Query: 121 QQTPQMNGN---LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           +    + GN      +G    SG GS  ++ +LN  I   V  +L NGNLI+ G + +R+
Sbjct: 104 RNI-TVGGNPLSAGINGTREFSGDGSSDQSNQLNGEITVTVIKVLPNGNLIVRGEKWMRI 162

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           N     + +TG++RPQD+ A N +   ++A ARI Y G G
Sbjct: 163 NTGDEYIRLTGMIRPQDITAANQIPSTRVANARIEYSGTG 202


>gi|237750914|ref|ZP_04581394.1| flagellar l-ring protein [Helicobacter bilis ATCC 43879]
 gi|229373359|gb|EEO23750.1| flagellar l-ring protein [Helicobacter bilis ATCC 43879]
          Length = 237

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 93/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIR---IDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           SL+      LF D RA+ V D++T+ I+    +D  +    +G S  N    +++     
Sbjct: 51  SLFGQGERPLFADRRAMRVDDLITIKIKENITNDFKIDKKYSGSSGGNVTPAQMTYNGQD 110

Query: 119 FGQQ--TPQMNGNLNY-----DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
             QQ  T  +N  +NY     +      G G+ S+++ L L I A +  ++ENGN  I G
Sbjct: 111 AQQQANTAYLNDQVNYTLTKPNNATNFQGGGTYSQSQNLALTITARILKVMENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            QE+ VN E + + ++G+VRP D+  +N++    IA+++IS    G+ +E L        
Sbjct: 171 KQEMLVNGEKQIIQISGVVRPYDIQQNNTIESQYIADSKISIVSVGKISETLTKKPTTDA 230

Query: 232 IENLSP 237
           IE+  P
Sbjct: 231 IESNWP 236


>gi|315125987|ref|YP_004067990.1| lateral flagellar L-ring protein, LfgH [Pseudoalteromonas sp.
           SM9913]
 gi|315014501|gb|ADT67839.1| lateral flagellar L-ring protein, LfgH [Pseudoalteromonas sp.
           SM9913]
          Length = 240

 Score = 78.6 bits (192), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 88/167 (52%), Gaps = 10/167 (5%)

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           SL++D++  +L+ D RA  VGDILTV +  R       D+   +S +  +   ++G  ++
Sbjct: 67  SLFQDNYMFSLYADKRAYRVGDILTVVLNERTQSSKSADSSLDKSTDLDVSVPVAGALNV 126

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   + NL         G+ S S+   L+  I   V  +L NG+L+I G +++++N
Sbjct: 127 -------ADFNLGIGSSAKFDGESSASQQNFLSGAITVRVNHVLSNGSLVIKGRKQIKLN 179

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
                + + G+VRP D+D  N VS  +IAEA+ISY GKG   +  RP
Sbjct: 180 QGDEYIEIEGLVRPGDIDVSNRVSSLRIAEAQISYTGKGTLADANRP 226


>gi|298529924|ref|ZP_07017326.1| flagellar L-ring protein [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509298|gb|EFI33202.1| flagellar L-ring protein [Desulfonatronospira thiodismutans ASO3-1]
          Length = 233

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 110/233 (47%), Gaps = 21/233 (9%)

Query: 1   MYRYSFIVLCYSSLLFG-CHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M  Y  I++   +   G C  +  + T +P   P         + P  G     + +   
Sbjct: 1   MKSYKLIIIVAMAFFLGACAPAQKKSTPMPSYGP--------EQYPDPG-----AVTEAD 47

Query: 60  SYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN-----SLHRKLS 113
           S SL++ +    LF D+RA NVGDI+TV I     A     T   R++     S+    +
Sbjct: 48  SPSLFQPNRTQFLFGDNRARNVGDIVTVHIEESSDAESRANTEYDRDSTMDLSSMPISAA 107

Query: 114 GGFSLFGQQTP-QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
            G    G  TP +M             G G+ SR   +   ++A V  +L+ G + + G+
Sbjct: 108 TGAIFPGAGTPGEMQQQFQSQSDRDFEGDGTTSRGSDVQASVSARVVEVLDGGVMHVEGA 167

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           ++++VN+E + + V G+VR +DVD++NSVS  ++A+A+I   G+G   +  RP
Sbjct: 168 RQIKVNNETQIIAVRGLVRSRDVDSNNSVSSTQLADAQIEMYGEGILADQQRP 220


>gi|116694222|ref|YP_728433.1| flagellar basal body L-ring protein [Ralstonia eutropha H16]
 gi|113528721|emb|CAJ95068.1| flagellar basal body L-ring protein [Ralstonia eutropha H16]
          Length = 234

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 58/188 (30%), Positives = 91/188 (48%), Gaps = 17/188 (9%)

Query: 60  SYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHR 110
           S S+++ S+A   LF+D R  NVGDILT+ I  +  A  ++ T  SR        +++ R
Sbjct: 55  SGSIYQSSYAGNPLFEDRRPRNVGDILTILITENVNASKNSGTNTSRTGNTALAFDAVPR 114

Query: 111 KLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
            LSG   LF   +     N + +G       G  S A   N  I   V  +L NGNL++S
Sbjct: 115 ALSG---LFNSSS-----NASINGANTMKASGGASAANTFNGTITVTVLEVLTNGNLVVS 166

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G +++ +N     +  +G+V P+ +   N+V   ++A+ARI Y  KG   E        +
Sbjct: 167 GEKQMAINQGAEFIRFSGVVNPRTITGDNAVLSTQVADARIEYTAKGVIDEAQNMGWLQR 226

Query: 231 LIENLSPL 238
              N+SP 
Sbjct: 227 FFLNVSPF 234


>gi|303328378|ref|ZP_07358816.1| flagellar L-ring protein FlgH [Desulfovibrio sp. 3_1_syn3]
 gi|302861708|gb|EFL84644.1| flagellar L-ring protein FlgH [Desulfovibrio sp. 3_1_syn3]
          Length = 239

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 87/178 (48%), Gaps = 10/178 (5%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL----------FG 120
           LF DSRA  VGDI+ V +  + +A    +T  +++ S   +++  F             G
Sbjct: 62  LFADSRARRVGDIVVVKLVENTKAQNKAETTANKDGSNDYQVAAMFGKSKTGFVPLVGIG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            Q       LN       S  G   R   +   +AA V  +L  G L I G++E+RVN+E
Sbjct: 122 PQARVGTPVLNTSSVSDLSATGKTKRENYVTTSMAARVLRVLPGGLLQIEGAREIRVNEE 181

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + V G++R +DVDA NSV   +IA+A I Y G+G   +  +P    +L++N+ P 
Sbjct: 182 TEYMVVRGMIRAKDVDAENSVYSTQIADASIEYYGRGVLADKQKPGWFTRLMDNIWPF 239


>gi|307721385|ref|YP_003892525.1| flagellar L-ring protein [Sulfurimonas autotrophica DSM 16294]
 gi|306979478|gb|ADN09513.1| flagellar L-ring protein [Sulfurimonas autotrophica DSM 16294]
          Length = 240

 Score = 78.2 bits (191), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 94/188 (50%), Gaps = 13/188 (6%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF----- 116
           S++      LF D +A++V DI+TV   I + A   N   +  + +    L GG      
Sbjct: 55  SIFGQGENPLFSDHKAMHVSDIVTV--VISEAAKSSNTGSKQLSENDTSALGGGLFSSTG 112

Query: 117 --SLFGQQTPQMNG----NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
             S    +   +NG      N +   A  G GS ++       I+A +  IL+NGN  IS
Sbjct: 113 VNSAMNSKVADINGFSNVGFNSNSSSAYKGSGSATKDASFTTTISARIVKILKNGNYYIS 172

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G +E+ ++D+ + + ++G++RP D+D +N ++  +I++A+I Y  +G      +   G +
Sbjct: 173 GKREILIDDQKQIVQLSGVIRPYDIDQYNKINSSQISDAKILYKTEGDMDRATQQGWGTK 232

Query: 231 LIENLSPL 238
           +++++ P 
Sbjct: 233 IVQSIWPF 240


>gi|110816539|sp|Q46PF8|FLGH_RALEJ RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 229

 Score = 78.2 bits (191), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 88/186 (47%), Gaps = 17/186 (9%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS-------LHRKL 112
           S++  S+A   LF+D R  NVGDILT+ I  +  A  ++ T  SR  S       + + L
Sbjct: 52  SIFASSYAGNPLFEDRRPRNVGDILTIVITENVNATKNSGTNASRTGSTSMAFDAVPKAL 111

Query: 113 SGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
           +G FS         + N + +G  A    G  S A   N  I   V  +L NGNL++SG 
Sbjct: 112 AGLFS--------SSSNASINGANALKASGGASAANTFNGTITVTVLEVLANGNLVVSGE 163

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +++ +N     +  +G+V P+ +   N V   ++A+ARI Y  KG   E        +  
Sbjct: 164 KQLAINQGAEFIRFSGVVNPRTITGDNGVLSTQVADARIEYTAKGYIDEAQNMGWLQRFF 223

Query: 233 ENLSPL 238
            N+SP 
Sbjct: 224 LNVSPF 229


>gi|284007172|emb|CBA72456.1| flagellar basal body L-ring protein FlgH [Arsenophonus nasoniae]
          Length = 249

 Score = 78.2 bits (191), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 110/246 (44%), Gaps = 30/246 (12%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           R+ F ++C + ++ GC    + I   P +S  G +  E    P    D K + S  ++  
Sbjct: 24  RWRFGIICLAVIMSGC----AYIPKKPLVS--GPTTVEPAERP----DLKVTGSIYQASQ 73

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH--RKLSGGFSLFG 120
               S+  LF+D R  +VGD LT+        +       S+N+S +  RK   GFS   
Sbjct: 74  PVNYSYQPLFEDRRPRHVGDTLTI--------ILQENVSASKNSSANASRKGKSGFS--A 123

Query: 121 QQTPQMNGNL--------NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
             TPQ+   L        + +G     GKG  +        I   VT +L NGNL + G 
Sbjct: 124 GATPQVLNKLVGVDKLQFDMEGENEFGGKGGANANNTFKGTITVTVTKLLANGNLQVVGE 183

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +++ +N     +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +++
Sbjct: 184 KQIAINQGTEYIRFSGVVNPRTISGSNTVNSTQVADARIEYVGDGYINEAQNMGWLQRIL 243

Query: 233 ENLSPL 238
            N+SP 
Sbjct: 244 LNISPF 249


>gi|73539453|ref|YP_299820.1| flagellar basal body L-ring protein [Ralstonia eutropha JMP134]
 gi|72122790|gb|AAZ64976.1| Flagellar L-ring protein [Ralstonia eutropha JMP134]
          Length = 232

 Score = 78.2 bits (191), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 88/186 (47%), Gaps = 17/186 (9%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS-------LHRKL 112
           S++  S+A   LF+D R  NVGDILT+ I  +  A  ++ T  SR  S       + + L
Sbjct: 55  SIFASSYAGNPLFEDRRPRNVGDILTIVITENVNATKNSGTNASRTGSTSMAFDAVPKAL 114

Query: 113 SGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
           +G FS         + N + +G  A    G  S A   N  I   V  +L NGNL++SG 
Sbjct: 115 AGLFS--------SSSNASINGANALKASGGASAANTFNGTITVTVLEVLANGNLVVSGE 166

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +++ +N     +  +G+V P+ +   N V   ++A+ARI Y  KG   E        +  
Sbjct: 167 KQLAINQGAEFIRFSGVVNPRTITGDNGVLSTQVADARIEYTAKGYIDEAQNMGWLQRFF 226

Query: 233 ENLSPL 238
            N+SP 
Sbjct: 227 LNVSPF 232


>gi|224158892|ref|XP_002338021.1| predicted protein [Populus trichocarpa]
 gi|222870339|gb|EEF07470.1| predicted protein [Populus trichocarpa]
          Length = 349

 Score = 78.2 bits (191), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 84/171 (49%), Gaps = 17/171 (9%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           L  D++A  VGD+LTV +  +  A     TG  R N+L   LS G           +G++
Sbjct: 41  LMADNKAFRVGDVLTVQVFENSSATTSADTGTRRRNALSADLSHG-----------SGSV 89

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQEVRVNDEIRSLNVT 187
                G         R ++ N ++A +   V  +L NG+L++ G Q + VN+E + + + 
Sbjct: 90  AQTAAGLGGTFDGGGRTQRTNRVLATLTVSVQEVLANGDLLVGGEQTLTVNEEPQKVTLQ 149

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPP---IGHQLIENL 235
           G VRP D+   N V   ++A+ARISY G+G   E  R P   +G  L+  L
Sbjct: 150 GRVRPLDISDGNVVLSTRLADARISYVGEGDLAERSRRPCCVLGAALLAGL 200


>gi|157373204|ref|YP_001471804.1| flagellar basal body L-ring protein [Shewanella sediminis HAW-EB3]
 gi|157315578|gb|ABV34676.1| flagellar L-ring protein [Shewanella sediminis HAW-EB3]
          Length = 220

 Score = 78.2 bits (191), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 104/213 (48%), Gaps = 34/213 (15%)

Query: 14  LLFGCHSSISEI---TGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAA 70
           LL GC ++  E     G P+ +P     + +  +P    D K+  + ++ Y L       
Sbjct: 11  LLSGCAANFPEADTKPGQPEWAPP----EIDYSLP----DAKDGSAYRQGYML------T 56

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LFKD RA   GDILTV +   D+  + ++   ++ N   + LS      G Q     G+ 
Sbjct: 57  LFKDKRAFREGDILTVAL---DEKTYSSKRADTKANK-EQDLS-----IGAQASA--GDS 105

Query: 131 NYDGGGASS------GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
           +Y G G  S      G GS ++  +L+  I   V  +L NG L+I G + +R+N     L
Sbjct: 106 SYSGAGDGSLARGFKGSGSSTQQNQLSGSITVTVAKVLPNGALLIRGEKWLRLNQGDEYL 165

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + G++R  D+   N++S  +IA+ARI YGG+G
Sbjct: 166 RLLGLIRTDDIGNDNTISSQRIADARIIYGGQG 198


>gi|78358196|ref|YP_389645.1| flagellar basal body L-ring protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|110816529|sp|Q30WJ6|FLGH_DESDG RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|78220601|gb|ABB39950.1| flagellar L-ring protein FlgH [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 234

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/189 (32%), Positives = 98/189 (51%), Gaps = 13/189 (6%)

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS--- 117
           SL+ D +A  L+ D RA  VGDI+ ++I  + +A     T  ++ ++    +S  F    
Sbjct: 47  SLFSDENADLLYADYRARRVGDIVLINIVENSKAENKASTSTNKESTGEYGVSSFFDRSK 106

Query: 118 --LFGQQTPQMNGN------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
             +   QT  ++G       L +      SG G  +R   +   IAA VT +L  G + +
Sbjct: 107 VGIIPGQT-LLSGRTGDVPLLKFSSVSDFSGDGETTRENTVTATIAARVTRVLPGGLMQV 165

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
            GS+E RVN+E + + V+G+VR  DV   NSV   ++A+ARISY GKG  ++  R     
Sbjct: 166 EGSRETRVNEETQIVTVSGLVRTSDVADDNSVMSTQMADARISYYGKGVISDKQRVGWFT 225

Query: 230 QLIENLSPL 238
           +L++NL P 
Sbjct: 226 RLMDNLWPF 234


>gi|94987185|ref|YP_595118.1| flagellar basal body L-ring protein [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731434|emb|CAJ54797.1| Flagellar basal body L-ring protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 230

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 115/247 (46%), Gaps = 51/247 (20%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA-ALF 72
           +L GC +        P ++P  + ++               DS     SL+  + +  LF
Sbjct: 13  ILTGCSAPNKTPVVAPPITPPPAYVEPE-------------DSYSNPGSLYSSAESDGLF 59

Query: 73  KDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS----GGFSLFGQQTPQMNG 128
            D+RA  VGDI+ V I        +N T +++ ++   K +    G  + FG+Q      
Sbjct: 60  ADTRARRVGDIVMVKI-------VENNTAKNKADTTADKKTANTYGIDAFFGRQ------ 106

Query: 129 NLNYDGGGASS-GKGSIS----------------RAEKLNLLIAAIVTAILENGNLIISG 171
              Y GGG++    GS++                R   +N  IAA V  ++  G L I G
Sbjct: 107 ---YIGGGSTKIPVGSVAFDTTSESGTTSTGETKREGAINGTIAARVLRVMPGGLLEIEG 163

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            +E RVN+E + + +TG++RP D++  NS+  ++I++A+I+Y G+G  +E  +P    + 
Sbjct: 164 VRETRVNNETQYIVITGLIRPMDIEPDNSIMSNRISDAKIAYYGQGVLSEKQKPGWFTRF 223

Query: 232 IENLSPL 238
           ++ L P 
Sbjct: 224 MDTLWPF 230


>gi|88704303|ref|ZP_01102017.1| flagellar L-ring protein FlgH [Congregibacter litoralis KT71]
 gi|88701354|gb|EAQ98459.1| flagellar L-ring protein FlgH [Congregibacter litoralis KT71]
          Length = 229

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 86/161 (53%), Gaps = 8/161 (4%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+ D+ +  LF+D RA  +GDI++V +     A     T  S++NS+        ++FG
Sbjct: 50  SLYADNRSMFLFEDVRAHEIGDIVSVVLVESTSATKSADTDVSKDNSVSIV---DPTIFG 106

Query: 121 QQTPQMNGNLNY----DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                 NG  N         A   +GS +++ +LN  IA  V+ +L NGNL I G + ++
Sbjct: 107 APVTINNGRYNLGTELSSSSAFESEGSSNQSNRLNGSIAVQVSRVLPNGNLEIQGEKWIK 166

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +N     + + GIVRP+D+   N++    +A+ARISYGG G
Sbjct: 167 INQGDEYIRLRGIVRPEDLSPTNTIPSTLVADARISYGGTG 207


>gi|212637788|ref|YP_002314313.1| flagellar basal body L-ring protein [Shewanella piezotolerans WP3]
 gi|212559272|gb|ACJ31726.1| Flagellar L-ring protein [Shewanella piezotolerans WP3]
          Length = 224

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 103/211 (48%), Gaps = 30/211 (14%)

Query: 14  LLFGCHSSISEI---TGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA- 69
           LL GC +   E     G P+ +P               ID+   D+  K  S++R     
Sbjct: 15  LLSGCVAHFPEPDTEPGKPEWAPPE-------------IDYSLPDA--KDGSVYRPGFML 59

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN-- 127
            LFKD RA   GDILTV +   D+  + ++   ++ N      + G S+ GQ T   N  
Sbjct: 60  TLFKDKRAFREGDILTVAL---DEKTYSSKRADTKTNK-----ASGLSIDGQGTTGSNSV 111

Query: 128 -GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
            G+   + G + +G GS ++  +L+  I   V  +L NG L+I G + +R+N     L +
Sbjct: 112 AGSGEANMGRSFNGTGSSTQQNQLSGSITVTVAKVLPNGALLIRGEKWLRLNQGDEYLRL 171

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            G++R  D+   N++S  +IA+ARI YGG+G
Sbjct: 172 LGLIRTDDIGNDNTISSQRIADARIIYGGQG 202


>gi|254227986|ref|ZP_04921416.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
 gi|151939482|gb|EDN58310.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
          Length = 233

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 87/161 (54%), Gaps = 8/161 (4%)

Query: 59  KSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG-GF 116
           +S SL+R  +   LF+D RA  VGD+LTV +  +  +     T   ++++++      G 
Sbjct: 57  QSGSLYRHQYTMTLFQDRRAYRVGDVLTVQLSEETSSSKKAGTKFGKSSAVNFAAPTIGT 116

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
             F +    ++G+ N+DG  +SS      +  KL   I   V  +L NG L ISG + +R
Sbjct: 117 KTFDELGVSVDGSRNFDGSASSS------QGNKLQGAITVTVHEVLPNGVLRISGEKWLR 170

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +N     + +TGIVR  D++  N VS  +IA+ARI+Y G+G
Sbjct: 171 LNQGDEFIRLTGIVRVDDINRSNQVSSQRIADARITYAGRG 211


>gi|34498337|ref|NP_902552.1| flagellar L-ring protein precursor flgH [Chromobacterium violaceum
           ATCC 12472]
 gi|81655149|sp|Q7NU21|FLGH2_CHRVO RecName: Full=Flagellar L-ring protein 2; AltName: Full=Basal body
           L-ring protein 2; Flags: Precursor
 gi|34104191|gb|AAQ60550.1| flagellar L-ring protein precursor flgH [Chromobacterium violaceum
           ATCC 12472]
          Length = 227

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 80/155 (51%), Gaps = 4/155 (2%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           S+  +F+D+  + VGD L + I+ +       Q   +R + L   ++ G  +    +   
Sbjct: 52  SYRPMFQDAMPIQVGDTLQITIQENSSTSQSEQVTDTRTSGLSSNITAGVKIPFLPSGLA 111

Query: 127 NG----NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           +G    + N  G   ++GKG+   A      I   VT +L NGNL++SG + VR+N +  
Sbjct: 112 SGLGGTSFNSSGSANNTGKGNNQVATTFVSSITVTVTDVLANGNLVVSGEKMVRINSDTE 171

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           S+ ++G+V P+DV    +VS  K+A+ARI    KG
Sbjct: 172 SIRLSGVVNPRDVTPDRTVSSLKVADARIEQQTKG 206


>gi|126452858|ref|YP_001064567.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           1106a]
 gi|242316923|ref|ZP_04815939.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1106b]
 gi|126226500|gb|ABN90040.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1106a]
 gi|242140162|gb|EES26564.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1106b]
          Length = 240

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 78/165 (47%), Gaps = 11/165 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  NVGDILT+ I   I+        T R  N S     +G   
Sbjct: 65  SIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 124

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 125 GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQML 178

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +N     +  +GIV P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 179 INQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYINE 223


>gi|167585197|ref|ZP_02377585.1| flagellar basal body L-ring protein [Burkholderia ubonensis Bu]
          Length = 229

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 83/171 (48%), Gaps = 11/171 (6%)

Query: 56  STKKSYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDN--QTGRSRNNSLHRK 111
           S +   S++   +A   LF+D R  NVGDILT+ I  +  A   +   T R+ N +    
Sbjct: 48  SMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRAGNTNFDVP 107

Query: 112 LSGGFS-LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
            +G    LF +       NL+  GG   +  G  S A   N  I   VT +L NGNLI+S
Sbjct: 108 TAGFLGGLFAK------ANLSAAGGNKFTATGGASAANTFNGTITVTVTNVLPNGNLIVS 161

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G +++ +N     +  +G+V P  +   NSV   ++A+A+I Y  KG   E
Sbjct: 162 GEKQMLINQGNEFVRFSGVVNPNTISGANSVFSTQVADAKIEYSAKGYINE 212


>gi|262396032|ref|YP_003287885.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
 gi|262339626|gb|ACY53420.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
          Length = 223

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 87/161 (54%), Gaps = 8/161 (4%)

Query: 59  KSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG-GF 116
           +S SL+R  +   LF+D RA  VGD+LTV +  +  +     T   ++++++      G 
Sbjct: 47  QSGSLYRHQYTMTLFQDRRAYRVGDVLTVQLSEETSSSKKAGTKFGKSSAVNFAAPTIGT 106

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
             F +    ++G+ N+DG  +SS      +  KL   I   V  +L NG L ISG + +R
Sbjct: 107 KTFDELGVSVDGSRNFDGSASSS------QGNKLQGAITVTVHEVLPNGVLRISGEKWLR 160

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +N     + +TGIVR  D++  N VS  +IA+ARI+Y G+G
Sbjct: 161 LNQGDEFIRLTGIVRVDDINRSNQVSSQRIADARITYAGRG 201


>gi|194365677|ref|YP_002028287.1| flagellar basal body L-ring protein [Stenotrophomonas maltophilia
           R551-3]
 gi|226701934|sp|B4SIL5|FLGH_STRM5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|194348481|gb|ACF51604.1| flagellar L-ring protein [Stenotrophomonas maltophilia R551-3]
          Length = 230

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 84/159 (52%), Gaps = 16/159 (10%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS----GGFSLFGQQTPQM 126
           L+ D RA +VGD+LT+ +        +N T ++  N+   K S    G  S+FG     +
Sbjct: 62  LYSDRRARDVGDLLTISL-------LENTTAQTSANTATNKESNLSLGTPSIFGAPV-TL 113

Query: 127 NGN--LNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
            G   L+    GA   +GKG+ +++ +L   +   V   L NGNL++ G + +R+N    
Sbjct: 114 GGKDILSASAKGARDFTGKGNSAQSNRLQGNVTVTVIQRLPNGNLVVQGQKNLRLNQGDE 173

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            + V GIVRP D+   N++   ++AEARI YGG+G   +
Sbjct: 174 LVQVQGIVRPGDISQDNTIPSSRVAEARIVYGGRGPVAQ 212


>gi|119503647|ref|ZP_01625730.1| Flagellar basal body L-ring protein [marine gamma proteobacterium
           HTCC2080]
 gi|119460709|gb|EAW41801.1| Flagellar basal body L-ring protein [marine gamma proteobacterium
           HTCC2080]
          Length = 228

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 94/195 (48%), Gaps = 25/195 (12%)

Query: 45  PFLGIDFKNSDSTKKSYSLW-RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRS 103
           P   ID+ ++       SL+ +    +LF+D+RA ++GDI++V +          Q   S
Sbjct: 31  PIEPIDYADNREGTTPASLYNKRGGLSLFEDTRARSIGDIVSVVL----------QESTS 80

Query: 104 RNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGAS-------------SGKGSISRAEKL 150
              S    LS G S  G   P + G     GGG S              G+GS +++ +L
Sbjct: 81  AAKSADTDLSKG-SDIGVDAPVLFGEPFNFGGGDSYDLSQSIASEYGFQGQGSSNQSNRL 139

Query: 151 NLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEAR 210
              IA  V  +L NGNL++ G + +++N     + + GI+RP+D+   N++    +A+AR
Sbjct: 140 QGAIAVQVAKVLPNGNLVVQGEKWIKLNQGDEFIQLRGIIRPEDISPLNTIPSSLVADAR 199

Query: 211 ISYGGKGRTTELLRP 225
           ISYGG G   E   P
Sbjct: 200 ISYGGTGIIEEANTP 214


>gi|152990361|ref|YP_001356083.1| flagellar L-ring protein FlgH [Nitratiruptor sp. SB155-2]
 gi|151422222|dbj|BAF69726.1| flagellar L-ring protein FlgH [Nitratiruptor sp. SB155-2]
          Length = 206

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 86/178 (48%), Gaps = 19/178 (10%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN- 129
           LF D +A  VGD++T++I  +      +    SR+NS+           G  TP++ G  
Sbjct: 38  LFSDMKAYEVGDVVTININENLSGKGQSDVQTSRSNSVG---------LGVPTPKIKGRS 88

Query: 130 -------LNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                  L+ DG   +S  G+G   R+ KL   I A V  +  NGNL I G + +++N +
Sbjct: 89  VVQGDELLSLDGSSQNSFSGQGGTKRSAKLIAKITARVVKVYPNGNLYIVGKKYLKINSD 148

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            + L + GIV P+D+   NS+   +I++  + Y G+G  T+   P    + +  + P 
Sbjct: 149 TQYLKIAGIVNPKDISPDNSIDSSRISDMYVEYNGQGFVTDGQEPGWLAKFVMKIWPF 206


>gi|121599856|ref|YP_994294.1| flagellar basal body L-ring protein [Burkholderia mallei SAVP1]
 gi|162210053|ref|YP_331882.2| flagellar basal body L-ring protein [Burkholderia pseudomallei
           1710b]
 gi|167001540|ref|ZP_02267335.1| flagellar L-ring protein FlgH [Burkholderia mallei PRL-20]
 gi|217424924|ref|ZP_03456420.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 576]
 gi|226199862|ref|ZP_03795413.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei Pakistan
           9]
 gi|254175119|ref|ZP_04881780.1| flagellar L-ring protein FlgH [Burkholderia mallei ATCC 10399]
 gi|254196301|ref|ZP_04902725.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei S13]
 gi|254259034|ref|ZP_04950088.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1710a]
 gi|254295817|ref|ZP_04963274.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 406e]
 gi|254359735|ref|ZP_04976006.1| flagellar L-ring protein FlgH [Burkholderia mallei 2002721280]
 gi|121228666|gb|ABM51184.1| flagellar L-ring protein FlgH [Burkholderia mallei SAVP1]
 gi|148028949|gb|EDK86881.1| flagellar L-ring protein FlgH [Burkholderia mallei 2002721280]
 gi|157805743|gb|EDO82913.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 406e]
 gi|160696164|gb|EDP86134.1| flagellar L-ring protein FlgH [Burkholderia mallei ATCC 10399]
 gi|169653044|gb|EDS85737.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei S13]
 gi|217391944|gb|EEC31970.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 576]
 gi|225928213|gb|EEH24249.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei Pakistan
           9]
 gi|243062741|gb|EES44927.1| flagellar L-ring protein FlgH [Burkholderia mallei PRL-20]
 gi|254217723|gb|EET07107.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1710a]
          Length = 240

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 78/165 (47%), Gaps = 11/165 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  NVGDILT+ I   I+        T R  N S     +G   
Sbjct: 65  SIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 124

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 125 GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQML 178

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +N     +  +GIV P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 179 INQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYINE 223


>gi|124385970|ref|YP_001028057.1| flagellar basal body L-ring protein [Burkholderia mallei NCTC
           10229]
 gi|126448432|ref|YP_001082864.1| flagellar basal body L-ring protein [Burkholderia mallei NCTC
           10247]
 gi|124293990|gb|ABN03259.1| flagellar L-ring protein FlgH [Burkholderia mallei NCTC 10229]
 gi|126241302|gb|ABO04395.1| flagellar L-ring protein FlgH [Burkholderia mallei NCTC 10247]
          Length = 238

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 78/165 (47%), Gaps = 11/165 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  NVGDILT+ I   I+        T R  N S     +G   
Sbjct: 63  SIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 122

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 123 GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQML 176

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +N     +  +GIV P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 177 INQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYINE 221


>gi|134283676|ref|ZP_01770375.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 305]
 gi|134245085|gb|EBA45180.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 305]
          Length = 232

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 78/165 (47%), Gaps = 11/165 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  NVGDILT+ I   I+        T R  N S     +G   
Sbjct: 57  SIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 116

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 117 GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQML 170

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +N     +  +GIV P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 171 INQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYINE 215


>gi|315127350|ref|YP_004069353.1| flagellar basal body L-ring protein [Pseudoalteromonas sp. SM9913]
 gi|315015864|gb|ADT69202.1| flagellar basal body L-ring protein [Pseudoalteromonas sp. SM9913]
          Length = 227

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 88/162 (54%), Gaps = 14/162 (8%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLS-GGFSLFGQQTPQMN 127
           L+ D +AL  GDI+TV ++   QA      +T +  + SL   +  GG  +       + 
Sbjct: 59  LYADKKALRTGDIITVKLQESTQATKAAKTETDKQTDASLDPVIGLGGLPV------NIG 112

Query: 128 GN-LNYDGGGASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQEVRVNDEIRS 183
           G+ + +  G  +S KG  S++ + N L+  I   V  +L NGNL+I G + + +N     
Sbjct: 113 GDSIQFGVGSDASFKGD-SKSNQSNSLVGDISVNVMRVLPNGNLVIRGEKWLTLNTGEEF 171

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           + + G+VRPQDV+A N+V  ++IA ARI Y GKG+T E   P
Sbjct: 172 IRLEGLVRPQDVNADNTVESNRIANARIQYSGKGQTQEAQSP 213


>gi|53717917|ref|YP_106903.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           K96243]
 gi|126440336|ref|YP_001057325.1| flagellar basal body L-ring protein [Burkholderia pseudomallei 668]
 gi|237810464|ref|YP_002894915.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei MSHR346]
 gi|254182137|ref|ZP_04888734.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1655]
 gi|81380628|sp|Q63YB2|FLGH_BURPS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|52208331|emb|CAH34264.1| flagellar L-ring protein precursor [Burkholderia pseudomallei
           K96243]
 gi|126219829|gb|ABN83335.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 668]
 gi|184212675|gb|EDU09718.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1655]
 gi|237503889|gb|ACQ96207.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei MSHR346]
          Length = 240

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 79/165 (47%), Gaps = 11/165 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDN--QTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  NVGDILT+ I  +  A   +   T R  N S     +G   
Sbjct: 65  SIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 124

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 125 GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQML 178

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +N     +  +GIV P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 179 INQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYINE 223


>gi|224373239|ref|YP_002607611.1| flagellar L-ring protein FlgH [Nautilia profundicola AmH]
 gi|223589417|gb|ACM93153.1| flagellar L-ring protein FlgH [Nautilia profundicola AmH]
          Length = 237

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 87/170 (51%), Gaps = 25/170 (14%)

Query: 71  LFKDSRALNVGDILTV----DIRIDDQAVFDNQTGRSRNNSLH-RKLSGGFSLFGQ---- 121
           LF D++A+ V DI+TV    +++   QA        + N  L    +SGG S+ G+    
Sbjct: 60  LFSDTKAMKVNDIVTVIITEEVKQSTQASKKLSETNADNGGLFDATVSGGVSINGKDHTF 119

Query: 122 -------QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                    P MN N ++ G G         R E     I+A +  +L+NGN  I G++E
Sbjct: 120 GKTGLSLNFPSMNSNRSFQGSGTQQ------RNETFQTTISARIVKVLKNGNYFIMGTRE 173

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG---RTTE 221
           + V+ + + + ++G++RPQD+ A N++    IA+A+I+Y  +G   R TE
Sbjct: 174 IYVDGQKQLIQISGVIRPQDIAADNTIDSKYIADAKIAYKTEGDIKRYTE 223


>gi|295111396|emb|CBL28146.1| Flagellar basal body L-ring protein [Synergistetes bacterium SGP1]
          Length = 200

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 91/178 (51%), Gaps = 16/178 (8%)

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIR----IDDQAVFDNQTGRSRNNSLHRKLSGG 115
           + SLW D       D R   VGD++TV +       D+A  D +  +S +NS+    S G
Sbjct: 32  AASLW-DDRTNWIVDVRPGRVGDVVTVLVNERTNAKDEATMDLK--KSSSNSV----SDG 84

Query: 116 FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
             +      +    L+     +S+G GS  R       +A +VT +L NGNL+I G+++V
Sbjct: 85  TGIL-----KFIRALSLTSKNSSAGDGSFERKHHATATVACLVTEVLPNGNLVIEGTRDV 139

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           R ++E   + + G++RPQDV++ N ++   +A A ++  G+G      +P I  Q+++
Sbjct: 140 RTSEETLQIQLVGVIRPQDVNSDNQINSSLVANAELAVKGRGAIARTQKPGIISQILQ 197


>gi|163784420|ref|ZP_02179304.1| hypothetical protein HG1285_04703 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880311|gb|EDP73931.1| hypothetical protein HG1285_04703 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 232

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 81/171 (47%), Gaps = 5/171 (2%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL---FGQQTPQMN 127
           LF D +AL VGD +T+ I  +       Q+   ++ +L+  L     L     ++TP   
Sbjct: 64  LFSDDKALRVGDTITIKITENISGQGSAQSDAKKDTNLNYDLPSPTWLGKNLVKKTPI-- 121

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
             +      +  G GS  R  KL   I A V  +  NGNL + G + +R+ND+ + L ++
Sbjct: 122 AGMTAKSSDSFKGSGSTKRQAKLIATITARVVKVYPNGNLFVVGKKIIRINDDTQILKIS 181

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           GIV+P  +   NSV   +I++  + Y GKG   +  RP    + +  + P 
Sbjct: 182 GIVKPTYIQQDNSVDSSRISDMYVEYNGKGYIADHQRPGWLARFLAKIWPF 232


>gi|83718865|ref|YP_440804.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           E264]
 gi|257140545|ref|ZP_05588807.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           E264]
 gi|83652690|gb|ABC36753.1| flagellar L-ring protein FlgH [Burkholderia thailandensis E264]
          Length = 240

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 78/165 (47%), Gaps = 11/165 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  NVGDILT+ I   I+        T R  N S     +G   
Sbjct: 65  SIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 124

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 125 GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGQKQML 178

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +N     +  +G+V P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 179 INQGNEFVRFSGVVNPNTISGQNSVYSTQVADARIEYSAKGYINE 223


>gi|238919262|ref|YP_002932777.1| flagellar basal body L-ring protein [Edwardsiella ictaluri 93-146]
 gi|238868831|gb|ACR68542.1| flagellar L-ring protein FlgH, putative [Edwardsiella ictaluri
           93-146]
          Length = 228

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 82/177 (46%), Gaps = 14/177 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS-------LHRKLSGGFSLFG 120
           +  LF+D R  NVGDILT+ ++ +  A  ++    SR+ S       + R L G   LFG
Sbjct: 58  YQPLFEDRRPRNVGDILTIVLQENVSASKNSSANASRDGSSKFDFSTVPRYLEG---LFG 114

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N+  DG    SGKG           I   V  +  NGNL + G +++ +N  
Sbjct: 115 N----ARANMEVDGDNKFSGKGGAKANNTFTGTITVTVDQVQANGNLKVVGEKQIAINQG 170

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              +  +G+V P+ +  +NSVS  ++A+ARI Y G G   E        +   NLSP
Sbjct: 171 TEYIRFSGVVNPRTISGNNSVSSTQVADARIEYVGSGYINEAQNMGWLQRFFLNLSP 227


>gi|170694395|ref|ZP_02885549.1| flagellar L-ring protein [Burkholderia graminis C4D1M]
 gi|170140818|gb|EDT08992.1| flagellar L-ring protein [Burkholderia graminis C4D1M]
          Length = 232

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 89/181 (49%), Gaps = 11/181 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL-SGGF-- 116
           S++   +A   LF+D R  NVGDILT+ I+ +  A   +  G +RN +    + + GF  
Sbjct: 57  SIYNPGYAGRPLFEDQRPRNVGDILTIVIQENVNATKSSGAGVNRNGTTSFDVPTAGFLG 116

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LFG+       NL+  G    +  G  + +   N  I   VT +L NGNL++SG +++ 
Sbjct: 117 GLFGK------ANLSASGANKFTSTGGANASNTFNGTITVTVTGVLPNGNLMVSGEKQML 170

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +G+V P  +   N+V   ++A+A+I Y  KG   E        +   N+S
Sbjct: 171 INQGNEFVRFSGVVNPNTISNLNAVYSTQVADAKIEYSAKGYVDEAENMGWLQRFFLNVS 230

Query: 237 P 237
           P
Sbjct: 231 P 231


>gi|167917167|ref|ZP_02504258.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           BCC215]
          Length = 201

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 83/182 (45%), Gaps = 11/182 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  NVGDILT+ I   I+        T R  N S     +G   
Sbjct: 26  SIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 85

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 86  GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQML 139

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +GIV P  +   NSV   ++A+ARI Y  KG   E        +   N++
Sbjct: 140 INQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIA 199

Query: 237 PL 238
           P 
Sbjct: 200 PW 201


>gi|269960119|ref|ZP_06174495.1| Flagellar L-ring protein precursor [Vibrio harveyi 1DA3]
 gi|269835090|gb|EEZ89173.1| Flagellar L-ring protein precursor [Vibrio harveyi 1DA3]
          Length = 223

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 86/162 (53%), Gaps = 10/162 (6%)

Query: 59  KSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFD--NQTGRSRNNSLHRKLSGG 115
           KS SL+R  +   LF+D RA  VGD+LTV +  + ++      Q G+S          G 
Sbjct: 47  KSGSLYRHQYTMTLFQDRRAYRVGDVLTVQLSEETESSKKAGTQFGKSSTVDFATPTIGT 106

Query: 116 FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
            ++  +    ++G+ N+DG  +SS      +  KL   I   V  +L NG L ISG + +
Sbjct: 107 KTI-DELGVSIDGSRNFDGSASSS------QGNKLQGAITVTVHEVLPNGVLRISGEKWL 159

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           R+N     + +TGIVR  D++  N VS  +IA+ARI+Y G+G
Sbjct: 160 RLNQGDEFIRLTGIVRVDDINRSNQVSSQRIADARITYAGRG 201


>gi|167822322|ref|ZP_02453793.1| flagellar basal body L-ring protein [Burkholderia pseudomallei 9]
          Length = 211

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 78/170 (45%), Gaps = 9/170 (5%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS-LFGQQTPQMN 127
           LF+D R  NVGDILT+ I   I+        T R  N S     +G    LF +      
Sbjct: 47  LFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLGGLFNK------ 100

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +
Sbjct: 101 ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFS 160

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           GIV P  +   NSV   ++A+ARI Y  KG   E        +   N++P
Sbjct: 161 GIVNPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIAP 210


>gi|53724568|ref|YP_104801.1| flagellar basal body L-ring protein [Burkholderia mallei ATCC
           23344]
 gi|67641541|ref|ZP_00440318.1| flagellar L-ring protein FlgH [Burkholderia mallei GB8 horse 4]
 gi|254207233|ref|ZP_04913584.1| flagellar L-ring protein FlgH [Burkholderia mallei JHU]
 gi|81603729|sp|Q62ES7|FLGH_BURMA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|110816525|sp|Q3JX21|FLGH_BURP1 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|52427991|gb|AAU48584.1| flagellar L-ring protein FlgH [Burkholderia mallei ATCC 23344]
 gi|76580178|gb|ABA49653.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1710b]
 gi|147752775|gb|EDK59841.1| flagellar L-ring protein FlgH [Burkholderia mallei JHU]
 gi|238522492|gb|EEP85936.1| flagellar L-ring protein FlgH [Burkholderia mallei GB8 horse 4]
          Length = 222

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 78/165 (47%), Gaps = 11/165 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  NVGDILT+ I   I+        T R  N S     +G   
Sbjct: 47  SIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 106

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 107 GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQML 160

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +N     +  +GIV P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 161 INQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYINE 205


>gi|167892414|ref|ZP_02479816.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           7894]
          Length = 213

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 83/182 (45%), Gaps = 11/182 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  NVGDILT+ I   I+        T R  N S     +G   
Sbjct: 38  SIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 97

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 98  GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQML 151

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +GIV P  +   NSV   ++A+ARI Y  KG   E        +   N++
Sbjct: 152 INQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIA 211

Query: 237 PL 238
           P 
Sbjct: 212 PW 213


>gi|332533172|ref|ZP_08409041.1| flagellar L-ring protein FlgH [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037454|gb|EGI73908.1| flagellar L-ring protein FlgH [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 227

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 84/161 (52%), Gaps = 12/161 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLS-GGFSLFGQQTPQMN 127
           L+ D +AL  GDI+TV ++   QA      +T +  + SL   +  GG  +       + 
Sbjct: 59  LYSDKKALRTGDIITVKLQESTQATKAAKTETDKETDASLDPVIGLGGLPV------NIG 112

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQEVRVNDEIRSL 184
           G+    G G+ S     S++ + N L+  I   V  +L NGNL+I G + + +N     +
Sbjct: 113 GDSIQFGIGSDSSFTGDSKSNQSNSLVGDISVNVMRVLPNGNLVIRGEKWLTLNTGEEFI 172

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            + G+VRPQDV A N+V  ++IA ARI Y GKG+T E   P
Sbjct: 173 RLEGLVRPQDVSADNTVESNRIANARIQYSGKGQTQEAQSP 213


>gi|239815251|ref|YP_002944161.1| flagellar L-ring protein [Variovorax paradoxus S110]
 gi|239801828|gb|ACS18895.1| flagellar L-ring protein [Variovorax paradoxus S110]
          Length = 201

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 87/171 (50%), Gaps = 9/171 (5%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS-GGFSLFGQQTP 124
           +S   L  D++A  VGD LTV +  +  A     TG  R N ++  ++  G  + GQ   
Sbjct: 37  NSFRPLTADNKAFRVGDSLTVQVFENSSASTSANTGTRRANDINGSVTQTGNRVVGQLGI 96

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
            + G   +DGGG +       RA KL   +   V  +L N  L ++G Q + VNDE++ +
Sbjct: 97  GVTGE--FDGGGRTQ------RANKLLATLTVTVKEVLANNELRVAGEQLLTVNDELQKV 148

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
           N+ G VRPQD+   N V   ++A+ARI+Y G+G   +  R     ++ + L
Sbjct: 149 NLEGRVRPQDISDGNVVLSTRLADARITYVGEGDVADRARRSAWRRIFDWL 199


>gi|167736706|ref|ZP_02409480.1| flagellar basal body L-ring protein [Burkholderia pseudomallei 14]
          Length = 179

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 78/171 (45%), Gaps = 9/171 (5%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS-LFGQQTPQMN 127
           LF+D R  NVGDILT+ I   I+        T R  N S     +G    LF +      
Sbjct: 15  LFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLGGLFNK------ 68

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +
Sbjct: 69  ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFS 128

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           GIV P  +   NSV   ++A+ARI Y  KG   E        +   N++P 
Sbjct: 129 GIVNPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIAPW 179


>gi|167717663|ref|ZP_02400899.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           DM98]
          Length = 210

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 78/170 (45%), Gaps = 9/170 (5%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS-LFGQQTPQMN 127
           LF+D R  NVGDILT+ I   I+        T R  N S     +G    LF +      
Sbjct: 46  LFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLGGLFNK------ 99

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +
Sbjct: 100 ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFS 159

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           GIV P  +   NSV   ++A+ARI Y  KG   E        +   N++P
Sbjct: 160 GIVNPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIAP 209


>gi|167900911|ref|ZP_02488116.1| flagellar basal body L-ring protein [Burkholderia pseudomallei NCTC
           13177]
          Length = 198

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 78/171 (45%), Gaps = 9/171 (5%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS-LFGQQTPQMN 127
           LF+D R  NVGDILT+ I   I+        T R  N S     +G    LF +      
Sbjct: 34  LFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLGGLFNK------ 87

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +
Sbjct: 88  ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFS 147

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           GIV P  +   NSV   ++A+ARI Y  KG   E        +   N++P 
Sbjct: 148 GIVNPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIAPW 198


>gi|167843912|ref|ZP_02469420.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           B7210]
 gi|167909131|ref|ZP_02496222.1| flagellar basal body L-ring protein [Burkholderia pseudomallei 112]
          Length = 203

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 78/165 (47%), Gaps = 11/165 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  NVGDILT+ I   I+        T R  N S     +G   
Sbjct: 28  SIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 87

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 88  GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQML 141

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +N     +  +GIV P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 142 INQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYINE 186


>gi|157959899|ref|YP_001499933.1| flagellar basal body L-ring protein [Shewanella pealeana ATCC
           700345]
 gi|157844899|gb|ABV85398.1| flagellar L-ring protein [Shewanella pealeana ATCC 700345]
          Length = 224

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 108/218 (49%), Gaps = 36/218 (16%)

Query: 14  LLFGCHSSISEI---TGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA- 69
           LL GC S I E+    G P+ +P               ID+   D+  K  S++R     
Sbjct: 15  LLSGCISHIPELDTKPGKPEWAPPE-------------IDYSLPDA--KDGSVYRPGFML 59

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
            LFKD RA   GDILTV +   D+  + +++  ++ N      + G SL GQ T    GN
Sbjct: 60  TLFKDKRAFREGDILTVAL---DEKTYSSKSADTKTNK-----NTGLSLDGQGT---TGN 108

Query: 130 LNYDGGGASS------GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
            +  G G ++      G GS ++  +L+  I   V  +L NG L+I G + +R+N     
Sbjct: 109 NSIAGSGEANLGSSFSGTGSSTQQNQLSGSITVTVAKVLPNGALLIRGEKWLRLNQGDEY 168

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           L + G++R  D+   N++S  +IA+ARI YGG+G  T+
Sbjct: 169 LRLLGLIRTDDIGNDNTISSQRIADARIIYGGQGAITD 206


>gi|167813805|ref|ZP_02445485.1| flagellar basal body L-ring protein [Burkholderia pseudomallei 91]
          Length = 209

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 73/154 (47%), Gaps = 9/154 (5%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS-LFGQQTPQMN 127
           LF+D R  NVGDILT+ I   I+        T R  N S     +G    LF +      
Sbjct: 45  LFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLGGLFNK------ 98

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +
Sbjct: 99  ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFS 158

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           GIV P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 159 GIVNPNTISGQNSVYSTQVADARIEYSAKGYINE 192


>gi|91785631|ref|YP_560837.1| flagellar basal body L-ring protein [Burkholderia xenovorans LB400]
 gi|91689585|gb|ABE32785.1| Flagellar L-ring protein [Burkholderia xenovorans LB400]
          Length = 234

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 78/156 (50%), Gaps = 13/156 (8%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFD-----NQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
           LF+D R  NVGDILT+ I+ +  A        N++G +  N       GG  LFG+    
Sbjct: 70  LFEDQRPRNVGDILTIVIQENVNATKSSGANANRSGNTNFNVPTAGFLGG--LFGKT--- 124

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              NL+  G    SG G  + +   N  I   VT +L NGNL++SG +++ +N     + 
Sbjct: 125 ---NLSATGANVFSGTGGANASNTFNGTITVTVTGVLPNGNLMVSGEKQMLINQGDEFVR 181

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            +G+V P  +   N+V   ++A+A+I Y  KG   E
Sbjct: 182 FSGVVNPNTISNLNAVYSTQVADAKIEYSAKGYLNE 217


>gi|296157453|ref|ZP_06840288.1| flagellar L-ring protein [Burkholderia sp. Ch1-1]
 gi|295892225|gb|EFG72008.1| flagellar L-ring protein [Burkholderia sp. Ch1-1]
          Length = 232

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 78/156 (50%), Gaps = 13/156 (8%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFD-----NQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
           LF+D R  NVGDILT+ I+ +  A        N++G +  N       GG  LFG+    
Sbjct: 68  LFEDQRPRNVGDILTIVIQENVNATKSSGANANRSGNTNFNVPTAGFLGG--LFGKT--- 122

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              NL+  G    SG G  + +   N  I   VT +L NGNL++SG +++ +N     + 
Sbjct: 123 ---NLSATGANVFSGTGGANASNTFNGTITVTVTGVLPNGNLMVSGEKQMLINQGDEFVR 179

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            +G+V P  +   N+V   ++A+A+I Y  KG   E
Sbjct: 180 FSGVVNPNTISNLNAVYSTQVADAKIEYSAKGYLNE 215


>gi|239817162|ref|YP_002946072.1| flagellar L-ring protein [Variovorax paradoxus S110]
 gi|239803739|gb|ACS20806.1| flagellar L-ring protein [Variovorax paradoxus S110]
          Length = 227

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 76/153 (49%), Gaps = 2/153 (1%)

Query: 69  AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           +ALF+D R  NVGDILT+ I     A  ++    SR  SL    +G   L G      + 
Sbjct: 60  SALFEDRRPRNVGDILTIVISERVNASKNSGASASRTGSLAADFAGIPKLLGSLLDGQDA 119

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
            L+  GG     KG  +     N +I   V  ++ NGNL++SG +++ +N     +  +G
Sbjct: 120 KLS--GGNKLDAKGGANANNTFNGVITVTVVDVMRNGNLLVSGEKQMGINQGTEYIRFSG 177

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +V P+ V  +N+V    +A+ARI Y  KG   E
Sbjct: 178 VVNPRTVSGNNTVPSTLVADARIEYTAKGYIDE 210


>gi|312880333|ref|ZP_07740133.1| flagellar L-ring protein [Aminomonas paucivorans DSM 12260]
 gi|310783624|gb|EFQ24022.1| flagellar L-ring protein [Aminomonas paucivorans DSM 12260]
          Length = 202

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 90/179 (50%), Gaps = 14/179 (7%)

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIR-IDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           + SLW++  A LF D +   VGDI+TV ++   D       T +  + S  +  +G F  
Sbjct: 34  AESLWQE-DANLFTDRKPSKVGDIVTVLVQETTDTKDEGKTTAKKTDKSGVQDWTGVFDF 92

Query: 119 FGQQTPQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                        +  G AS  +G G   R   +   I  +VT I   GNL++ G++++ 
Sbjct: 93  L----------RGFVIGAASDTTGDGKSERKHHIKTSIGCVVTEITPGGNLVLLGTRDLM 142

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
              E   ++ TG+VRP+D+  +N+VS +++A A I   GKG  + L +P I  Q+++++
Sbjct: 143 TQAEKMQVSFTGVVRPEDIGPNNTVSSNRVANAEIRVEGKGSISRLQKPGIFTQILQSI 201


>gi|91204381|emb|CAJ70881.1| strongly similar to flagellar L-ring protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 211

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 101/213 (47%), Gaps = 10/213 (4%)

Query: 34  MGSSLDENNRMPFLGIDFKNSDSTKKSY--SLWRDS---HAALFKDSRALNVGDILTVDI 88
           M  SL +   +P+L   F        +   SLW+     +  L+ D+RA+ +GDI+TV  
Sbjct: 1   MAESLMKKKTIPYLIACFTCIAFVTDAMGESLWQKRITLNTNLYNDNRAMRIGDIVTV-- 58

Query: 89  RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG---NLNYDGGGASSGKGSIS 145
            I++      +   S + S    ++   S F ++   +     N+         G G   
Sbjct: 59  TINESTAITGKEDSSADQSTSHNINVDASDFSKKLGALQDYLPNVKSQTEHTFGGTGQYD 118

Query: 146 RAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDK 205
            +  L L I A+VT IL NGNLII G++EV +N E  ++ V+GI+RP DV   N +    
Sbjct: 119 SSRSLQLEITAVVTEILSNGNLIIEGNREVDINKEKYNIKVSGIIRPIDVSVDNVIQSSS 178

Query: 206 IAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           IA A IS  GKG  T   +    ++L E +SP 
Sbjct: 179 IANASISLEGKGFLTNAAKRGWFYRLKEFVSPF 211


>gi|302392937|ref|YP_003828757.1| flagellar L-ring protein [Acetohalobium arabaticum DSM 5501]
 gi|302205014|gb|ADL13692.1| flagellar L-ring protein [Acetohalobium arabaticum DSM 5501]
          Length = 195

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 86/168 (51%), Gaps = 16/168 (9%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG----FS 117
           SL+ DS++  + + +A   GDILTV I     A     T   ++N ++     G      
Sbjct: 29  SLYEDSNSP-YGEHKAAEAGDILTVMISESSTADQQASTETGQSNEVNVGPGAGELDFVK 87

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           LF          LN +   +SS  GS S++  L   +   VT +L NGNL I G++E+ V
Sbjct: 88  LF---------RLNQED--SSSADGSTSQSGSLTAQMTVQVTEVLPNGNLKIEGTKEITV 136

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           N E++ + V GIVRP+D+   N+V+  KIA ++I Y G+G   +   P
Sbjct: 137 NAEMQKIEVEGIVRPEDITISNTVNSTKIANSKIKYVGEGAIGDRQEP 184


>gi|167568426|ref|ZP_02361300.1| flagellar basal body L-ring protein [Burkholderia oklahomensis
           C6786]
          Length = 216

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 83/182 (45%), Gaps = 11/182 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  N+GDILT+ I   I+        T R  N S     +G   
Sbjct: 41  SIYNPGYAGRPLFEDQRPRNIGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 100

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 101 GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQML 154

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +GIV P  +   NSV   ++A+ARI Y  KG   E        +   N++
Sbjct: 155 INQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIA 214

Query: 237 PL 238
           P 
Sbjct: 215 PW 216


>gi|167561207|ref|ZP_02354123.1| flagellar basal body L-ring protein [Burkholderia oklahomensis
           EO147]
          Length = 212

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 83/182 (45%), Gaps = 11/182 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  N+GDILT+ I   I+        T R  N S     +G   
Sbjct: 37  SIYNPGYAGRPLFEDQRPRNIGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 96

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 97  GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQML 150

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +GIV P  +   NSV   ++A+ARI Y  KG   E        +   N++
Sbjct: 151 INQGNEFVRFSGIVNPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIA 210

Query: 237 PL 238
           P 
Sbjct: 211 PW 212


>gi|167617588|ref|ZP_02386219.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           Bt4]
          Length = 202

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 79/165 (47%), Gaps = 11/165 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDN--QTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  NVGDILT+ I  +  A   +   T R  N S     +G   
Sbjct: 27  SIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 86

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 87  GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGQKQML 140

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +N     +  +G+V P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 141 INQGNEFVRFSGVVNPNTISGQNSVYSTQVADARIEYSAKGYINE 185


>gi|167579491|ref|ZP_02372365.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           TXDOH]
          Length = 220

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 83/182 (45%), Gaps = 11/182 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  NVGDILT+ I   I+        T R  N S     +G   
Sbjct: 45  SIYNPGYAGRPLFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLG 104

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 105 GLFNK------ANLSAQGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGQKQML 158

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +G+V P  +   NSV   ++A+ARI Y  KG   E        +   N++
Sbjct: 159 INQGNEFVRFSGVVNPNTISGQNSVYSTQVADARIEYSAKGYINEAETMGWLQRFFLNIA 218

Query: 237 PL 238
           P 
Sbjct: 219 PW 220


>gi|220932492|ref|YP_002509400.1| flagellar L-ring protein [Halothermothrix orenii H 168]
 gi|219993802|gb|ACL70405.1| flagellar L-ring protein [Halothermothrix orenii H 168]
          Length = 192

 Score = 75.9 bits (185), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 87/171 (50%), Gaps = 7/171 (4%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW D  A++++D +   VGD++TV I  +  AV    T  S+ +++      G   F +
Sbjct: 25  SLWSDESASIYEDRQEFKVGDVITVVIEENSSAVQSANTSTSQESNIDAGPGLGIFDFIK 84

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                    +Y   G + G+    R+  +   +   +  IL  GN  I G + +++N E 
Sbjct: 85  AF-----GFSYSDEGQADGQ--TQRSGIIEADLTTQIVEILPGGNFRIVGRKTIKINGEE 137

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           + + ++GI+RP+DV   N+V   K+AEA I + G+G  TE  +P +  +++
Sbjct: 138 QYIKLSGIIRPEDVTLDNTVLSTKVAEASIEFEGEGIVTEKQKPGLFERIM 188


>gi|295678055|ref|YP_003606579.1| flagellar L-ring protein [Burkholderia sp. CCGE1002]
 gi|295437898|gb|ADG17068.1| flagellar L-ring protein [Burkholderia sp. CCGE1002]
          Length = 215

 Score = 75.9 bits (185), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 84/165 (50%), Gaps = 11/165 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL-SGGF-- 116
           S++   +A   LF+D R  NVGDI+T+ I  +  A  ++    SRN S +  + + GF  
Sbjct: 40  SIYNPGYAGRPLFEDQRPRNVGDIITIVIAENINATKNSGANASRNGSTNLSVPTAGFLS 99

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +G G  + +   N  I   VT +  NGNLI+SG +++ 
Sbjct: 100 GLFAKT------NLSAAGANGFAGTGGANASNTFNGTITVTVTGVQANGNLIVSGEKQML 153

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +N     +  +G+V P  + + N+V   ++A+A+I Y  KG   E
Sbjct: 154 INQGNEFVRFSGVVNPNTISSLNAVYSTQVADAKIEYSAKGYINE 198


>gi|78485809|ref|YP_391734.1| flagellar L-ring protein [Thiomicrospira crunogena XCL-2]
 gi|110816544|sp|Q31FL3|FLGH_THICR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|78364095|gb|ABB42060.1| Flagellar L-ring protein FlgH [Thiomicrospira crunogena XCL-2]
          Length = 250

 Score = 75.9 bits (185), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 97/195 (49%), Gaps = 13/195 (6%)

Query: 56  STKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
           +  K+ SL++   A  LF DSRA  VGDI+T+++  +  A   ++    ++N  +  L+G
Sbjct: 57  TVPKNGSLYQSGDAITLFDDSRAHKVGDIITINLAENFDAKKKDEAKYDKSNQQNFGLNG 116

Query: 115 GFSLFGQQTPQMNGNLNYDGG-----------GASSGKGSISRAEKLNLLIAAIVTAILE 163
             ++ G       GN++  G            G+ +GK  + +   L+  IA  V  ++ 
Sbjct: 117 QAAV-GSNASVFGGNVSVPGLGSGIGIGYGSDGSFAGKSDVKQKSSLSGSIAVTVVQVIS 175

Query: 164 NGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELL 223
           NGNL+I G + + +++    +   GIVRPQD+   N++  +K+A+ R+ Y   G + +  
Sbjct: 176 NGNLVIRGEKWITIHEGEEVIRFAGIVRPQDIRPDNTIDSEKVADVRLIYKDTGISGDTN 235

Query: 224 RPPIGHQLIENLSPL 238
           RP    Q +    PL
Sbjct: 236 RPGAMTQWLHKYWPL 250


>gi|260779344|ref|ZP_05888236.1| flagellar L-ring protein FlgH [Vibrio coralliilyticus ATCC BAA-450]
 gi|260605508|gb|EEX31803.1| flagellar L-ring protein FlgH [Vibrio coralliilyticus ATCC BAA-450]
          Length = 223

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 86/160 (53%), Gaps = 12/160 (7%)

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF---S 117
           SL+R  ++  LF+D RA  VGD+LTV +  + ++     T   +N+S+      GF   S
Sbjct: 50  SLYRHQYSMTLFQDRRAYRVGDMLTVVLSEETESSKKADTKYGKNSSV------GFAAPS 103

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           L G+   ++  ++  D   A  G  S S+  KL   I   V  +L NG L ISG + +R+
Sbjct: 104 LGGKTIDELAASV--DAQRAFDGSASSSQGNKLEGAITVTVHEVLPNGVLRISGEKWIRL 161

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           N     + +TGIVR  D+  +N VS  +I +ARI+Y G+G
Sbjct: 162 NQGDEFIRLTGIVRVDDISRNNQVSSARIGDARITYSGRG 201


>gi|315453929|ref|YP_004074199.1| flagellar L-ring protein [Helicobacter felis ATCC 49179]
 gi|315132981|emb|CBY83609.1| flagellar L-ring protein precursor [Helicobacter felis ATCC 49179]
          Length = 234

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 96/187 (51%), Gaps = 10/187 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF---DNQTGRSRNNSLHRKLS-GGFS 117
           SL+      LF D RA+   D++TV+I  +  A +    N    S   S   +L+  G  
Sbjct: 48  SLFGQGERPLFADRRAMKPNDLVTVEISENASANYSASKNYANTSNGTSTPPRLAYNGTD 107

Query: 118 LFGQQTPQ-MNGNLNYDGGGASSGK-----GSISRAEKLNLLIAAIVTAILENGNLIISG 171
           L  ++  Q ++   NY     ++ K     GS  ++E L  ++ A +  +LENGN  I G
Sbjct: 108 LNKREQAQFLDDRSNYSLTQPTTNKTFKGGGSQKKSEDLKFILTARIVKVLENGNYFIYG 167

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           S+E+ V+ E + + ++G+VRP D++ +N V    IA+A+ISY   G  +   +  + +++
Sbjct: 168 SKEILVDGEKQVIKLSGVVRPFDINKNNVVQSKHIADAKISYTNLGPLSASNKKKLSNEV 227

Query: 232 IENLSPL 238
           +E+  P 
Sbjct: 228 LESEFPF 234


>gi|332162898|ref|YP_004299475.1| Lateral flagellar L-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318604255|emb|CBY25753.1| flagellar L-ring protein FlgH [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667128|gb|ADZ43772.1| Lateral flagellar L-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863348|emb|CBX73471.1| flagellar L-ring protein 2 [Yersinia enterocolitica W22703]
          Length = 221

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 90/171 (52%), Gaps = 20/171 (11%)

Query: 55  DSTKKSYSLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS 113
           DS KK   L++ ++  +L +D RA  +GDILTV +    Q+    +T   + N +   + 
Sbjct: 41  DSVKKGGGLFQPAYNWSLLQDRRAYRIGDILTVKLDESTQSSKQAKTNFGKKNDMSLGI- 99

Query: 114 GGFSLFGQQTPQMNGNLNYDGGGASSGK----GSISRAEKLNLLIAAIVTAI---LENGN 166
                     P++ G      GG+ SGK    GS + A++ N+L  +I  A+   L NG 
Sbjct: 100 ----------PEVLGKKLNKFGGSISGKRDFDGSATSAQQ-NMLRGSITVAVHQVLPNGV 148

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           L+I G + + +N     + VTG+VR  DV+  NSVS  +IA ARISY G+G
Sbjct: 149 LVIRGEKWLTLNQGDEYMRVTGLVRADDVERDNSVSSQRIANARISYAGRG 199


>gi|78776932|ref|YP_393247.1| flagellar basal body L-ring protein [Sulfurimonas denitrificans DSM
           1251]
 gi|110816546|sp|Q30SL9|FLGH_SULDN RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|78497472|gb|ABB44012.1| Flagellar L-ring protein [Sulfurimonas denitrificans DSM 1251]
          Length = 240

 Score = 75.5 bits (184), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 98/188 (52%), Gaps = 13/188 (6%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG-FSLFG 120
           S++      LF D +A++V DI+TV I  + Q+        S ++SL+  L GG F+  G
Sbjct: 55  SVFGQGENPLFSDHKAMHVNDIVTVIISENTQSSNSGSKQISESDSLN--LGGGAFTSAG 112

Query: 121 QQTP------QMNGNLNYDGGGAS----SGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
             +       ++NG  N   G  S     G+GS ++       ++A +  +L+NGN  IS
Sbjct: 113 TNSAVNSAVSKLNGIANLGFGSTSDSAYKGQGSATKDASFTTTVSARIVKVLQNGNYFIS 172

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G +E+ V+++ + + + G++RP D+D  N ++  +++EA+I Y  +G          G +
Sbjct: 173 GKREILVDNQKQIIQIGGVIRPYDIDQGNRINSSQMSEAKILYKTQGDVERATDRGWGTK 232

Query: 231 LIENLSPL 238
           +I+++ P 
Sbjct: 233 IIQSVWPF 240


>gi|24374754|ref|NP_718797.1| flagellar basal body L-ring protein [Shewanella oneidensis MR-1]
 gi|31076704|sp|Q8ECA1|FLGH_SHEON RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|24349418|gb|AAN56241.1|AE015761_11 flagellar L-ring protein FlgH [Shewanella oneidensis MR-1]
          Length = 224

 Score = 75.5 bits (184), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 93/182 (51%), Gaps = 8/182 (4%)

Query: 45  PFLGIDFKNSDSTK--KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFD--NQ 99
           PF    +  +  TK   + S+++DS AA L+ D RA  VGDI+T+ ++   QA     NQ
Sbjct: 28  PFYAPVYPEAPPTKIAATGSIYQDSQAASLYSDIRAHKVGDIITIVLKEATQAKKSAGNQ 87

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
             +  + +L    +GG +L     P    +L Y     +  +    ++  L+  I+A + 
Sbjct: 88  IKKGSDMTLDPVYAGGSNLSLGGIPL---DLRYKDSMNTKRESDADQSNSLDGSISANIM 144

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL++ G + + +N+    + VTGIVR QD+   N++   ++A ARI Y G G  
Sbjct: 145 QVLNNGNLVVRGEKWISINNGDEFIRVTGIVRSQDIKPDNTIDSTRMANARIQYSGTGTF 204

Query: 220 TE 221
            E
Sbjct: 205 AE 206


>gi|190574260|ref|YP_001972105.1| flagellar basal body L-ring protein [Stenotrophomonas maltophilia
           K279a]
 gi|226701935|sp|B2FQV2|FLGH_STRMK RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|190012182|emb|CAQ45805.1| putative flagellar L-ring protein [Stenotrophomonas maltophilia
           K279a]
          Length = 230

 Score = 75.5 bits (184), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 83/159 (52%), Gaps = 16/159 (10%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS----GGFSLFGQQTPQM 126
           L+ D RA +VGD+LT+ +        +N T ++  N+   K S    G  S+ G     +
Sbjct: 62  LYSDRRARDVGDLLTITL-------LENTTAQTSANTATNKESNLSLGTPSILGAPV-TL 113

Query: 127 NGN--LNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
            G   L+    GA   +GKG+ +++ +L   +   V   L NGNL++ G + +R+N    
Sbjct: 114 GGKDILSATAKGARDFTGKGNSAQSNRLQGSVTVTVIQRLPNGNLVVQGQKNLRLNQGDE 173

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            + V GIVRP D+   N++   ++AEARI YGG+G   +
Sbjct: 174 LVQVQGIVRPGDISQDNTIPSSRVAEARIVYGGRGPVAQ 212


>gi|134297195|ref|YP_001120930.1| flagellar basal body L-ring protein [Burkholderia vietnamiensis G4]
 gi|166214817|sp|A4JIJ2|FLGH_BURVG RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|134140352|gb|ABO56095.1| flagellar L-ring protein [Burkholderia vietnamiensis G4]
          Length = 229

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 74/156 (47%), Gaps = 13/156 (8%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFD-----NQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
           LF+D R  NVGDILT+ I  +  A        N+ G +  N       GG  LF +    
Sbjct: 65  LFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTDFNVPTAAFLGG--LFAK---- 118

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     + 
Sbjct: 119 --ANLSATGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVR 176

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            +G+V P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 177 FSGVVNPNTISGANSVYSTQVADARIEYSAKGYINE 212


>gi|114046841|ref|YP_737391.1| flagellar basal body L-ring protein [Shewanella sp. MR-7]
 gi|123030764|sp|Q0HX21|FLGH_SHESR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|113888283|gb|ABI42334.1| flagellar L-ring protein [Shewanella sp. MR-7]
          Length = 224

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 106/222 (47%), Gaps = 25/222 (11%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK-- 58
           M RY   +L  + LL  C S+  +        P+          PF    +  +  TK  
Sbjct: 1   MARY--FILAVALLLTACSSTSKK--------PIADD-------PFYAPVYPEAPPTKIA 43

Query: 59  KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFD--NQTGRSRNNSLHRKLSGG 115
            + S+++DS AA L+ D RA  VGDI+T+ ++   QA     NQ  +  + SL    +GG
Sbjct: 44  ATGSIYQDSQAASLYSDIRAHKVGDIITIVLKEATQAKKSAGNQIKKGSDMSLDPIYAGG 103

Query: 116 FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
            ++     P    +L Y     +  +    ++  L+  I+A V  +L NGNL++ G + +
Sbjct: 104 SNVSIGGVPL---DLRYKDSMNTKRESDADQSNSLDGSISANVMQVLNNGNLVVRGEKWI 160

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            +N+    + VTGIVR QD+   N++   ++A ARI Y G G
Sbjct: 161 SINNGDEFIRVTGIVRSQDIKPDNTIDSTRMANARIQYSGTG 202


>gi|328470104|gb|EGF41015.1| flagellar basal body L-ring protein [Vibrio parahaemolyticus 10329]
          Length = 234

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 92/171 (53%), Gaps = 10/171 (5%)

Query: 49  IDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS 107
           +D+   D+  +S SL+R  +   LF+D RA  VGD+LTV +  +  +     T   ++++
Sbjct: 50  LDYTLPDA--QSGSLYRHQYTMTLFQDRRAYRVGDVLTVVLSEETSSSKKAGTKFGKSSA 107

Query: 108 LHRKLSG-GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGN 166
           ++      G   F +    ++G+ N+DG  +SS      +  KL   I   V  +L NG 
Sbjct: 108 VNFAAPTIGTKKFDELGVSIDGSRNFDGSASSS------QGNKLQGAITVTVHDVLPNGV 161

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           L ISG + +R+N     + +TGIVR  D+  +N VS  +IA+ARI+Y G+G
Sbjct: 162 LRISGEKWLRLNQGDEFIRLTGIVRVDDITRNNQVSSQRIADARITYAGRG 212


>gi|170737041|ref|YP_001778301.1| flagellar L-ring protein [Burkholderia cenocepacia MC0-3]
 gi|169819229|gb|ACA93811.1| flagellar L-ring protein [Burkholderia cenocepacia MC0-3]
          Length = 221

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 82/160 (51%), Gaps = 6/160 (3%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
           D   +L  D RA   GD+LTVD+    QA   + T   +++SL  K     SLFG+  P 
Sbjct: 54  DQAWSLTSDVRAFRAGDVLTVDLEESTQASKKSGTQVGKDSSLSAKKP---SLFGKALP- 109

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           +   L    G   +G GS S+   L   +  +V  ++ NG L + G + + +N    ++ 
Sbjct: 110 VEAELGTKSG--FNGAGSSSQQNTLRGSVTVVVQRVMPNGLLQVRGEKRLVLNQGEENVR 167

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           + G VR  D+D++N VS  ++A ARI+Y G+G   +  +P
Sbjct: 168 LAGYVRAADIDSNNRVSSQRVANARITYAGRGSLADASQP 207


>gi|299066530|emb|CBJ37720.1| Flagellar L-ring protein precursor (Basal body L-ring protein)
           [Ralstonia solanacearum CMR15]
          Length = 179

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 92/184 (50%), Gaps = 26/184 (14%)

Query: 62  SLWRD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH---------RK 111
           SL+++ ++  L  D++A  VGD++TV +  +  A+    T   R N+L+         R+
Sbjct: 10  SLYKEGAYRQLTSDNKAFRVGDVITVQVYENSSALTSTDTTTQRKNNLNVGVTTLPAGRQ 69

Query: 112 LSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
           + G   + G          ++DGGG +       R  KL   I   V  +L NG+L I+G
Sbjct: 70  IGGSVGVAG----------DFDGGGTTQ------RTNKLLATITVAVQDVLPNGDLRIAG 113

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            Q + VNDE   + + G VRPQD+   N V   ++AEA I+Y G+G  ++  R     +L
Sbjct: 114 EQLLTVNDEQHKVALEGRVRPQDISDGNVVLSTRLAEAHINYVGEGDLSDRQRRSWWRKL 173

Query: 232 IENL 235
           ++ L
Sbjct: 174 VDFL 177


>gi|254251194|ref|ZP_04944512.1| hypothetical protein BDAG_00370 [Burkholderia dolosa AUO158]
 gi|124893803|gb|EAY67683.1| hypothetical protein BDAG_00370 [Burkholderia dolosa AUO158]
          Length = 238

 Score = 75.1 bits (183), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 80/165 (48%), Gaps = 11/165 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-NSLHRKLSGGF-- 116
           S++   +A   LF+D R  N+GDILT+ I  +  A   +    +R  N+     + GF  
Sbjct: 63  SIYNPGYAGRPLFEDQRPRNIGDILTIVIAENINATKSSGANTNRQGNTDFNVPTAGFLG 122

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ 
Sbjct: 123 GLFAK------ANLSATGNNKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQML 176

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +N     +  +G+V P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 177 INQGNEFVRFSGVVNPNTISGSNSVYSTQVADARIEYSAKGYINE 221


>gi|323527710|ref|YP_004229863.1| flagellar L-ring protein [Burkholderia sp. CCGE1001]
 gi|323384712|gb|ADX56803.1| flagellar L-ring protein [Burkholderia sp. CCGE1001]
          Length = 232

 Score = 75.1 bits (183), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 87/182 (47%), Gaps = 11/182 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTG--RSRNNSLHRKLSGGFS 117
           S++   +A   LF+D R  NVGDILT+ I+ +  A   +  G  RS N S     +G   
Sbjct: 57  SIYNPGYAGRPLFEDQRPRNVGDILTIVIQENVNATKSSGAGVNRSGNTSFDVPTAGFLG 116

Query: 118 -LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LFG+       NL+  G    +  G  + +   N  I   VT +L NGNL++SG +++ 
Sbjct: 117 GLFGK------ANLSASGANKFASTGGANASNTFNGTITVTVTGVLPNGNLMVSGEKQML 170

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +G+V P  +   N+V   ++A+A+I Y  KG   E        +   N+S
Sbjct: 171 INQGNEFVRFSGVVNPNTISNLNAVYSTQVADAKIEYSAKGYVDEAENMGWLQRFFLNVS 230

Query: 237 PL 238
           P 
Sbjct: 231 PW 232


>gi|153837030|ref|ZP_01989697.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ3810]
 gi|149749618|gb|EDM60363.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ3810]
          Length = 229

 Score = 75.1 bits (183), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 92/171 (53%), Gaps = 10/171 (5%)

Query: 49  IDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS 107
           +D+   D+  +S SL+R  +   LF+D RA  VGD+LTV +  +  +     T   ++++
Sbjct: 45  LDYTLPDA--QSGSLYRHQYTMTLFQDRRAYRVGDVLTVVLSEETSSSKKAGTKFGKSSA 102

Query: 108 LHRKLSG-GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGN 166
           ++      G   F +    ++G+ N+DG  +SS      +  KL   I   V  +L NG 
Sbjct: 103 VNFAAPTIGTKKFDELGVSIDGSRNFDGSASSS------QGNKLQGAITVTVHDVLPNGV 156

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           L ISG + +R+N     + +TGIVR  D+  +N VS  +IA+ARI+Y G+G
Sbjct: 157 LRISGEKWLRLNQGDEFIRLTGIVRVDDITRNNQVSSQRIADARITYAGRG 207


>gi|308094857|ref|ZP_05893052.2| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AN-5034]
 gi|308095485|ref|ZP_05906193.2| flagellar L-ring protein FlgH [Vibrio parahaemolyticus Peru-466]
 gi|308125941|ref|ZP_05778271.2| flagellar L-ring protein FlgH [Vibrio parahaemolyticus K5030]
 gi|308126101|ref|ZP_05907787.2| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ4037]
 gi|308086264|gb|EFO35959.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus Peru-466]
 gi|308091837|gb|EFO41532.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AN-5034]
 gi|308109222|gb|EFO46762.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ4037]
 gi|308114954|gb|EFO52494.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus K5030]
          Length = 233

 Score = 75.1 bits (183), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 92/171 (53%), Gaps = 10/171 (5%)

Query: 49  IDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS 107
           +D+   D+  +S SL+R  +   LF+D RA  VGD+LTV +  +  +     T   ++++
Sbjct: 49  LDYTLPDA--QSGSLYRHQYTMTLFQDRRAYRVGDVLTVVLSEETSSSKKAGTKFGKSSA 106

Query: 108 LHRKLSG-GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGN 166
           ++      G   F +    ++G+ N+DG  +SS      +  KL   I   V  +L NG 
Sbjct: 107 VNFAAPTIGTKKFDELGVSIDGSRNFDGSASSS------QGNKLQGAITVTVHDVLPNGV 160

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           L ISG + +R+N     + +TGIVR  D+  +N VS  +IA+ARI+Y G+G
Sbjct: 161 LRISGEKWLRLNQGDEFIRLTGIVRVDDITRNNQVSSQRIADARITYAGRG 211


>gi|303248237|ref|ZP_07334500.1| flagellar L-ring protein [Desulfovibrio fructosovorans JJ]
 gi|302490375|gb|EFL50286.1| flagellar L-ring protein [Desulfovibrio fructosovorans JJ]
          Length = 240

 Score = 75.1 bits (183), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 121/259 (46%), Gaps = 40/259 (15%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           M R  F+ L   + L  C  +  + T +PQ++P  +      + P  G  F  +  T   
Sbjct: 1   MIRKQFLPLLLIAGLAACAPASKKATPMPQVTPTVAKAPPPAQNP--GSVFSQNQPT--- 55

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
                     LF D+RA  +GDILTV+I    ++    +T   +N+    +  G  + FG
Sbjct: 56  ---------FLFDDTRARRIGDILTVNIVDTSKSDLKAET---KNDKTSSQQFGVSNYFG 103

Query: 121 QQTPQMNGNLNYDGGGASSG-KG--------SISRAEKL---------NLLIAAI---VT 159
            +T  + GNL    GG   G KG        S+S AEK          + + A+I   + 
Sbjct: 104 NKT--ITGNLPGQLGGPDFGMKGYTGSTPLVSVSNAEKFQSKGETKRESAVTASIGCRIV 161

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            IL  G + + G+++ RVN+E + + V G+VRP DV   N+V+  ++A+ +I Y G+G  
Sbjct: 162 NILPGGVMQLEGARQTRVNNENQIIVVKGLVRPIDVGPSNTVASTQLADCQIEYYGEGDL 221

Query: 220 TELLRPPIGHQLIENLSPL 238
            +  +     ++++N+ P 
Sbjct: 222 ADRQKSGWLARILDNVWPF 240


>gi|307731360|ref|YP_003908584.1| flagellar L-ring protein [Burkholderia sp. CCGE1003]
 gi|307585895|gb|ADN59293.1| flagellar L-ring protein [Burkholderia sp. CCGE1003]
          Length = 232

 Score = 75.1 bits (183), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 89/181 (49%), Gaps = 11/181 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL-SGGF-- 116
           S++   +A   LF+D R  NVGDILT+ I+ +  A   +    +RN +    + + GF  
Sbjct: 57  SIYNPGYAGRPLFEDQRPRNVGDILTIVIQENVNATKSSGANVNRNGTTSFDVPTAGFLG 116

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LFG+       NL+ +G    +  G  + +   N  I   VT +L NGNL++SG +++ 
Sbjct: 117 GLFGK------ANLSANGANKFTAAGGANASNTFNGTITVTVTGVLPNGNLMVSGEKQML 170

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +  +G+V P  +   N+V   ++A+A+I Y  KG   E        +   N+S
Sbjct: 171 INQGNEFVRFSGVVNPNTISNLNAVYSTQVADAKIEYSAKGYVDEAQNLGWLQRFFLNVS 230

Query: 237 P 237
           P
Sbjct: 231 P 231


>gi|28900125|ref|NP_799780.1| flagellar basal body L-ring protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|81726358|sp|Q87JI3|FLGH2_VIBPA RecName: Full=Flagellar L-ring protein 2; AltName: Full=Basal body
           L-ring protein 2; Flags: Precursor
 gi|28808408|dbj|BAC61613.1| putative flagellar L-ring protein [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 223

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 92/171 (53%), Gaps = 10/171 (5%)

Query: 49  IDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS 107
           +D+   D+  +S SL+R  +   LF+D RA  VGD+LTV +  +  +     T   ++++
Sbjct: 39  LDYTLPDA--QSGSLYRHQYTMTLFQDRRAYRVGDVLTVVLSEETSSSKKAGTKFGKSSA 96

Query: 108 LHRKLSG-GFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGN 166
           ++      G   F +    ++G+ N+DG  +SS      +  KL   I   V  +L NG 
Sbjct: 97  VNFAAPTIGTKKFDELGVSIDGSRNFDGSASSS------QGNKLQGAITVTVHDVLPNGV 150

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           L ISG + +R+N     + +TGIVR  D+  +N VS  +IA+ARI+Y G+G
Sbjct: 151 LRISGEKWLRLNQGDEFIRLTGIVRVDDITRNNQVSSQRIADARITYAGRG 201


>gi|85706165|ref|ZP_01037260.1| flagellar L-ring protein precursor [Roseovarius sp. 217]
 gi|85669329|gb|EAQ24195.1| flagellar L-ring protein precursor [Roseovarius sp. 217]
          Length = 64

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 48/64 (75%)

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           +RVN E+R L V+G VRP+D+   N ++YDKIA ARISYGG+G+ T++ +P IG Q+++ 
Sbjct: 1   MRVNFELRELLVSGFVRPEDISRQNEITYDKIAAARISYGGRGQITDVQQPRIGQQVLDA 60

Query: 235 LSPL 238
           + P 
Sbjct: 61  ILPF 64


>gi|325529017|gb|EGD06030.1| flagellar basal body L-ring protein [Burkholderia sp. TJI49]
          Length = 229

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 74/154 (48%), Gaps = 9/154 (5%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDN--QTGRSRNNSLHRKLSGGFS-LFGQQTPQMN 127
           LF+D R  NVGDILT+ I  +  A   +   T R  N   +   +G    LF +      
Sbjct: 65  LFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTDFNVPTAGFLGGLFSK------ 118

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +
Sbjct: 119 ANLSASGDNKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFS 178

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G+V P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 179 GVVNPNTISGSNSVYSTQVADARIEYSAKGYINE 212


>gi|254522805|ref|ZP_05134860.1| flagellar L-ring protein FlgH [Stenotrophomonas sp. SKA14]
 gi|219720396|gb|EED38921.1| flagellar L-ring protein FlgH [Stenotrophomonas sp. SKA14]
          Length = 230

 Score = 74.7 bits (182), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 82/160 (51%), Gaps = 18/160 (11%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS----GGFSLFGQQTPQM 126
           L+ D RA +VGD+LT+ +        +N T ++  N+   K S    G  S+ G   P  
Sbjct: 62  LYSDRRARDVGDLLTITL-------LENTTAQTSANTATNKESNLNLGTPSILG--APVT 112

Query: 127 NGNLNYDGGGAS-----SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
            G  +     A+     +GKG+ +++ +L   +   V   L NGNL++ G + +R+N   
Sbjct: 113 LGGKDILSASATGKRDFTGKGNSAQSNRLQGSVTVTVVQRLPNGNLVVQGQKNLRLNQGD 172

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
             + V GIVRP D+   N++   ++AEARI YGG+G   +
Sbjct: 173 ELVQVQGIVRPGDISQDNTIPSSRVAEARIVYGGRGPVAQ 212


>gi|91224196|ref|ZP_01259459.1| flagellar L-ring protein precursor H [Vibrio alginolyticus 12G01]
 gi|269965647|ref|ZP_06179760.1| Flagellar L-ring protein precursor [Vibrio alginolyticus 40B]
 gi|91191107|gb|EAS77373.1| flagellar L-ring protein precursor H [Vibrio alginolyticus 12G01]
 gi|269829715|gb|EEZ83951.1| Flagellar L-ring protein precursor [Vibrio alginolyticus 40B]
          Length = 233

 Score = 74.7 bits (182), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 87/161 (54%), Gaps = 8/161 (4%)

Query: 59  KSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH-RKLSGGF 116
           +S SL+R  +   LF+D RA  VGD+LTV +  +  +  +  T   ++++++    + G 
Sbjct: 57  QSGSLYRHQYTMTLFQDRRAYRVGDVLTVQLSEETSSSKNAGTKFGKSSAINFVAPTIGT 116

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
               +    ++G  N+DG  +SS      +  KL   I   V  +L NG L ISG + +R
Sbjct: 117 KTIDELGVSVDGKRNFDGSASSS------QGNKLQGAITVTVHEVLPNGVLRISGEKWLR 170

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +N     + +TGIVR  D++  N VS  +IA+ARI+Y G+G
Sbjct: 171 LNQGDEFIRLTGIVRVDDINRSNQVSSQRIADARITYAGRG 211


>gi|167835115|ref|ZP_02461998.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           MSMB43]
          Length = 209

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 78/171 (45%), Gaps = 9/171 (5%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFS-LFGQQTPQMN 127
           LF+D R  NVGDILT+ I   I+        T R  N S     +G    LF +      
Sbjct: 45  LFEDQRPRNVGDILTIVIAENINATKSSGANTNRQGNTSFDVPTAGFLGGLFNK------ 98

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +
Sbjct: 99  ANLSAQGANKFASTGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFS 158

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           G+V P  +   NSV   ++A+A+I Y  KG   E        +   N++P 
Sbjct: 159 GVVNPNTISGQNSVYSTQVADAKIEYSAKGYINEAETMGWLQRFFLNIAPW 209


>gi|167623364|ref|YP_001673658.1| flagellar basal body L-ring protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167353386|gb|ABZ75999.1| flagellar L-ring protein [Shewanella halifaxensis HAW-EB4]
          Length = 224

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 96/185 (51%), Gaps = 8/185 (4%)

Query: 45  PFLGIDFKNSDSTK--KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQA--VFDNQ 99
           P+    +  +  TK   + S+++DS A+ L+ D +AL VGDI+TV +    QA    +N+
Sbjct: 28  PYYAPVYPEAPPTKIAATGSMYQDSQASSLYSDIKALKVGDIITVYLMEQTQAKKSANNE 87

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
             +  + SL    +GG ++     P    +L Y     +  +    ++  L+  I+A V 
Sbjct: 88  ISKGTDLSLDPIYAGGGNVTIGGNPI---DLRYKDSMNTKRESDADQSNSLSGSISANVM 144

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL+I G + + +N+    + +TGIVR QD+   N++   ++A ARI Y G G  
Sbjct: 145 QVLNNGNLVIRGEKWISINNGDEFVRITGIVRAQDIRPDNTIDSQRVANARIQYSGTGTF 204

Query: 220 TELLR 224
            E+ +
Sbjct: 205 AEVQK 209


>gi|153831745|ref|ZP_01984412.1| flagellar L-ring protein FlgH [Vibrio harveyi HY01]
 gi|156976144|ref|YP_001447050.1| flagellar basal body L-ring protein [Vibrio harveyi ATCC BAA-1116]
 gi|148872255|gb|EDL71072.1| flagellar L-ring protein FlgH [Vibrio harveyi HY01]
 gi|156527738|gb|ABU72823.1| hypothetical protein VIBHAR_04915 [Vibrio harveyi ATCC BAA-1116]
          Length = 229

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 82/160 (51%), Gaps = 6/160 (3%)

Query: 59  KSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           KS SL+R  +   LF+D RA  VGD+LTV  ++ ++     + G     S     +    
Sbjct: 53  KSGSLYRHQYTMTLFQDRRAYRVGDVLTV--QLSEETSSSKKAGTQFGKSSTVDFAA--P 108

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
             G +T    G ++ DG  +  G  S S+  KL   I   V  +L NG L ISG + +R+
Sbjct: 109 TIGTKTIDELG-VSVDGSRSFDGSASSSQGNKLQGAITVTVHEVLPNGVLRISGEKWLRL 167

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           N     + +TGIVR  D+   N VS  +IA+ARI+Y G+G
Sbjct: 168 NQGDEFIRLTGIVRVDDISRSNQVSSQRIADARITYAGRG 207


>gi|332284022|ref|YP_004415933.1| flagellar L-ring protein [Pusillimonas sp. T7-7]
 gi|330427975|gb|AEC19309.1| flagellar L-ring protein [Pusillimonas sp. T7-7]
          Length = 227

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 84/172 (48%), Gaps = 10/172 (5%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGF--SLFGQQTPQM 126
           LF+D R  NVGDI+TV I+    A      QT RS N      L+  F  S F +Q+ +M
Sbjct: 62  LFEDRRPRNVGDIVTVIIQEKTNAAKNVQTQTDRSGNADFGVTLAPDFMPSDFAKQSFEM 121

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           +G      G A+ G GS       +  +   V  +L NGNL I+G +++ +N     +  
Sbjct: 122 SG------GNAAKGTGSTRADNTFSGTLTTTVIGVLPNGNLQIAGDKQMAINRGSEHIRF 175

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +G++ P+ +   N+V   ++A+ARI +  KG   E+       +   N+SP 
Sbjct: 176 SGVIDPRSITGSNTVLSTQVADARIEFRSKGVMDEVQTMGWLQRFFLNISPF 227


>gi|78067834|ref|YP_370603.1| flagellar basal body L-ring protein [Burkholderia sp. 383]
 gi|110816526|sp|Q39C57|FLGH_BURS3 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|77968579|gb|ABB09959.1| Flagellar L-ring protein [Burkholderia sp. 383]
          Length = 230

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 81/171 (47%), Gaps = 11/171 (6%)

Query: 56  STKKSYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDN--QTGRSRNNSLHRK 111
           S +   S++   +A   LF+D R  NVGDILT+ I  +  A   +   T R  N   +  
Sbjct: 49  SMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIMIAENINATKSSGANTNRQGNTDFNVP 108

Query: 112 LSGGFS-LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
            +G    LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++S
Sbjct: 109 TAGFLGGLFAK------ANLSATGNNKFAATGGASAANTFNGTITVTVTNVLPNGNLVVS 162

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G +++ +N     +  +G+V P  +   NSV   ++A+A+I Y  KG   E
Sbjct: 163 GEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADAKIEYSAKGYINE 213


>gi|157147099|ref|YP_001454418.1| flagellar basal body L-ring protein [Citrobacter koseri ATCC
           BAA-895]
 gi|157084304|gb|ABV13982.1| hypothetical protein CKO_02876 [Citrobacter koseri ATCC BAA-895]
          Length = 221

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 77/149 (51%), Gaps = 7/149 (4%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-FGQQTPQMNG 128
           +L +D RA  VGDILTV +    QA    +T   + N +   +   F     + +  ++G
Sbjct: 57  SLTQDRRAYRVGDILTVKLDESTQASKQARTNFGKKNDVSLGIPEAFGHSIDKLSGSIDG 116

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           N N++G   S  + S+  A      I   V  +L NG L I G + + +N     + VTG
Sbjct: 117 NRNFNGNATSQQQNSLRGA------ITVAVYKVLPNGVLAIRGEKWLTLNQGDEYMRVTG 170

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +VR +D++  NSVS  +IA ARISY G+G
Sbjct: 171 LVRAEDIERDNSVSSQRIANARISYAGRG 199


>gi|157961174|ref|YP_001501208.1| flagellar basal body L-ring protein [Shewanella pealeana ATCC
           700345]
 gi|157846174|gb|ABV86673.1| flagellar L-ring protein [Shewanella pealeana ATCC 700345]
          Length = 217

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 96/185 (51%), Gaps = 8/185 (4%)

Query: 45  PFLGIDFKNSDSTK--KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQA--VFDNQ 99
           P+    +  +  TK   + S+++DS A+ L+ D +AL VGDI+TV +    QA    +N+
Sbjct: 21  PYYAPVYPEAPPTKIAATGSMYQDSQASSLYSDIKALKVGDIITVLLMEQTQAKKSANNE 80

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
             +  + SL    +GG ++     P    +L Y     +  +    ++  L+  I+A V 
Sbjct: 81  ISKGTDLSLDPIYAGGGNVTIGGNPI---DLRYKDSMNTKRESDADQSNSLSGSISANVM 137

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL+I G + + +N+    + +TGIVR QD+   N++   ++A ARI Y G G  
Sbjct: 138 QVLNNGNLVIRGEKWISINNGDEFVRITGIVRAQDIRPDNTIDSQRVANARIQYSGTGTF 197

Query: 220 TELLR 224
            E+ +
Sbjct: 198 AEVQK 202


>gi|187925758|ref|YP_001897400.1| flagellar basal body L-ring protein [Burkholderia phytofirmans
           PsJN]
 gi|187716952|gb|ACD18176.1| flagellar L-ring protein [Burkholderia phytofirmans PsJN]
          Length = 233

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 89/171 (52%), Gaps = 11/171 (6%)

Query: 56  STKKSYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL- 112
           S +   S++   +A   LF+D R  NVGDILT+ I+ +  A   +  G +R+ + +  + 
Sbjct: 52  SAQSPGSIYNPGYAGRPLFEDQRPRNVGDILTIVIQENVNATKSSGAGVNRSGNTNFDVP 111

Query: 113 SGGF--SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
           + GF   LFG+       NL+ +G    +  G  + +   + +I   VT +L NGNL++S
Sbjct: 112 TAGFLGGLFGKV------NLSANGANKFAATGGANASNTFSGVITVTVTGVLPNGNLMVS 165

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G +++ +N     +  +G+V P  +   N+V   ++A+A+I Y  KG   E
Sbjct: 166 GEKQMLINQGNEFVRFSGVVNPNTISNLNAVYSTQVADAKIEYSAKGYIDE 216


>gi|117617995|ref|YP_857340.1| flagellar basal body L-ring protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559402|gb|ABK36350.1| flagellar L-ring protein FlgH [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 223

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 83/154 (53%), Gaps = 5/154 (3%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           D    ++ D +A  VGDI+T+++     A    + Q+G+    +++  + GG  +     
Sbjct: 51  DQVNGIYSDIKAHKVGDIITIELAESTSASKKANTQSGKDNKFTMNPAVLGGVPVTAGPY 110

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
             ++ +L+ +G  A  G+    ++  L   I+  V  +L NGNL++ G + + +N+    
Sbjct: 111 -DLSASLSQNG--AFKGQAKADQSNSLQGNISVSVAKVLPNGNLLVRGEKWIMLNNGNEY 167

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           + +TG++RP+DV   NSVS  K+A ARI YGG G
Sbjct: 168 IRITGMIRPEDVTTDNSVSSQKVANARIHYGGTG 201


>gi|119899024|ref|YP_934237.1| flagellar L-ring protein [Azoarcus sp. BH72]
 gi|166214814|sp|A1K945|FLGH_AZOSB RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|119671437|emb|CAL95350.1| flagellar L-ring protein precursor [Azoarcus sp. BH72]
          Length = 225

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 87/166 (52%), Gaps = 17/166 (10%)

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR--KLSGGFSL 118
           S+++ S A  LF+D RA NVGDI+T+++      V  N   +S N S  R   ++GG SL
Sbjct: 46  SIYQPSQARPLFEDRRARNVGDIITINL------VERNTAQKSANASATRGSAITGGISL 99

Query: 119 FGQQ-----TPQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
                      ++NG L  D G  S  SG+G+ +     N  I+  V  +  NGNL++SG
Sbjct: 100 TAPNIASLANAKLNG-LQADVGLDSDFSGEGAAAANNVFNGTISVTVIDVYPNGNLLVSG 158

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + V +N     +  +G++ P  V A N+V   ++A+ARI Y G G
Sbjct: 159 EKMVAINQGNEFIRFSGVINPTTVTAANTVQSTQVADARIEYRGSG 204


>gi|212634351|ref|YP_002310876.1| flagellar basal body L-ring protein [Shewanella piezotolerans WP3]
 gi|212555835|gb|ACJ28289.1| Flagellar L-ring protein [Shewanella piezotolerans WP3]
          Length = 224

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 96/185 (51%), Gaps = 8/185 (4%)

Query: 45  PFLGIDFKNSDSTK--KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQA--VFDNQ 99
           P+    +  +  TK   + S+++DS A+ L+ D +AL VGDI+TV +    QA    +N+
Sbjct: 28  PYYAPVYPEAPPTKIAATGSMYQDSQASSLYSDIKALKVGDIITVMLMESTQAKKSANNE 87

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
             +  + SL    +GG ++     P    +L Y     +  +    ++  L+  I+A V 
Sbjct: 88  IKKGTDLSLDPIYAGGGNVTIGGNPI---DLRYKDSMNTKRESDADQSNSLSGSISANVM 144

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL+I G + + +N+    + +TGIVR QD+   N++   ++A ARI Y G G  
Sbjct: 145 QVLNNGNLVIRGEKWISINNGDEFVRITGIVRAQDIRPDNTIDSPRVANARIQYSGTGTF 204

Query: 220 TELLR 224
            E+ +
Sbjct: 205 AEVQK 209


>gi|157376213|ref|YP_001474813.1| flagellar basal body L-ring protein [Shewanella sediminis HAW-EB3]
 gi|157318587|gb|ABV37685.1| flagellar L-ring protein [Shewanella sediminis HAW-EB3]
          Length = 229

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 90/168 (53%), Gaps = 10/168 (5%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQA--VFDNQTGRSRNNSLHRKLSGG--F 116
           S+++DS A+ L+ D +AL VGDI+TV ++   QA     N+  +  + +L    +GG   
Sbjct: 52  SMYQDSQASSLYSDIKALKVGDIITVMLQESTQAKKSASNEIKKGTDLTLDPIYAGGKNI 111

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           S+ GQ       +L Y     +  +    ++  L+  I+A V  +L NGNL+I G + + 
Sbjct: 112 SIGGQPI-----DLRYKDSMNTKRESDADQSNSLSGSISANVMQVLNNGNLVIRGEKWIS 166

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           +N+    + +TGIVR QD+   N++   ++A ARI Y G G   ++ +
Sbjct: 167 INNGDEFVRITGIVRSQDIRPDNTIDSQRVANARIQYSGTGTFADVQK 214


>gi|117919775|ref|YP_868967.1| flagellar basal body L-ring protein [Shewanella sp. ANA-3]
 gi|166214828|sp|A0KUU2|FLGH_SHESA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|117612107|gb|ABK47561.1| flagellar L-ring protein FlgH [Shewanella sp. ANA-3]
          Length = 224

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 94/185 (50%), Gaps = 8/185 (4%)

Query: 45  PFLGIDFKNSDSTK--KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFD--NQ 99
           PF    +  +  TK   + S+++DS AA L+ D RA  VGDI+T+ ++   QA     NQ
Sbjct: 28  PFYAPVYPEAPPTKIAATGSIYQDSQAASLYSDIRAHKVGDIITIVLKEATQAKKSAGNQ 87

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
             +  + +L    +GG ++     P    +L Y     +  +    ++  L+  I+A + 
Sbjct: 88  IKKGSDMTLDPIYAGGSNVSLGGIPL---DLRYKDSMNTKRESDADQSNSLDGSISANIM 144

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
            +L NGNL++ G + + +N+    + VTGIVR QD+   N++   ++A ARI Y G G  
Sbjct: 145 QVLNNGNLVVRGEKWISINNGDEFIRVTGIVRSQDIKPDNTIDSTRMANARIQYSGTGTF 204

Query: 220 TELLR 224
            E  +
Sbjct: 205 AEAQK 209


>gi|113969609|ref|YP_733402.1| flagellar basal body L-ring protein [Shewanella sp. MR-4]
 gi|123130593|sp|Q0HKS2|FLGH_SHESM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|113884293|gb|ABI38345.1| flagellar L-ring protein [Shewanella sp. MR-4]
          Length = 224

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 92/178 (51%), Gaps = 8/178 (4%)

Query: 45  PFLGIDFKNSDSTK--KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFD--NQ 99
           PF    +  +  TK   + S+++DS AA L+ D RA  VGDI+T+ ++   QA     NQ
Sbjct: 28  PFYAPVYPEAPPTKIAATGSIYQDSQAASLYSDIRAHKVGDIITIVLKEATQAKKSAGNQ 87

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
             +  + SL    +GG ++     P    +L Y     +  +    ++  L+  I+A V 
Sbjct: 88  IKKGSDLSLDPIYAGGSNVSIGGVPL---DLRYKDSMNTKRESDADQSNSLDGSISANVM 144

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            +L NGNL++ G + + +N+    + VTGIVR QD+   N++   ++A ARI Y G G
Sbjct: 145 QVLNNGNLVVRGEKWISINNGDEFIRVTGIVRSQDIKPDNTIDSTRMANARIQYSGTG 202


>gi|221199742|ref|ZP_03572785.1| flagellar L-ring protein FlgH [Burkholderia multivorans CGD2M]
 gi|221208653|ref|ZP_03581653.1| flagellar L-ring protein FlgH [Burkholderia multivorans CGD2]
 gi|221215574|ref|ZP_03588537.1| flagellar L-ring protein FlgH [Burkholderia multivorans CGD1]
 gi|221164562|gb|EED97045.1| flagellar L-ring protein FlgH [Burkholderia multivorans CGD1]
 gi|221171464|gb|EEE03911.1| flagellar L-ring protein FlgH [Burkholderia multivorans CGD2]
 gi|221179981|gb|EEE12385.1| flagellar L-ring protein FlgH [Burkholderia multivorans CGD2M]
          Length = 229

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 74/154 (48%), Gaps = 9/154 (5%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDN--QTGRSRNNSLHRKLSGGFS-LFGQQTPQMN 127
           LF+D R  N+GDILT+ I  +  A   +   T R  N   +   +G    LF +      
Sbjct: 65  LFEDQRPRNIGDILTIVIAENINATKSSGANTNRQGNTDFNVPTAGFLGGLFSK------ 118

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +
Sbjct: 119 ANLSAAGTNKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFS 178

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G+V P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 179 GVVNPNTISGSNSVYSTQVADARIEYSAKGYINE 212


>gi|78047583|ref|YP_363758.1| flagellar basal body L-ring protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|110816547|sp|Q3BU05|FLGH_XANC5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|78036013|emb|CAJ23704.1| flagellar basal body L-ring protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 230

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 80/155 (51%), Gaps = 16/155 (10%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK---LSGGFSLFGQQTPQMN 127
           L+ D RA +VGD+LTV++      V       + N S+ +K     G  +L G   P   
Sbjct: 62  LYGDRRARDVGDLLTVNL------VESTTASSTANTSISKKDATTMGAPTLLG--APLTV 113

Query: 128 GNLNY-----DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           G LN       G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+     
Sbjct: 114 GGLNVLENSTSGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDE 173

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + V GIVR  D+   N+V   K+A+ARI+YGG+G
Sbjct: 174 LVQVQGIVRAADIAPDNTVPSSKVADARIAYGGRG 208


>gi|107023950|ref|YP_622277.1| flagellar basal body L-ring protein [Burkholderia cenocepacia AU
           1054]
 gi|116691037|ref|YP_836660.1| flagellar basal body L-ring protein [Burkholderia cenocepacia
           HI2424]
 gi|170734371|ref|YP_001766318.1| flagellar basal body L-ring protein [Burkholderia cenocepacia
           MC0-3]
 gi|123071887|sp|Q1BSV1|FLGH_BURCA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|166214816|sp|A0KB90|FLGH_BURCH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|105894139|gb|ABF77304.1| flagellar L-ring protein [Burkholderia cenocepacia AU 1054]
 gi|116649126|gb|ABK09767.1| flagellar L-ring protein [Burkholderia cenocepacia HI2424]
 gi|169817613|gb|ACA92196.1| flagellar L-ring protein [Burkholderia cenocepacia MC0-3]
          Length = 229

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 81/171 (47%), Gaps = 11/171 (6%)

Query: 56  STKKSYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDN--QTGRSRNNSLHRK 111
           S +   S++   +A   LF+D R  N+GDILT+ I  +  A   +   T R  N   +  
Sbjct: 48  SMQAPGSIYNPGYAGRPLFEDQRPRNIGDILTIMIAENINATKSSGANTNRQGNTDFNVP 107

Query: 112 LSGGFS-LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
            +G    LF +       NL+  G    +  G  S A   N  I   VT +L NGNL++S
Sbjct: 108 TAGFLGGLFAK------ANLSATGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVS 161

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G +++ +N     +  +G+V P  +   NSV   ++A+A+I Y  KG   E
Sbjct: 162 GEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADAKIEYSSKGYINE 212


>gi|206558971|ref|YP_002229731.1| flagellar basal body L-ring protein [Burkholderia cenocepacia
           J2315]
 gi|226701914|sp|B4E8L3|FLGH_BURCJ RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|198035008|emb|CAR50880.1| flagellar L-ring protein precursor (basal body L-ring protein)
           [Burkholderia cenocepacia J2315]
          Length = 229

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 74/154 (48%), Gaps = 9/154 (5%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDN--QTGRSRNNSLHRKLSGGFS-LFGQQTPQMN 127
           LF+D R  N+GDILT+ I  +  A   +   T R  N   +   +G    LF +      
Sbjct: 65  LFEDQRPRNIGDILTIMIAENINATKSSGANTNRQGNTDFNVPTAGFLGGLFAK------ 118

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +
Sbjct: 119 ANLSATGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFS 178

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G+V P  +   NSV   ++A+A+I Y  KG   E
Sbjct: 179 GVVNPNTISGANSVYSTQVADAKIEYSSKGYINE 212


>gi|161526183|ref|YP_001581195.1| flagellar basal body L-ring protein [Burkholderia multivorans ATCC
           17616]
 gi|189349101|ref|YP_001944729.1| flagellar basal body L-ring protein [Burkholderia multivorans ATCC
           17616]
 gi|226701915|sp|A9ABN1|FLGH_BURM1 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|160343612|gb|ABX16698.1| flagellar L-ring protein [Burkholderia multivorans ATCC 17616]
 gi|189333123|dbj|BAG42193.1| flagellar L-ring protein precursor [Burkholderia multivorans ATCC
           17616]
          Length = 229

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 74/154 (48%), Gaps = 9/154 (5%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDN--QTGRSRNNSLHRKLSGGFS-LFGQQTPQMN 127
           LF+D R  N+GDILT+ I  +  A   +   T R  N   +   +G    LF +      
Sbjct: 65  LFEDQRPRNIGDILTIVIAENINATKSSGANTNRQGNTDFNVPTAGFLGGLFSK------ 118

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            NL+  G    +  G  S A   N  I   VT +L NGNL++SG +++ +N     +  +
Sbjct: 119 ANLSAAGTNKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGEKQMLINQGNEFVRFS 178

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G+V P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 179 GVVNPNTISGSNSVYSTQVADARIEYSAKGYINE 212


>gi|238028846|ref|YP_002913077.1| flagellar basal body L-ring protein [Burkholderia glumae BGR1]
 gi|237878040|gb|ACR30373.1| Flagellar L-ring protein [Burkholderia glumae BGR1]
          Length = 224

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 81/165 (49%), Gaps = 11/165 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL-SGGF-- 116
           S++   +A   LF+D R  N+GDILT+ I  +  A   +    +R ++   K+ + GF  
Sbjct: 49  SIYNPGYAGRPLFEDQRPRNIGDILTIMIAENVNATKSSGANANRGSATDFKVPTAGFLG 108

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LFG+        L+  G    +  G  S A      I   VT +L NGNL++SG +++ 
Sbjct: 109 GLFGK------AKLSASGDNKFTATGGASAANTFTGTITVTVTNVLPNGNLVVSGEKQML 162

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +N     +  +G+V P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 163 INQGNEFVRFSGVVNPNTISGANSVYSTQVADARIEYSSKGYINE 207


>gi|94500244|ref|ZP_01306777.1| Flagellar basal body L-ring protein [Oceanobacter sp. RED65]
 gi|94427543|gb|EAT12520.1| Flagellar basal body L-ring protein [Oceanobacter sp. RED65]
          Length = 223

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 94/211 (44%), Gaps = 26/211 (12%)

Query: 25  ITGIPQMSPMGSSLDENNRMPFLGIDFK-----NSDSTKKSYSLWRDSHAALFKDSRALN 79
           + G   + PM    D+ N  P      K     N    + +YS+      AL+ D R+  
Sbjct: 15  LQGCSTIVPMDEKPDDPNFAPVPAQSLKPPAENNGSIYQANYSM------ALYGDQRSRR 68

Query: 80  VGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF-----SLFGQQTPQMNGNLNYDG 134
           +GDI+T+        +   QT  S++NS              S+FGQ    +  +  ++ 
Sbjct: 69  IGDIVTI--------ILQEQTNASKSNSASTTKDSEIDVVPTSIFGQGLDFLQND--FEA 118

Query: 135 GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQD 194
             A  G G   ++  L   I   ++ IL NG L I G + + +N     + V G++RPQD
Sbjct: 119 ERAFDGSGDADQSNSLQGQITVTISDILPNGVLEIRGEKWLSLNQGDEFIRVKGLIRPQD 178

Query: 195 VDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           + + N+V   K+A+ARISYGG G      +P
Sbjct: 179 ISSDNTVLSHKLADARISYGGTGYVHNASKP 209


>gi|313672188|ref|YP_004050299.1| flagellar l-ring protein [Calditerrivibrio nitroreducens DSM 19672]
 gi|312938944|gb|ADR18136.1| flagellar L-ring protein [Calditerrivibrio nitroreducens DSM 19672]
          Length = 244

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/173 (32%), Positives = 89/173 (51%), Gaps = 20/173 (11%)

Query: 60  SYSLWRD--SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           + SLW D  + +ALF D +   +GDI+ V I     A   N T  S+ +S    L+    
Sbjct: 56  TASLWTDIGNSSALFLDYKGRTIGDIVIVKIVESSSATNSNSTSASKTSSYDMGLTNLLG 115

Query: 118 LFGQQTPQMNGNLNYDGGG-------------ASSGKGSISRAEKLNLLIAAIVTAILEN 164
           L     P   G  N+ G G             + +G+G   +++++   +AA V  +L +
Sbjct: 116 L-----PTNLGVKNFLGTGNPLDPTVKESTKNSFTGQGKKQKSDQVKATMAARVVDVLPS 170

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           GNL+I G +E+ V+ E + + V GI+R +D+DA N V    IA+A+ISY GKG
Sbjct: 171 GNLVIEGQREIIVDQEKQVITVKGIIRQKDIDADNQVLSTAIADAQISYSGKG 223


>gi|255605341|ref|XP_002538377.1| Flagellar L-ring protein precursor, putative [Ricinus communis]
 gi|223512459|gb|EEF24006.1| Flagellar L-ring protein precursor, putative [Ricinus communis]
          Length = 334

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 86/177 (48%), Gaps = 12/177 (6%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS----LHRKLSGGFSLFGQ 121
           D +AAL++  RA  VGD LT  I + ++       G   ++     L    +G  SLF +
Sbjct: 166 DGYAALYEGMRARRVGDPLT--ILLVEKTAASKSAGTKLDSGGGFGLTPPTTGALSLFKE 223

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
               ++G  N++G       G+  +A  L+  I+  V A+  NG +++ G + V +N   
Sbjct: 224 SDASVSGKRNFNG------TGTADQANALSGEISVTVAAVYPNGTMLVQGQKRVTLNRGD 277

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
             + + G+VR  D+DA+N V   ++A+ARI+Y GKG      R     +    +SP 
Sbjct: 278 EFVQIKGLVRTADIDANNRVLSTRVADARIAYTGKGDVARASRQGWLSRFFSAISPF 334


>gi|261341491|ref|ZP_05969349.1| flagellar L-ring protein FlgH [Enterobacter cancerogenus ATCC
           35316]
 gi|288316287|gb|EFC55225.1| flagellar L-ring protein FlgH [Enterobacter cancerogenus ATCC
           35316]
          Length = 221

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 77/149 (51%), Gaps = 7/149 (4%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-FGQQTPQMNG 128
           +L +D RA  VGDILTV +    QA    +T   + N +   +   F     + +  ++G
Sbjct: 57  SLTQDRRAYRVGDILTVKLDESTQASKQARTNFGKKNDVSIGVPEAFGHSVDKLSGSIDG 116

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           N N++G   S  + S+  A      I   V  +L NG L I G + + +N     + VTG
Sbjct: 117 NRNFNGNATSQQQNSLRGA------ITVAVYKVLPNGVLAIRGEKWLTLNQGDEYMRVTG 170

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +VR +D++  NSVS  +IA ARISY G+G
Sbjct: 171 LVRAEDIERDNSVSSQRIANARISYAGRG 199


>gi|242309080|ref|ZP_04808235.1| flagellar L-ring protein [Helicobacter pullorum MIT 98-5489]
 gi|239524504|gb|EEQ64370.1| flagellar L-ring protein [Helicobacter pullorum MIT 98-5489]
          Length = 228

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 92/184 (50%), Gaps = 22/184 (11%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG---GFSL-----FGQQ 122
           LF D RA+ + D++TV I    QA        S N +L+   SG   G SL         
Sbjct: 51  LFSDRRAMQLNDLVTVIINQTAQA------SSSANKNLNENSSGTLGGPSLTYAGSSSSI 104

Query: 123 TPQMNGNLNYDGGGAS--------SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
              +NG  N  G G +        +G G+ +R E     IAA +  +L+NGN  I GS+E
Sbjct: 105 NSIVNGINNATGFGINLGNNTSTYAGTGTQNRQETFTTTIAARIIKVLQNGNYFIEGSRE 164

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           V +N E + ++++G+VRP D+  +N++    IA+A+I Y  +G   +      G +LIE+
Sbjct: 165 VLINGEKQIIHLSGVVRPTDIARNNTIESQYIADAKIMYDTQGELKKNTEKGWGTKLIES 224

Query: 235 LSPL 238
           + P 
Sbjct: 225 IWPF 228


>gi|220903673|ref|YP_002478985.1| flagellar basal body L-ring protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219867972|gb|ACL48307.1| flagellar L-ring protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 239

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 92/184 (50%), Gaps = 22/184 (11%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LF DSRA  VGDI+ V +  + +A    +T  ++  +   ++    +L GQ +   +G +
Sbjct: 62  LFSDSRARRVGDIVVVKLVENTKAQNKAETTANKKGANDYQVG---ALMGQGS---HGFI 115

Query: 131 NYDGGGAS----------------SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
            + G G +                SG G   R   +   +AA V  +L  G L I G++E
Sbjct: 116 PFLGLGPTNRVGTPALTTSSTSDLSGTGKTKRENYVTTSLAARVIRVLPGGLLQIEGARE 175

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           +RVN+E   + V G+VR +DV A NSV   +IA+A I Y G+G   +  +P    +L++N
Sbjct: 176 IRVNEETEYMVVRGMVRAKDVSADNSVLSTQIADASIEYYGRGVLADKQKPGWFTRLMDN 235

Query: 235 LSPL 238
           + P 
Sbjct: 236 IWPF 239


>gi|170725958|ref|YP_001759984.1| flagellar basal body L-ring protein [Shewanella woodyi ATCC 51908]
 gi|169811305|gb|ACA85889.1| flagellar L-ring protein [Shewanella woodyi ATCC 51908]
          Length = 229

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 97/187 (51%), Gaps = 12/187 (6%)

Query: 45  PFLGIDFKNSDSTK--KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQA--VFDNQ 99
           P+    +  +  TK   + S+++DS A+ L+ D +AL VGDI+TV +    QA    +N+
Sbjct: 33  PYYAPVYPEAPPTKIAATGSMYQDSQASSLYSDIKALKVGDIITVILMEQTQAKKSANNE 92

Query: 100 TGRSRNNSLHRKLSGG--FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
             +  + SL    +GG   S+ GQ       +L Y     +  +    ++  L+  I+A 
Sbjct: 93  IKKGTDLSLDPIYAGGGNISIGGQPI-----DLRYSDSMNTKRESGADQSNSLSGSISAN 147

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL+I G + + +N+    + +TGIVR QD+   N++   ++A ARI Y G G
Sbjct: 148 VMQVLNNGNLVIRGEKWISINNGDEFVRLTGIVRSQDIRPDNTIDSPRVANARIQYSGTG 207

Query: 218 RTTELLR 224
              ++ +
Sbjct: 208 TFADVQK 214


>gi|317008972|gb|ADU79552.1| flagellar basal body L-ring protein [Helicobacter pylori India7]
          Length = 237

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  Q ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ARKKQEAQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|309388848|gb|ADO76728.1| flagellar L-ring protein [Halanaerobium praevalens DSM 2228]
          Length = 194

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 82/156 (52%), Gaps = 7/156 (4%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW D    L++D    ++GDI+TV I  +  A+    +  S++++ +    GG   F  
Sbjct: 27  SLWSDESQDLYQDYPDYHLGDIITVMIEENASAIQSANSDASQSSNYNAAEGGGILDF-- 84

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
             P      ++    + +  G   R+  L   I   +  + ENGNL I G++ V++N EI
Sbjct: 85  -IPF----FDFSYSDSETADGETQRSGTLQADITTEIVGLQENGNLKIRGNKRVKINGEI 139

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +++ + G++RP+D++  N +S  +++ A I Y G+G
Sbjct: 140 QTIVLEGVIRPKDINFDNEISSKRVSNANIEYEGEG 175


>gi|206889518|ref|YP_002249846.1| flagellar L-ring protein FlgH [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|254789285|sp|B5YIX2|FLGH_THEYD RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|206741456|gb|ACI20513.1| flagellar L-ring protein FlgH [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 238

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 85/175 (48%), Gaps = 25/175 (14%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLWR+  A+L++D +A  V D++T+ I     A     T  SR++S +  L    + FG 
Sbjct: 49  SLWRN-KASLYEDKKARRVNDLVTILINESTSAQKTASTTASRDSSTNYGLD---TFFGM 104

Query: 122 QT-------PQMNGNLNYDGGGASS------------GKGSISRAEKLNLLIAAIVTAIL 162
            T       P +NG   Y  G   S            G G  +R  K+   I A V  +L
Sbjct: 105 NTDFNIHNLPLINGF--YKAGNVFSPSVKGSATSDFKGDGDTARTGKITGTITAKVVEVL 162

Query: 163 ENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            NGNL+I   +EV VN+E   L + GI+RP D+   N++    +A+A+I   G+G
Sbjct: 163 PNGNLVIESRKEVIVNNEKEILVLRGIIRPDDISQSNTILSQYVADAQIYLVGEG 217


>gi|172061969|ref|YP_001809621.1| flagellar basal body L-ring protein [Burkholderia ambifaria MC40-6]
 gi|226701913|sp|B1YPA0|FLGH_BURA4 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|171994486|gb|ACB65405.1| flagellar L-ring protein [Burkholderia ambifaria MC40-6]
          Length = 229

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 82/171 (47%), Gaps = 11/171 (6%)

Query: 56  STKKSYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-NSLHRKL 112
           S +   S++   +A   LF+D R  NVGDILT+ I  +  A   +    +R  N+     
Sbjct: 48  SMQAPGSIYNPGYAGRPLFEDQRPRNVGDILTIMIAENINATKSSGANTNRQGNTDFSVP 107

Query: 113 SGGF--SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
           + GF   LF +       N++  G    +  G  S A   N  I   VT +L NGNL++S
Sbjct: 108 TAGFLGGLFAK------ANMSAAGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVS 161

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G +++ +N     +  +G+V P  +   NSV   ++A+A+I Y  KG   E
Sbjct: 162 GEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADAKIEYSSKGYINE 212


>gi|322378821|ref|ZP_08053247.1| flagellar basal body L-ring protein [Helicobacter suis HS1]
 gi|322380137|ref|ZP_08054385.1| flagellar basal body L-ring protein [Helicobacter suis HS5]
 gi|321147442|gb|EFX42094.1| flagellar basal body L-ring protein [Helicobacter suis HS5]
 gi|321148745|gb|EFX43219.1| flagellar basal body L-ring protein [Helicobacter suis HS1]
          Length = 253

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 85/162 (52%), Gaps = 10/162 (6%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF---DNQTGRSRNNSLHRKLS--GGF 116
           SL+      LF D RA+   D++TV I  +  A +    N T  S  NS   +L+  G  
Sbjct: 67  SLFGQGERPLFADRRAMKPNDLVTVMINENASANYSASKNYTNTSNGNSTAPRLTYNGTN 126

Query: 117 SLFGQQTPQMNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
                Q   ++   NY+   +++     G GS  ++E + L I A +  +LENGN  I G
Sbjct: 127 PNKRNQAQFLDDQSNYNLTQSTTNNTFKGGGSQKKSEDMKLTITARIVKVLENGNYFIYG 186

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISY 213
           S+E+ V+ E + + ++G+VRP D+  +N++    IA+A+I+Y
Sbjct: 187 SREILVDGEKQIIKISGVVRPFDISRNNTIESKYIADAKIAY 228


>gi|71906394|ref|YP_283981.1| flagellar L-ring protein [Dechloromonas aromatica RCB]
 gi|110816528|sp|Q47I20|FLGH_DECAR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|71846015|gb|AAZ45511.1| Flagellar L-ring protein [Dechloromonas aromatica RCB]
          Length = 219

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 75/151 (49%), Gaps = 1/151 (0%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LF+D RA  VGD +TV I     A   +     ++N+    L     +FG+  P    ++
Sbjct: 53  LFEDRRARFVGDTITVKITESTTASTKSNNKVDQSNAQKYGLGASTGMFGRVLPGAM-DM 111

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
           +     A SGKG  +        +   V  ++ NGNL++SG ++V +  E   + ++G+V
Sbjct: 112 SASSSTAFSGKGEAANNNIFTGNMTVTVIDVMPNGNLLVSGEKQVAIGSEQEFVRISGVV 171

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            P  VDA N V   KIA+ARI Y   G+ ++
Sbjct: 172 NPSFVDAFNVVDSSKIADARIEYKSSGQVSD 202


>gi|254255090|ref|ZP_04948407.1| Flagellar basal body L-ring protein [Burkholderia dolosa AUO158]
 gi|124899735|gb|EAY71578.1| Flagellar basal body L-ring protein [Burkholderia dolosa AUO158]
          Length = 222

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 85/163 (52%), Gaps = 12/163 (7%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP- 124
           D   +L  D RA   GD+LTV+++   QA   + T   +N S+  K     +L G   P 
Sbjct: 55  DQAWSLTSDVRAFRAGDVLTVELQESTQASKKSGTQIGKNGSVSVKQP---NLMGSLLPI 111

Query: 125 --QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
             ++ G  ++DG G+SS + ++  +      +  IV  ++ NG L + G + + +N    
Sbjct: 112 EAELGGKRSFDGSGSSSQQNTLRGS------VTVIVQRVMPNGLLQVRGEKRLVLNQGEE 165

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           ++ + G VR  D+DA+N VS  ++A+ARI Y G+G   +  +P
Sbjct: 166 TVRLAGYVRAADIDANNRVSSQRVADARIRYSGRGSLADANQP 208


>gi|217033383|ref|ZP_03438814.1| hypothetical protein HP9810_9g136 [Helicobacter pylori 98-10]
 gi|216944324|gb|EEC23749.1| hypothetical protein HP9810_9g136 [Helicobacter pylori 98-10]
          Length = 237

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  Q ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKQEAQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|208434272|ref|YP_002265938.1| flagellar basal-body L-ring protein [Helicobacter pylori G27]
 gi|208432201|gb|ACI27072.1| flagellar basal-body L-ring protein [Helicobacter pylori G27]
          Length = 237

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  Q ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKQEAQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|296274398|ref|YP_003657029.1| flagellar L-ring protein [Arcobacter nitrofigilis DSM 7299]
 gi|296098572|gb|ADG94522.1| flagellar L-ring protein [Arcobacter nitrofigilis DSM 7299]
          Length = 237

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 92/193 (47%), Gaps = 18/193 (9%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF--SLF 119
           SL+     +LF D + L VGDI  + + ID+    +    R   N+    + GG      
Sbjct: 47  SLYSRKGPSLFADKKDLQVGDI--IQVVIDESLTSNTSNKRELTNTSAETMGGGVISPAT 104

Query: 120 GQQTP----------QMN--GNLNYDGGGASSGKGSI--SRAEKLNLLIAAIVTAILENG 165
           G   P          ++N  G + ++    SS KG +  +  E  +  ++ I+    +NG
Sbjct: 105 GNNLPLNSTVQSVANKINSIGGVQFNSNSNSSFKGKVKANADESFSTTLSVIIEETYQNG 164

Query: 166 NLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           N  I GS+E+ ++++ + + ++G++RP D+   NS+   +IA  ++ Y   G   +++  
Sbjct: 165 NYYIKGSKEMLIDEQKQEIIISGVIRPYDISPDNSIKSSQIANLKVLYKKDGEEQDVMHQ 224

Query: 226 PIGHQLIENLSPL 238
           P G +L++ L P 
Sbjct: 225 PWGTKLLKMLWPF 237


>gi|261837766|gb|ACX97532.1| flagellar basal-body L-ring protein [Helicobacter pylori 51]
 gi|332673170|gb|AEE69987.1| flagellar L-ring protein FlgH [Helicobacter pylori 83]
          Length = 237

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  Q ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKQEAQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|261839177|gb|ACX98942.1| flagellar basal body L-ring protein [Helicobacter pylori 52]
 gi|315586317|gb|ADU40698.1| flagellar L-ring protein FlgH [Helicobacter pylori 35A]
          Length = 237

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  Q ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKQEAQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|120598235|ref|YP_962809.1| flagellar basal body L-ring protein [Shewanella sp. W3-18-1]
 gi|146293687|ref|YP_001184111.1| flagellar basal body L-ring protein [Shewanella putrefaciens CN-32]
 gi|120558328|gb|ABM24255.1| flagellar L-ring protein [Shewanella sp. W3-18-1]
 gi|145565377|gb|ABP76312.1| flagellar L-ring protein [Shewanella putrefaciens CN-32]
 gi|319427086|gb|ADV55160.1| flagellar L-ring protein [Shewanella putrefaciens 200]
          Length = 224

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 91/178 (51%), Gaps = 8/178 (4%)

Query: 45  PFLGIDFKNSDSTK--KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFD--NQ 99
           PF    +  +  TK   + S+++DS AA L+ D RA  VGDI+T+ ++   QA     NQ
Sbjct: 28  PFYAPVYPEAPPTKIAATGSIYQDSQAASLYSDIRAHKVGDIITIVLKEATQAKKSAGNQ 87

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
             +  + SL    + G ++     P    +L Y     +  +    ++  L+  I+A + 
Sbjct: 88  IKKGSDMSLDPIYAAGSNISVAGVPL---DLRYKDSMNTKRESDADQSNSLDGSISANIM 144

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            +L NGNL++ G + + +N+    + VTGIVR QD+   N++   ++A ARI Y G G
Sbjct: 145 QVLNNGNLVVRGEKWISINNGDEFIRVTGIVRSQDIKPDNTIDSTRMANARIQYSGTG 202


>gi|254779024|ref|YP_003057129.1| flagellar basal body L-ring protein [Helicobacter pylori B38]
 gi|254000935|emb|CAX28871.1| Flagellar L-ring protein precursor (Basal body L-ring protein);
           putative signal peptide [Helicobacter pylori B38]
 gi|297379546|gb|ADI34433.1| Flagellar L-ring protein precursor [Helicobacter pylori v225d]
 gi|308061675|gb|ADO03563.1| flagellar basal body L-ring protein [Helicobacter pylori Cuz20]
 gi|308063186|gb|ADO05073.1| flagellar basal body L-ring protein [Helicobacter pylori Sat464]
 gi|317012165|gb|ADU82773.1| flagellar basal body L-ring protein [Helicobacter pylori
           Lithuania75]
          Length = 237

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  Q ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKQEAQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|317179280|dbj|BAJ57068.1| flagellar basal body L-ring protein [Helicobacter pylori F30]
 gi|317181667|dbj|BAJ59451.1| flagellar basal body L-ring protein [Helicobacter pylori F57]
          Length = 237

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  Q ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKQEAQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|238752864|ref|ZP_04614329.1| Flagellar L-ring protein 1 [Yersinia rohdei ATCC 43380]
 gi|238708903|gb|EEQ01156.1| Flagellar L-ring protein 1 [Yersinia rohdei ATCC 43380]
          Length = 211

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 81/155 (52%), Gaps = 19/155 (12%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
           +L +D RA  VGDILTV +    Q+    +T   + N +   +           P++ G 
Sbjct: 47  SLLQDRRAYRVGDILTVKLDESTQSSKQAKTNFGKKNEMSLGI-----------PEILGK 95

Query: 130 LNYDGGGASSGK----GSISRAEKLNLLIAAIVTAI---LENGNLIISGSQEVRVNDEIR 182
                GG+ SGK    GS + A++ N+L  +I  A+   L NG L+I G + + +N    
Sbjct: 96  KLNKLGGSISGKRDFDGSATSAQQ-NMLRGSITVAVHQVLPNGVLVIRGEKWLTLNQGDE 154

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + VTG+VR  DV+  NSVS  +IA ARISY G+G
Sbjct: 155 YMRVTGLVRADDVERDNSVSSQRIANARISYAGRG 189


>gi|115353115|ref|YP_774954.1| flagellar basal body L-ring protein [Burkholderia ambifaria AMMD]
 gi|123128059|sp|Q0BB53|FLGH_BURCM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|115283103|gb|ABI88620.1| flagellar L-ring protein [Burkholderia ambifaria AMMD]
          Length = 229

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 82/171 (47%), Gaps = 11/171 (6%)

Query: 56  STKKSYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-NSLHRKL 112
           S +   S++   +A   LF+D R  N+GDILT+ I  +  A   +    +R  N+     
Sbjct: 48  SMQAPGSIYNPGYAGRPLFEDQRPRNIGDILTIMIAENINATKSSGANTNRQGNTDFSVP 107

Query: 113 SGGF--SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
           + GF   LF +       N++  G    +  G  S A   N  I   VT +L NGNL++S
Sbjct: 108 TAGFLGGLFAK------ANMSAAGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVS 161

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G +++ +N     +  +G+V P  +   NSV   ++A+A+I Y  KG   E
Sbjct: 162 GEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADAKIEYSSKGYINE 212


>gi|108562753|ref|YP_627069.1| flagellar basal body L-ring protein [Helicobacter pylori HPAG1]
 gi|107836526|gb|ABF84395.1| flagellar basal-body L-ring protein [Helicobacter pylori HPAG1]
          Length = 237

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  Q ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKQEAQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|170703099|ref|ZP_02893919.1| flagellar L-ring protein [Burkholderia ambifaria IOP40-10]
 gi|170131996|gb|EDT00504.1| flagellar L-ring protein [Burkholderia ambifaria IOP40-10]
          Length = 229

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 82/171 (47%), Gaps = 11/171 (6%)

Query: 56  STKKSYSLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-NSLHRKL 112
           S +   S++   +A   LF+D R  N+GDILT+ I  +  A   +    +R  N+     
Sbjct: 48  SMQAPGSIYNPGYAGRPLFEDQRPRNIGDILTIMIAENINATKSSGANTNRQGNTDFSVP 107

Query: 113 SGGF--SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
           + GF   LF +       N++  G    +  G  S A   N  I   VT +L NGNL++S
Sbjct: 108 TAGFLGGLFAK------ANMSAAGANKFAATGGASAANTFNGTITVTVTNVLPNGNLVVS 161

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G +++ +N     +  +G+V P  +   NSV   ++A+A+I Y  KG   E
Sbjct: 162 GEKQMLINQGNEFVRFSGVVNPNTISGANSVYSTQVADAKIEYSSKGYINE 212


>gi|91792667|ref|YP_562318.1| flagellar basal body L-ring protein [Shewanella denitrificans
           OS217]
 gi|91714669|gb|ABE54595.1| flagellar L-ring protein [Shewanella denitrificans OS217]
          Length = 224

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 104/217 (47%), Gaps = 23/217 (10%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY--SL 63
           +I+L   SLL  C S+           P     D+    PF    + ++ +T+ +   S+
Sbjct: 4   YIMLLMVSLLSACSST-----------PRKPIPDD----PFYAPVYPDAPATQTAATGSI 48

Query: 64  WRDSHAA-LFKDSRALNVGDILTVDIRIDDQA--VFDNQTGRSRNNSLHRKLSGGFSLFG 120
           + DS A+ L+ D RA  +GDI+TV +    QA     N   +  + S+    +GG ++  
Sbjct: 49  FLDSQASSLYSDIRAHKIGDIITVVLMESTQAKKSATNDIKKGSDMSMDPLFAGGGNVTI 108

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
           +  P    +L Y     +  +    ++  L   I+A V  +L NGNL+I G + + +N+ 
Sbjct: 109 KGVPL---DLKYKDAYNTKRESDADQSNSLAGSISANVMQVLSNGNLVIRGEKWISINNG 165

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
              + VTGIVR QD+   N++   ++A ARI Y G G
Sbjct: 166 DEFIRVTGIVRSQDIKPDNTIESVRVANARIQYSGTG 202


>gi|188527130|ref|YP_001909817.1| flagellar basal body L-ring protein [Helicobacter pylori Shi470]
 gi|188143370|gb|ACD47787.1| flagellar basal body L-ring protein [Helicobacter pylori Shi470]
          Length = 237

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 93/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR----NNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A + +  G       N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKGYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  Q ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKQEAQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|210134520|ref|YP_002300959.1| flagellar basal body L-ring protein [Helicobacter pylori P12]
 gi|210132488|gb|ACJ07479.1| flagellar basal-body L-ring protein [Helicobacter pylori P12]
          Length = 237

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  Q ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKRQEAQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|311105938|ref|YP_003978791.1| flagellar L-ring protein [Achromobacter xylosoxidans A8]
 gi|310760627|gb|ADP16076.1| flagellar L-ring protein [Achromobacter xylosoxidans A8]
          Length = 214

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 79/159 (49%), Gaps = 15/159 (9%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM---- 126
           LF+D R  NVGDI+T+        V + +T  S+N + +   SG  SL     P      
Sbjct: 48  LFEDRRPRNVGDIVTI--------VLNEKTNASKNVATNTNRSGSASLGIAAAPSFMDSW 99

Query: 127 -NGNLNYD--GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
            N NLN D  GG  S GKG  +        I   V  ++ NGNL ++G +++ +N     
Sbjct: 100 ANANLNTDAKGGNVSQGKGDSTANNAFTGTITTTVVGVMSNGNLQVAGEKQIAINRGSEF 159

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
           +  +G+V P+ +   N+VS  ++A+ARI Y  KG   E+
Sbjct: 160 VRFSGVVDPRSITGTNTVSSTQVADARIEYRSKGVMDEV 198


>gi|257095356|ref|YP_003168997.1| flagellar L-ring protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047880|gb|ACV37068.1| flagellar L-ring protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 229

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 77/151 (50%), Gaps = 2/151 (1%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LF+D RA  VGD +TV I  +  A   + T  S+  S+    +G    F  ++ Q  G L
Sbjct: 64  LFEDRRARYVGDTITVTITENTSAATKSNTAVSKTGSIS-AAAGPIVGFPGKSFQ-GGEL 121

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
             +    +SGKG  +        I   V  +L NGNL++SG ++V +      + ++G+V
Sbjct: 122 KANSSNVASGKGDAAANNVFTGTITVTVIEVLPNGNLLVSGEKQVAIGHGQEYIRLSGVV 181

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            P  V+A N+V+  +IA+ARI Y   G  +E
Sbjct: 182 NPYFVNAANTVASSQIADARIEYKESGTISE 212


>gi|188025865|ref|ZP_02960113.2| hypothetical protein PROSTU_02020 [Providencia stuartii ATCC 25827]
 gi|188020799|gb|EDU58839.1| hypothetical protein PROSTU_02020 [Providencia stuartii ATCC 25827]
          Length = 255

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 81/178 (45%), Gaps = 16/178 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM- 126
           +  LF+D R  NVGDILT++++ +  A        S+N+S +   SG         P   
Sbjct: 85  YQPLFEDRRPRNVGDILTINLQENVSA--------SKNSSANANRSGKTGFLAAILPGFM 136

Query: 127 -------NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                  N  L+  G    SGKG  +        I   V  +L NGNL + G + + +N 
Sbjct: 137 QGWLGGSNTELDVKGSSDFSGKGGANANNTFRGTITVTVDQLLANGNLHVVGEKRIAINQ 196

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              S+  +G+V P+ + A N+VS  ++A+ARI Y G G   E        +   N+SP
Sbjct: 197 GTESIRFSGVVNPRTIGADNNVSSTQVADARIEYVGDGYINESQTMGWLQRFFLNVSP 254


>gi|171321841|ref|ZP_02910742.1| flagellar L-ring protein [Burkholderia ambifaria MEX-5]
 gi|171092879|gb|EDT38131.1| flagellar L-ring protein [Burkholderia ambifaria MEX-5]
          Length = 229

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 75/154 (48%), Gaps = 9/154 (5%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-NSLHRKLSGGF--SLFGQQTPQMN 127
           LF+D R  N+GDILT+ I  +  A   +    +R  N+     +  F   LF +      
Sbjct: 65  LFEDQRPRNIGDILTIMIAENINATKSSGANTNRQGNTDFSVPTAAFLGGLFAK------ 118

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            NL+  G    +  G  S A   N  I   VT++L NGNL++SG +++ +N     +  +
Sbjct: 119 ANLSAAGANKFAATGGASAANTFNGTITVTVTSVLPNGNLVVSGEKQMLINQGNEFVRFS 178

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G+V P  +   NSV   ++A+A+I Y  KG   E
Sbjct: 179 GVVNPNTISGANSVYSTQVADAKIEYSSKGYINE 212


>gi|317406198|gb|EFV86447.1| flagellar basal-body L-ring protein FlgH [Achromobacter
           xylosoxidans C54]
          Length = 230

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 79/159 (49%), Gaps = 15/159 (9%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM---- 126
           LF+D R  NVGDI+T+        V + +T  S+N + +   SG  SL     P      
Sbjct: 64  LFEDRRPRNVGDIVTI--------VLNEKTNASKNVATNTNRSGSASLGITAAPSFMDSW 115

Query: 127 -NGNLNYD--GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
            N NLN D  GG  + GKG  +        I   V  ++ NGNL ++G +++ +N     
Sbjct: 116 ANANLNTDAKGGNVAQGKGDSTANNAFTGTITTTVVGVMSNGNLQVAGEKQIAINRGSEY 175

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
           +  +G+V P+ +   N+VS  ++A+ARI Y  KG   E+
Sbjct: 176 VRFSGVVDPRSITGTNTVSSTQVADARIEYRSKGVMDEV 214


>gi|77359725|ref|YP_339300.1| flagellar basal body L-ring protein [Pseudoalteromonas haloplanktis
           TAC125]
 gi|110816537|sp|Q3IDW1|FLGH_PSEHT RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|76874636|emb|CAI85857.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 227

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 82/154 (53%), Gaps = 6/154 (3%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           L+ D +AL  GDI+TV ++   QA    +T   + +    KL     L G        ++
Sbjct: 59  LYADKKALRTGDIITVKLQESTQASKAAKTETDKQS--DAKLDPVIGLGGLPVNIGGDSI 116

Query: 131 NYDGGGASSGKGSISRAEKLNLL---IAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            +  G  +S KG  S++ + N L   I+  V  +L NGNL+I G + + +N     + + 
Sbjct: 117 QFGIGSDASFKGD-SKSNQSNSLAGDISVNVMRVLPNGNLVIRGEKWLTLNSGEEFIRLE 175

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G+VRP+DV A N+V  ++IA ARI Y GKG+T E
Sbjct: 176 GLVRPEDVTADNTVQSNRIANARIQYSGKGQTQE 209


>gi|126175143|ref|YP_001051292.1| flagellar basal body L-ring protein [Shewanella baltica OS155]
 gi|125998348|gb|ABN62423.1| flagellar L-ring protein [Shewanella baltica OS155]
          Length = 224

 Score = 72.4 bits (176), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 92/178 (51%), Gaps = 8/178 (4%)

Query: 45  PFLGIDFKNSDSTK--KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFD--NQ 99
           PF    +  +  TK   + S+++DS A+ L+ D RA  VGDI+T+ ++   QA     NQ
Sbjct: 28  PFYAPVYPEAPPTKIAATGSIYQDSQASSLYSDIRAHKVGDIITIVLKESTQAKKSAGNQ 87

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
             +  + SL    +GG ++     P    +L Y     +  +    ++  L+  I+A V 
Sbjct: 88  IKKGSDMSLDPIFAGGSNISVGGVPL---DLRYKDSMNTKRESDADQSNSLDGSISANVM 144

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            +L NG+L+I G + + +N+    + VTG+VR QD+   N++   ++A ARI Y G G
Sbjct: 145 QVLNNGSLVIRGEKWISINNGDEFIRVTGLVRSQDIKPDNTIDSTRMANARIQYSGTG 202


>gi|308184128|ref|YP_003928261.1| flagellar basal body L-ring protein [Helicobacter pylori SJM180]
 gi|308060048|gb|ADO01944.1| flagellar basal body L-ring protein [Helicobacter pylori SJM180]
          Length = 237

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  Q ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKQEVQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|317177140|dbj|BAJ54929.1| flagellar basal body L-ring protein [Helicobacter pylori F16]
          Length = 237

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  Q ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKQEVQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|317180776|dbj|BAJ58562.1| flagellar basal body L-ring protein [Helicobacter pylori F32]
          Length = 237

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSTSGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  Q ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKQEAQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|85712257|ref|ZP_01043308.1| Flagellar basal body L-ring protein [Idiomarina baltica OS145]
 gi|85693884|gb|EAQ31831.1| Flagellar basal body L-ring protein [Idiomarina baltica OS145]
          Length = 224

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 77/152 (50%), Gaps = 11/152 (7%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           ++ D +A  +GDI+TV +  R       + QT +  N  L        ++ GQ    +NG
Sbjct: 57  MYSDIKARRLGDIITVTLQERTTASKSANAQTTKESNVDLPVP-----TILGQAA-TING 110

Query: 129 N---LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           N    N  G    +G  +  ++ +L+  I   V   L NGNLI+ G + +R+N     + 
Sbjct: 111 NPISANLGGTRDFTGDATADQSNRLSGEITVTVIRTLANGNLIVRGEKWLRINTGDEYIR 170

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +TGI+RPQDV A N++   ++A ARI Y G G
Sbjct: 171 LTGIIRPQDVSADNTIPSTRVANARIEYSGTG 202


>gi|119775447|ref|YP_928187.1| flagellar basal body L-ring protein [Shewanella amazonensis SB2B]
 gi|166214826|sp|A1S811|FLGH_SHEAM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|119767947|gb|ABM00518.1| flagellar L-ring protein FlgH [Shewanella amazonensis SB2B]
          Length = 224

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 85/164 (51%), Gaps = 16/164 (9%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR----KLSGGF 116
           S++ DS AA L+ D RA  VGDI+TV +    QA       +S NN + +     +    
Sbjct: 47  SIFLDSQAASLYTDIRAHRVGDIITVVLTESTQAT------KSANNEIKKGSDLNMDAIQ 100

Query: 117 SLFGQQTPQMNGN---LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
           +L G  T  ++GN   L Y     +  +    ++  L   I+A V  +L NGNL+I G +
Sbjct: 101 ALGGPVT--ISGNPLSLGYSDSMNTKREADADQSNSLRGNISAHVLQVLANGNLVIRGEK 158

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + +N+    + VTG++RPQD+   N+V   ++A ARI Y G G
Sbjct: 159 WISINNGDEFIRVTGVIRPQDITTDNTVVSTRVANARIQYSGTG 202


>gi|253990124|ref|YP_003041480.1| flagellar basal body L-ring protein [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253781574|emb|CAQ84737.1| flagellar l-ring protein precursor (basal body l-ring protein)
           [Photorhabdus asymbiotica]
          Length = 250

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 85/179 (47%), Gaps = 16/179 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM- 126
           +  LF+D R  N+GD LT+ ++ +  A        S+N+S +   +G  S     TP+  
Sbjct: 80  YQPLFEDRRPRNIGDTLTITLQENVSA--------SKNSSANASRNGKTSFSATLTPRFL 131

Query: 127 -------NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                    +L+ +G     GKG  +        I   V  +L NGNL + G +++ +N 
Sbjct: 132 KGLIGGDKTDLDMEGENTFGGKGGANANNTFRGTITVTVDQLLANGNLHVVGEKQIAINQ 191

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               +  +G+V P+ ++A+N+VS +++A+ARI Y G G   E        +   N++P 
Sbjct: 192 GTEFIRFSGVVNPRTINANNTVSSNQVADARIEYVGNGYINEAQNMGWLQRFFLNVAPF 250


>gi|256830174|ref|YP_003158902.1| flagellar L-ring protein [Desulfomicrobium baculatum DSM 4028]
 gi|256579350|gb|ACU90486.1| flagellar L-ring protein [Desulfomicrobium baculatum DSM 4028]
          Length = 229

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 83/178 (46%), Gaps = 5/178 (2%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG-----GFSLFG 120
           D    LF D+RA  VGDI+ + +     +     T   R +S++  +S         L  
Sbjct: 52  DGATMLFADARAKRVGDIVLIKVVETTLSKSKASTTADRESSMNLGVSAYLGKDKLPLIP 111

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
             T   +  +N        G G   R   L   +AA VT +L  G + + G++E RVN E
Sbjct: 112 GATVGPDALVNAGSTSGFEGDGETKRESSLTTTVAARVTRVLGGGLMEVVGARETRVNGE 171

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            + + V G+ R +D+DA N++    +AEARI   G+G   +  RP    ++++N+ P 
Sbjct: 172 TQIVLVQGVARDRDIDADNTIMSTSLAEARIELYGEGVLADKQRPGWLARILDNVWPF 229


>gi|171321212|ref|ZP_02910182.1| flagellar L-ring protein [Burkholderia ambifaria MEX-5]
 gi|171093522|gb|EDT38692.1| flagellar L-ring protein [Burkholderia ambifaria MEX-5]
          Length = 211

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 88/172 (51%), Gaps = 13/172 (7%)

Query: 57  TKKSYSLWR-DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
           + ++ +L+R D+  +L  D RA  +GDI+T+        V++  +     ++  R    G
Sbjct: 37  SSRADTLYRPDAFQSLIADRRASAIGDIVTI-------LVYEQSSASQTADTSTRT---G 86

Query: 116 FSLFGQQTPQMNGN--LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
           FS+ G  +    GN       G    G+G I R+ +L   ++A+V  +L NG+L ++G Q
Sbjct: 87  FSINGSVSTLYAGNNRAQVGAGDDYGGRGQIQRSGRLLAQLSAVVVDVLPNGDLAVAGEQ 146

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            + VN E   + + G VR  D+   N+V   ++A+ARI Y G G  T+  +P
Sbjct: 147 RIDVNGEKTGIRLNGRVRAIDIGPGNTVLSTRLADARIDYTGDGFVTDRTKP 198


>gi|153001469|ref|YP_001367150.1| flagellar basal body L-ring protein [Shewanella baltica OS185]
 gi|166214827|sp|A6WQJ8|FLGH_SHEB8 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|151366087|gb|ABS09087.1| flagellar L-ring protein [Shewanella baltica OS185]
          Length = 224

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 92/178 (51%), Gaps = 8/178 (4%)

Query: 45  PFLGIDFKNSDSTK--KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFD--NQ 99
           PF    +  +  TK   + S+++DS A+ L+ D RA  VGDI+T+ ++   QA     NQ
Sbjct: 28  PFYAPVYPEAPPTKIAATGSIYQDSQASSLYSDIRAHKVGDIITIVLKESTQAKKSAGNQ 87

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
             +  + SL    +GG ++     P    +L Y     +  +    ++  L+  I+A V 
Sbjct: 88  IKKGSDMSLDPIFAGGSNISVGGVPI---DLRYKDSMNTKRESDADQSNSLDGSISANVM 144

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            +L NG+L+I G + + +N+    + VTG+VR QD+   N++   ++A ARI Y G G
Sbjct: 145 QVLNNGSLVIRGEKWISINNGDEFIRVTGLVRSQDIKPDNTIDSTRMANARIQYSGTG 202


>gi|90415315|ref|ZP_01223249.1| flagellar L-ring protein FlgH [marine gamma proteobacterium
           HTCC2207]
 gi|90332638|gb|EAS47808.1| flagellar L-ring protein FlgH [marine gamma proteobacterium
           HTCC2207]
          Length = 217

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 59/185 (31%), Positives = 87/185 (47%), Gaps = 25/185 (13%)

Query: 71  LFKDSRA-----LNVGDILTVDIRIDDQAV--FDNQTGRSRNN---------SLHRKLSG 114
           LF D R+     L VGD++TV +    QA    D  T R+  N         S+  K+  
Sbjct: 41  LFGDLRSYQGGDLKVGDLVTVLLSETTQASRSSDISTSRASTNDVVTEAQKDSVLDKIGR 100

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASS-GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
           G   F         +   DGG  +S G G+  +A  L   I+A+V  +L NGNL+I G +
Sbjct: 101 GTGFFS--------DFKLDGGTVTSDGTGTADQAASLTGSISAMVVEVLSNGNLVILGEK 152

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIE 233
           ++ + +    + V GI+RP D+   N+V   +IA A+ISY G G   +  +P  G  LI 
Sbjct: 153 QLALTEGSEFIRVKGIIRPADIQPDNTVLSRRIANAQISYRGTGDLAKASKPGWGTGLIF 212

Query: 234 NLSPL 238
              P 
Sbjct: 213 KFWPF 217


>gi|163750567|ref|ZP_02157805.1| flagellar L-ring protein FlgH [Shewanella benthica KT99]
 gi|161329722|gb|EDQ00711.1| flagellar L-ring protein FlgH [Shewanella benthica KT99]
          Length = 228

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 85/161 (52%), Gaps = 10/161 (6%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQA--VFDNQTGRSRNNSLHRKLSGG--F 116
           S+++DS A+ L+ D +AL VGDI+TV +    QA     N+  +  N +L    +GG   
Sbjct: 51  SMYQDSQASSLYSDIKALKVGDIITVILMEATQAKKSASNEIKKGTNLTLDPIYAGGGNI 110

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           ++ GQ       +L Y     +  +    ++  L   I+A V  +L NGNL+I G + + 
Sbjct: 111 TIGGQAL-----DLRYKDSMNTKRESDADQSNSLTGSISANVMQVLNNGNLVIRGEKWIS 165

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +N+    + +TG+VR QD+   N++   ++A ARI Y G G
Sbjct: 166 INNGNEFIRITGVVRSQDIRPDNTIDSTRVANARIQYSGTG 206


>gi|145298494|ref|YP_001141335.1| flagellar basal body L-ring protein [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851266|gb|ABO89587.1| flagellar L-ring protein FlgH [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 224

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 83/155 (53%), Gaps = 7/155 (4%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
           D    ++ D +A  VGDI+T+++     A     T   ++N L  +     +L G     
Sbjct: 52  DQVNGIYSDIKAHKVGDIITIELAESTSASKKANTQSGKDNKLSMEP---VTLGGVPVTA 108

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLL---IAAIVTAILENGNLIISGSQEVRVNDEIR 182
              +L+   G  S+ KG  ++A++ N L   I+  V  +L NGNL++ G + + +N+   
Sbjct: 109 GPYDLSASLGQNSAFKGQ-AKADQSNSLQGNISVSVAKVLPNGNLVVRGEKWIMLNNGNE 167

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + +TG++RP+DV + NSVS  ++A ARI YGG G
Sbjct: 168 YIRITGMIRPEDVTSENSVSSQRVANARIHYGGTG 202


>gi|114562345|ref|YP_749858.1| flagellar basal body L-ring protein [Shewanella frigidimarina NCIMB
           400]
 gi|122941034|sp|Q085P5|FLGH_SHEFN RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|114333638|gb|ABI71020.1| flagellar L-ring protein [Shewanella frigidimarina NCIMB 400]
          Length = 224

 Score = 72.0 bits (175), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 106/217 (48%), Gaps = 23/217 (10%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY--SL 63
           +I L    LL GC S+  +        P+          PF    + ++  T+ +   S+
Sbjct: 4   YIALASVVLLVGCSSTAKK--------PIADD-------PFYAPVYPDTVPTQVAATGSI 48

Query: 64  WRDSHAA-LFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGFSLFG 120
           + DS A+ L+ D RA  VGDI+TV ++   QA    +N+  +  + S+    +GG ++  
Sbjct: 49  YLDSQASSLYSDIRAHRVGDIITVTLKESTQASKSANNEIKKGSDLSVEPVYAGGKNISI 108

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
              P    +L Y     +  +    ++  L+  I+A +  +L NGNL+I G + + +N+ 
Sbjct: 109 SGVPI---DLGYSDSMNTKRESDADQSNSLDGSISANIIQVLSNGNLVIRGEKWISINNG 165

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
              + VTG++R +D++  N++   ++A ARI Y G G
Sbjct: 166 DEFIRVTGMIRSEDINPDNTIDSTRVANARIQYSGTG 202


>gi|238762357|ref|ZP_04623328.1| Flagellar L-ring protein 1 [Yersinia kristensenii ATCC 33638]
 gi|238699342|gb|EEP92088.1| Flagellar L-ring protein 1 [Yersinia kristensenii ATCC 33638]
          Length = 212

 Score = 72.0 bits (175), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 81/155 (52%), Gaps = 19/155 (12%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
           +L +D RA  +GDILTV +    Q+    +T   + N +   +           P++ G 
Sbjct: 48  SLLQDRRAYRIGDILTVKLDESTQSSKQAKTNFGKKNDMSLGI-----------PEILGK 96

Query: 130 LNYDGGGASSGK----GSISRAEKLNLLIAAIVTAI---LENGNLIISGSQEVRVNDEIR 182
                GG+ SGK    GS + A++ N+L  +I  A+   L NG L+I G + + +N    
Sbjct: 97  KLNKLGGSISGKRDFDGSATSAQQ-NMLRGSITVAVHQVLPNGVLVIRGEKWLTLNQGDE 155

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + VTG+VR  DV+  NSVS  +IA ARISY G+G
Sbjct: 156 YMRVTGLVRADDVERDNSVSSQRIANARISYAGRG 190


>gi|294665576|ref|ZP_06730857.1| flagellar L-ring protein precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292604674|gb|EFF48044.1| flagellar L-ring protein precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 230

 Score = 72.0 bits (175), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 79/155 (50%), Gaps = 16/155 (10%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK---LSGGFSLFGQQTPQMN 127
           L+ D RA +VGD+LTV++      V       + N S+ +K        +L G   P   
Sbjct: 62  LYGDRRARDVGDLLTVNL------VESTTASSTANTSISKKDATTMAAPTLLG--APLTV 113

Query: 128 GNLNY-----DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           G LN       G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+     
Sbjct: 114 GGLNVLENSTSGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDE 173

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + V GIVR  D+   N+V   K+A+ARI+YGG+G
Sbjct: 174 LVQVQGIVRAADIAPDNTVPSSKVADARIAYGGRG 208


>gi|325927972|ref|ZP_08189193.1| flagellar basal body L-ring protein [Xanthomonas perforans 91-118]
 gi|325541657|gb|EGD13178.1| flagellar basal body L-ring protein [Xanthomonas perforans 91-118]
          Length = 230

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 79/155 (50%), Gaps = 16/155 (10%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK---LSGGFSLFGQQTPQMN 127
           L+ D RA +VGD+LTV++      V       + N S+ +K        +L G   P   
Sbjct: 62  LYGDRRARDVGDLLTVNL------VESTTASSTANTSISKKDATTMAAPTLLG--APLTV 113

Query: 128 GNLNY-----DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           G LN       G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+     
Sbjct: 114 GGLNVLENSTSGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDE 173

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + V GIVR  D+   N+V   K+A+ARI+YGG+G
Sbjct: 174 LVQVQGIVRAADIAPDNTVPSSKVADARIAYGGRG 208


>gi|294624041|ref|ZP_06702804.1| flagellar L-ring protein precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292601660|gb|EFF45634.1| flagellar L-ring protein precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 230

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 79/155 (50%), Gaps = 16/155 (10%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK---LSGGFSLFGQQTPQMN 127
           L+ D RA +VGD+LTV++      V       + N S+ +K        +L G   P   
Sbjct: 62  LYGDRRARDVGDLLTVNL------VESTTASSTANTSISKKDATTMAAPTLLG--APLTV 113

Query: 128 GNLNY-----DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           G LN       G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+     
Sbjct: 114 GGLNVLENSTSGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDE 173

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + V GIVR  D+   N+V   K+A+ARI+YGG+G
Sbjct: 174 LVQVQGIVRAADIAPDNTVPSSKVADARIAYGGRG 208


>gi|21242724|ref|NP_642306.1| flagellar basal body L-ring protein [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|31076714|sp|Q8PL26|FLGH_XANAC RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|21108200|gb|AAM36842.1| flagellar L-ring protein [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 230

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 79/155 (50%), Gaps = 16/155 (10%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK---LSGGFSLFGQQTPQMN 127
           L+ D RA +VGD+LTV++      V       + N S+ +K        +L G   P   
Sbjct: 62  LYGDRRARDVGDLLTVNL------VESTTASSTANTSISKKDATTMAAPTLLG--APLTV 113

Query: 128 GNLNY-----DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           G LN       G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+     
Sbjct: 114 GGLNVLENSTSGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDE 173

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + V GIVR  D+   N+V   K+A+ARI+YGG+G
Sbjct: 174 LVQVQGIVRAADIAPDNTVPSSKVADARIAYGGRG 208


>gi|217031551|ref|ZP_03437056.1| hypothetical protein HPB128_21g109 [Helicobacter pylori B128]
 gi|298736730|ref|YP_003729260.1| flagellar L-ring protein FlgH [Helicobacter pylori B8]
 gi|216946751|gb|EEC25347.1| hypothetical protein HPB128_21g109 [Helicobacter pylori B128]
 gi|298355924|emb|CBI66796.1| flagellar L-ring protein precursor FlgH [Helicobacter pylori B8]
          Length = 237

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  + ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKQEAEYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|94312672|ref|YP_585881.1| flagellar basal body L-ring protein [Cupriavidus metallidurans
           CH34]
 gi|93356524|gb|ABF10612.1| flagellar basal body L-ring protein [Cupriavidus metallidurans
           CH34]
          Length = 237

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 56/172 (32%), Positives = 85/172 (49%), Gaps = 22/172 (12%)

Query: 62  SLWRDSHAA---LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRK 111
           S++  S+AA   LF+D R  NVGDILT+ I  +  A  ++ +  SR        N++ R 
Sbjct: 59  SIFASSYAAGNPLFEDRRPRNVGDILTIVITENINASKNSGSNASRAGNSTLSFNAVPRA 118

Query: 112 LSGGFSLFGQQTPQMNGNLNYDGGGASSGK--GSISRAEKLNLLIAAIVTAILENGNLII 169
           L+G FS             N D GG ++ K  G  S     N  I   V  +L NGNL++
Sbjct: 119 LAGLFS----------SASNADIGGTNTLKASGGSSANNTFNGTITVTVLEVLPNGNLVV 168

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           SG +++ +N     +  +G+V P+ +   N V   ++A+ARI Y  KG   E
Sbjct: 169 SGEKQMAINQGAEFIRFSGVVNPRTITGDNGVLSTQVADARIEYTAKGYIDE 220


>gi|148554186|ref|YP_001261768.1| flagellar L-ring protein [Sphingomonas wittichii RW1]
 gi|148499376|gb|ABQ67630.1| flagellar L-ring protein [Sphingomonas wittichii RW1]
          Length = 227

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 87/175 (49%), Gaps = 8/175 (4%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ--TGRSRNNSLHRKLSGGFSLFGQQT 123
           + ++AL   +RA  +GDI+T+ +    QA   N   T RS    L    +G  SLF    
Sbjct: 59  NGYSALTNGARAAMIGDIVTITLVERTQAAKSNSASTDRSGELGLTPPTTGPLSLFKPT- 117

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                ++   GG   +GKG+ +++ +LN  I+  +  +  NG +++ G + + +N    +
Sbjct: 118 -----DVGASGGSTFTGKGAAAQSNQLNGEISVSIVRVYPNGTMLVRGEKLLTLNRGDEN 172

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           + +TG++R  D+   N V   ++A+ARI+Y GKG      R    ++    LSP 
Sbjct: 173 IAITGLIRAADIGPDNRVPSTRVADARITYSGKGEIARGSRQGWLNRFFSILSPF 227


>gi|308182497|ref|YP_003926624.1| flagellar basal body L-ring protein [Helicobacter pylori PeCan4]
 gi|308064682|gb|ADO06574.1| flagellar basal body L-ring protein [Helicobacter pylori PeCan4]
          Length = 237

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              +Q  + ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKQEAEYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|209521592|ref|ZP_03270290.1| flagellar L-ring protein [Burkholderia sp. H160]
 gi|209497975|gb|EDZ98132.1| flagellar L-ring protein [Burkholderia sp. H160]
          Length = 233

 Score = 71.6 bits (174), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 77/154 (50%), Gaps = 9/154 (5%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL-SGGF--SLFGQQTPQMN 127
           LF+D R  NVGDI+T+ I  +  A   +    +RN S    + + GF   LF +      
Sbjct: 69  LFEDQRPRNVGDIITIVIAENINATKSSGANANRNGSTKFDVPTAGFLGGLFAKT----- 123

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            NL+  G    +G G  + +   N  I   VT +  NGNLI+SG +++ +N     +  +
Sbjct: 124 -NLSATGTNGFAGTGGANASNTFNGTITVTVTGVQPNGNLIVSGEKQMLINQGNEFVRFS 182

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G+V P  + + N+V   ++A+A+I Y  KG   E
Sbjct: 183 GVVNPNTISSLNAVYSTQVADAKIEYSAKGYIDE 216


>gi|262273525|ref|ZP_06051339.1| flagellar L-ring protein FlgH [Grimontia hollisae CIP 101886]
 gi|262222503|gb|EEY73814.1| flagellar L-ring protein FlgH [Grimontia hollisae CIP 101886]
          Length = 186

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 82/148 (55%), Gaps = 5/148 (3%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
           ALF+D RA  VGDILT  I +D+Q     + G S + S    + G  +LFG   PQ  G 
Sbjct: 22  ALFQDRRAFRVGDILT--ITLDEQTRSSKKAGTSFDKSSDVSM-GVPTLFGTSYPQ--GE 76

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           ++  G    SG  S S+   L+  I  +V  ++ NG L + G + +R+N     + ++G+
Sbjct: 77  VSVSGSRDFSGASSSSQQNSLSGSITVMVDEVMPNGVLRVRGEKWLRLNQGDEFIRLSGL 136

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKG 217
           VR  D+D +N VS  ++ +ARI+Y G+G
Sbjct: 137 VRVDDIDGNNQVSSQRLGDARITYSGRG 164


>gi|330830300|ref|YP_004393252.1| flagellar L-ring protein [Aeromonas veronii B565]
 gi|328805436|gb|AEB50635.1| Flagellar L-ring protein [Aeromonas veronii B565]
          Length = 224

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 80/155 (51%), Gaps = 7/155 (4%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR---KLSGGFSLFGQQ 122
           D    ++ D +A  VGDI+T+++     A     T   +NN  +    KL GG  +    
Sbjct: 52  DQVNGIYSDIKAHKVGDIITIELSESTSASKKANTQSGKNNKFNLDPVKL-GGVPVTASP 110

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
              ++ ++  D   A  G+    ++  L   I+  V  +L NGNL++ G + + +N+   
Sbjct: 111 Y-DLSASIAQDS--AFKGQAKADQSNSLQGNISVSVAKVLPNGNLVVRGEKWIMLNNGNE 167

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + +TG++RP+DV + NSVS  K+A ARI YGG G
Sbjct: 168 YIRITGLIRPEDVTSDNSVSSQKVANARIYYGGTG 202


>gi|160876200|ref|YP_001555516.1| flagellar basal body L-ring protein [Shewanella baltica OS195]
 gi|217972601|ref|YP_002357352.1| flagellar basal body L-ring protein [Shewanella baltica OS223]
 gi|304409975|ref|ZP_07391594.1| flagellar L-ring protein [Shewanella baltica OS183]
 gi|307302312|ref|ZP_07582070.1| flagellar L-ring protein [Shewanella baltica BA175]
 gi|189044482|sp|A9KWR9|FLGH_SHEB9 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789284|sp|B8E9X5|FLGH_SHEB2 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|160861722|gb|ABX50256.1| flagellar L-ring protein [Shewanella baltica OS195]
 gi|217497736|gb|ACK45929.1| flagellar L-ring protein [Shewanella baltica OS223]
 gi|304351384|gb|EFM15783.1| flagellar L-ring protein [Shewanella baltica OS183]
 gi|306914350|gb|EFN44771.1| flagellar L-ring protein [Shewanella baltica BA175]
 gi|315268390|gb|ADT95243.1| flagellar L-ring protein [Shewanella baltica OS678]
          Length = 224

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 92/178 (51%), Gaps = 8/178 (4%)

Query: 45  PFLGIDFKNSDSTK--KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFD--NQ 99
           PF    +  +  TK   + S+++DS A+ L+ D RA  VGDI+T+ ++   QA     NQ
Sbjct: 28  PFYAPVYPEAPPTKIAATGSIYQDSQASSLYSDIRAHKVGDIITIVLKESTQAKKSAGNQ 87

Query: 100 TGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVT 159
             +  + SL    +GG ++     P    +L Y     +  +    ++  L+  I+A V 
Sbjct: 88  IKKGSDMSLDPIFAGGSNVSIGGVPI---DLRYKDSMNTKRESDADQSNSLDGSISANVM 144

Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            +L NG+L+I G + + +N+    + VTG+VR QD+   N++   ++A ARI Y G G
Sbjct: 145 QVLNNGSLVIRGEKWISINNGDEFIRVTGLVRSQDIKPDNTIDSTRMANARIQYSGTG 202


>gi|312173288|emb|CBX81543.1| Flagellar L-ring protein precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 237

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 99/218 (45%), Gaps = 35/218 (16%)

Query: 30  QMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIR 89
           QM+P+G+S          G  F++  +    Y         +F+D R  NVGD LT+ ++
Sbjct: 46  QMAPIGAS----------GSLFQSGQAMNYGYQ-------PMFEDRRPRNVGDTLTILLQ 88

Query: 90  IDDQAVFDNQTGRSRNNS-------LHRKLSGGFSLFGQQTPQMNGNLNYDGGGAS--SG 140
            +  A   +    +RN S       +   +SG            NG L+++ GG S  +G
Sbjct: 89  ENVSASKSSSASANRNGSAGMGLEVVPSSVSGALG---------NGKLDFNAGGQSDFAG 139

Query: 141 KGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNS 200
           KG  +        I   V  +L NGNL + G +++ +N     +  +G+V P+ +  +N+
Sbjct: 140 KGGAAARNTFTGTITVTVNQLLPNGNLQVVGEKQIAINQGTEFIRFSGVVNPRTISGNNT 199

Query: 201 VSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VS  ++++ARI Y G G   E        +++ N+SP 
Sbjct: 200 VSSTQVSDARIEYVGNGYINESQNMGWLQRVLLNISPF 237


>gi|119469953|ref|ZP_01612758.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Alteromonadales
           bacterium TW-7]
 gi|119446663|gb|EAW27936.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Alteromonadales
           bacterium TW-7]
          Length = 227

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 83/157 (52%), Gaps = 12/157 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLS-GGFSLFGQQTPQMN 127
           L+ D +AL  GDI+TV+++   QA      +T +  + SL   +  GG  +       + 
Sbjct: 59  LYADRKALRTGDIITVNLQESTQATKAAKTETDKQSDASLDPVIGLGGLPV------NIG 112

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQEVRVNDEIRSL 184
           G+    G G+ +     S++ + N L   I   V  +L NGNL+I G + + +N     +
Sbjct: 113 GDSIQFGIGSDASFTGDSKSNQSNSLFGNISVNVMRVLPNGNLVIRGEKWLTLNTGEEFI 172

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            + G+VRPQDV + N+V  ++IA ARI Y GKG+T E
Sbjct: 173 RLEGLVRPQDVSSDNTVESNRIANARIQYSGKGQTQE 209


>gi|289666051|ref|ZP_06487632.1| flagellar basal body L-ring protein [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 230

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 81/155 (52%), Gaps = 16/155 (10%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS---LFGQQTPQMN 127
           L+ D RA +VGD+LTV++      V       + N S+ +K +   S   L G   P   
Sbjct: 62  LYGDRRARDVGDLLTVNL------VESTTASSTANTSISKKDATTMSAPTLLG--APLTV 113

Query: 128 GNLNY-----DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           G LN      +G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+     
Sbjct: 114 GGLNVLENSTNGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDE 173

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + V GIVR  D+   N+V   ++A+ARI+YGG+G
Sbjct: 174 LVQVQGIVRAADIAPDNTVPSSRVADARIAYGGRG 208


>gi|330818582|ref|YP_004362287.1| flagellar L-ring protein FlgH [Burkholderia gladioli BSR3]
 gi|327370975|gb|AEA62331.1| flagellar L-ring protein FlgH [Burkholderia gladioli BSR3]
          Length = 232

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 80/165 (48%), Gaps = 11/165 (6%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL-SGGF-- 116
           S++   +A   LF+D R  N+GDILT+ I  +  A   +    +R  S    + + GF  
Sbjct: 57  SIYNPGYAGRPLFEDQRPRNIGDILTIMIAENVNATKTSGANANRGGSTDFNVPTAGFLG 116

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            LF +       NL+  G    +  G  + A   +  I   VT +L NGNL++SG +++ 
Sbjct: 117 GLFNK------ANLSASGSNKFTATGGATAANTFSGTITVTVTNVLPNGNLMVSGEKQML 170

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +N     +  +G+V P  +   NSV   ++A+ARI Y  KG   E
Sbjct: 171 INQGNEFVRFSGVVNPNSISGANSVYSTQVADARIEYSAKGYINE 215


>gi|285018206|ref|YP_003375917.1| flagellar l-ring protein precursor (basal body l-ring protein)
           [Xanthomonas albilineans GPE PC73]
 gi|283473424|emb|CBA15929.1| probable flagellar l-ring protein precursor (basal body l-ring
           protein) [Xanthomonas albilineans]
          Length = 232

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 83/157 (52%), Gaps = 10/157 (6%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP-QMNG 128
           +L+ D RA +VGD+LT+ +     A     T  S+ +S+        +L G  TP  +NG
Sbjct: 63  SLYSDRRARDVGDLLTITLVESTNASSTAGTSISKKDSVKMATP---TLLG--TPFTING 117

Query: 129 ----NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
               N +  G  + +GKG+ +++  +   +   V   L NGNL+I G + +R+N     +
Sbjct: 118 TDVLNNSTSGDRSFAGKGNTAQSNTMQGSLTVTVMQRLPNGNLVIQGDKNLRLNQGDELV 177

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            V GIVR  D+   N++   K+A+ARI+YGG+G   +
Sbjct: 178 QVQGIVRAADIAPDNTIPSSKVADARIAYGGRGAVAQ 214


>gi|292489130|ref|YP_003532017.1| flagellar L-ring protein [Erwinia amylovora CFBP1430]
 gi|292900249|ref|YP_003539618.1| flagellar L-ring protein [Erwinia amylovora ATCC 49946]
 gi|291200097|emb|CBJ47223.1| flagellar L-ring protein [Erwinia amylovora ATCC 49946]
 gi|291554564|emb|CBA22175.1| Flagellar L-ring protein precursor [Erwinia amylovora CFBP1430]
          Length = 237

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 99/218 (45%), Gaps = 35/218 (16%)

Query: 30  QMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIR 89
           QM+P+G+S          G  F++  +    Y         +F+D R  NVGD LT+ ++
Sbjct: 46  QMAPIGAS----------GSLFQSGQAMNYGYQ-------PMFEDRRPRNVGDTLTILLQ 88

Query: 90  IDDQAVFDNQTGRSRNNS-------LHRKLSGGFSLFGQQTPQMNGNLNYDGGGAS--SG 140
            +  A   +    +RN S       +   +SG            NG L+++ GG S  +G
Sbjct: 89  ENVSASKSSSASANRNGSAGMGLEVVPSSVSGALG---------NGKLDFNAGGQSDFAG 139

Query: 141 KGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNS 200
           KG  +        I   V  +L NGNL + G +++ +N     +  +G+V P+ +  +N+
Sbjct: 140 KGGAAARNTFTGTITVTVNQLLPNGNLQVVGEKQIAINQGTEFIRFSGVVNPRTISGNNT 199

Query: 201 VSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VS  ++++ARI Y G G   E        +++ N+SP 
Sbjct: 200 VSSTQVSDARIEYVGNGYINESQNMGWLQRVLLNISPF 237


>gi|242238972|ref|YP_002987153.1| flagellar L-ring protein [Dickeya dadantii Ech703]
 gi|242131029|gb|ACS85331.1| flagellar L-ring protein [Dickeya dadantii Ech703]
          Length = 228

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 83/178 (46%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH-------RKLSGGFSLFG 120
           +  LF+D R  NVGDILT+ ++ +  A   +    SR+ S         R L G   LFG
Sbjct: 58  YQPLFEDRRPRNVGDILTITLQENVSASKSSTASASRDGSATSTVTTAPRMLQG---LFG 114

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            Q      +L+  G    +GKG  + +      I   V  +L NGNL + G +++ +N  
Sbjct: 115 NQ----RADLDAAGTNDFTGKGGATASNTFTGTITVTVREVLSNGNLKVVGEKQIAINQG 170

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y GKG   E        +   N++P 
Sbjct: 171 AEYIRFSGVVNPRTITGTNSVVSTQVADARIEYVGKGYINEAQEMGWLQRFFLNVAPF 228


>gi|332704821|ref|ZP_08424909.1| Flagellar L-ring protein [Desulfovibrio africanus str. Walvis Bay]
 gi|332554970|gb|EGJ52014.1| Flagellar L-ring protein [Desulfovibrio africanus str. Walvis Bay]
          Length = 235

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 88/180 (48%), Gaps = 16/180 (8%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LF+D RA  VGDI+ V I           T   +++S     +G  + FG+    + G +
Sbjct: 60  LFEDDRARRVGDIVLVRIVETSSGSHTADTTSDKDSSYQ---AGVTNYFGRSKVGIAG-I 115

Query: 131 NYDGGGAS------------SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           N+ G   +            S  G  SR   L   + A V  +L +G L + G++++R+N
Sbjct: 116 NFPGTVGTDPMIGTNTTSKFSASGETSRESDLTAAVGARVIRVLPDGLLQVEGARQMRIN 175

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           DE + L V G+VR +D+   NS+S  ++A A + Y G+G   +  RP    ++++N+ P 
Sbjct: 176 DETQILVVRGLVRSRDIGPDNSISSSQMANAEVEYYGQGVLADKQRPGWIARILDNIWPF 235


>gi|300816781|ref|ZP_07097001.1| flagellar L-ring protein FlgH [Escherichia coli MS 107-1]
 gi|300530555|gb|EFK51617.1| flagellar L-ring protein FlgH [Escherichia coli MS 107-1]
          Length = 235

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSYANASRDGKTNFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   N  +   V  +L NGNL + G +++ +N  
Sbjct: 122 N----ARADVEASGGNTFNGKGGANASNTFNGTLTVTVDQVLVNGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|23092318|gb|AAN08643.1| FlgH [Aeromonas hydrophila]
          Length = 223

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 82/155 (52%), Gaps = 7/155 (4%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
           D    ++ D  A  VGDI+T+++     A     T  +++N L        SL G     
Sbjct: 51  DQVNCIYSDINAHRVGDIITIELAESTSASKKANTTAAQDNKLSLDQ---VSLGGVPVTA 107

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLL---IAAIVTAILENGNLIISGSQEVRVNDEIR 182
              +L+   G  S+ KG  ++A++ N L   I+  V  +L NGNLI+ G + + +N+   
Sbjct: 108 GPYDLSASLGQNSAFKGQ-AKADQSNSLQGNISVSVAKVLPNGNLIVRGEKWIMLNNGNE 166

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + +TG++RP+DV + NSVS  ++A ARI YGG G
Sbjct: 167 YIRITGMIRPEDVTSENSVSSQRVANARIHYGGTG 201


>gi|34558388|ref|NP_908203.1| flagellar basal body L-ring protein [Wolinella succinogenes DSM
           1740]
 gi|34484107|emb|CAE11103.1| FLAGELLAR L-RING PROTEIN FLGH [Wolinella succinogenes]
          Length = 238

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 89/190 (46%), Gaps = 16/190 (8%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFD-----NQTGRSRNNSLHRKLSGGF 116
           SL+      LF D RA+ + D++TV I     A        ++T  S  N       G  
Sbjct: 52  SLFGQGDNPLFADRRAMKLNDLVTVIINETASASSSGKKDLSETSSSTMNGPSVTFGGPS 111

Query: 117 SLFGQQTPQMNGNLNYDGGGASSG--------KGSISRAEKLNLLIAAIVTAILENGNLI 168
              G    ++N   N+   G S+G         G+  R E     ++A +  ++ENGN  
Sbjct: 112 QSIGNAVNKLN---NFTSFGLSTGNNNSTFAGSGTQQRQESFTTTVSARIIKVMENGNYF 168

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G +E+ +N E + + +TG++RP D+  +N+++   IA+A+I Y  +G   +      G
Sbjct: 169 IEGGREILINGEKQIMRLTGVIRPYDIGRNNTINSRYIADAKIMYETQGEIKKSTEKGWG 228

Query: 229 HQLIENLSPL 238
            +++E++ P 
Sbjct: 229 TKVLESVWPF 238


>gi|118574273|sp|Q7M7T1|FLGH_WOLSU RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 235

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 89/190 (46%), Gaps = 16/190 (8%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFD-----NQTGRSRNNSLHRKLSGGF 116
           SL+      LF D RA+ + D++TV I     A        ++T  S  N       G  
Sbjct: 49  SLFGQGDNPLFADRRAMKLNDLVTVIINETASASSSGKKDLSETSSSTMNGPSVTFGGPS 108

Query: 117 SLFGQQTPQMNGNLNYDGGGASSG--------KGSISRAEKLNLLIAAIVTAILENGNLI 168
              G    ++N   N+   G S+G         G+  R E     ++A +  ++ENGN  
Sbjct: 109 QSIGNAVNKLN---NFTSFGLSTGNNNSTFAGSGTQQRQESFTTTVSARIIKVMENGNYF 165

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G +E+ +N E + + +TG++RP D+  +N+++   IA+A+I Y  +G   +      G
Sbjct: 166 IEGGREILINGEKQIMRLTGVIRPYDIGRNNTINSRYIADAKIMYETQGEIKKSTEKGWG 225

Query: 229 HQLIENLSPL 238
            +++E++ P 
Sbjct: 226 TKVLESVWPF 235


>gi|149927801|ref|ZP_01916052.1| Flagellar L-ring protein [Limnobacter sp. MED105]
 gi|149823423|gb|EDM82654.1| Flagellar L-ring protein [Limnobacter sp. MED105]
          Length = 201

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 80/154 (51%), Gaps = 7/154 (4%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS--LHRKLSGGFSLFGQQTP 124
           ++  LF+D RA  +GD LT+ I     A   N    SR++S  +   L  GF  FG +  
Sbjct: 31  TYRPLFEDQRARFLGDTLTIQIIEQINAAQTNSMSASRSDSASIDVPLIQGF--FGSRDL 88

Query: 125 Q-MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
           + +NG+ + D     SG+GS   A  L   I   V ++L NGNL + G +++  N E+  
Sbjct: 89  RAINGSASSDKD--FSGEGSSRAANTLTGSITVTVASVLPNGNLQVVGEKQIGTNREVEY 146

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           L  +G+V P  +   N V   K+A+ARI Y GKG
Sbjct: 147 LKFSGVVNPITILPGNVVPSTKVADARIEYRGKG 180


>gi|269138585|ref|YP_003295285.1| flagellar basal body L-ring protein [Edwardsiella tarda EIB202]
 gi|267984245|gb|ACY84074.1| flagellar basal body L-ring protein [Edwardsiella tarda EIB202]
 gi|304558595|gb|ADM41259.1| Flagellar L-ring protein FlgH [Edwardsiella tarda FL6-60]
          Length = 228

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 82/177 (46%), Gaps = 14/177 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS-------LHRKLSGGFSLFG 120
           +  LF+D R  N+GDILT+ ++ +  A   +    SRN +       + R L G   LFG
Sbjct: 58  YQPLFEDRRPRNIGDILTIVLQENVSASKSSSANASRNGTSKFDFATVPRYLEG---LFG 114

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M  N    G    +GKG  +     +  I   V  +L NGNL + G +++ +N  
Sbjct: 115 NARANMEAN----GDNQFNGKGGANANNTFSGTITVTVDDVLSNGNLKVVGEKQIAINQG 170

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              +  +G+V P+ +  +NSV   ++A+ARI Y G G   E        +   NLSP
Sbjct: 171 TEYIRFSGVVNPRTISGNNSVPSTQVADARIEYVGSGYINEAQNMGWMQRFFLNLSP 227


>gi|323492335|ref|ZP_08097488.1| flagellar basal body L-ring protein [Vibrio brasiliensis LMG 20546]
 gi|323313382|gb|EGA66493.1| flagellar basal body L-ring protein [Vibrio brasiliensis LMG 20546]
          Length = 223

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 85/162 (52%), Gaps = 16/162 (9%)

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGF-- 116
           SL+R  +   LF+D RA  VGD+LTV +  + ++    D Q G+S         S GF  
Sbjct: 50  SLYRHQYTMTLFQDRRAYRVGDMLTVVLSEETESSKKADTQYGKS--------ASVGFAA 101

Query: 117 -SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
            S+ G+   ++  +++ D   +  G  S S+  KL   I   V  +L NG L ISG + +
Sbjct: 102 PSIAGKTIDELAASIDADR--SFDGSASSSQGNKLEGAITVTVHDVLPNGVLRISGEKWI 159

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           R+N     + +TGIVR  D+  +N V   +I +ARI+Y G+G
Sbjct: 160 RLNQGDEFIRLTGIVRVDDISRNNQVPSSRIGDARITYSGRG 201


>gi|149194488|ref|ZP_01871584.1| flagellar L-ring protein precursor H [Caminibacter mediatlanticus
           TB-2]
 gi|149135232|gb|EDM23712.1| flagellar L-ring protein precursor H [Caminibacter mediatlanticus
           TB-2]
          Length = 235

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 107/241 (44%), Gaps = 50/241 (20%)

Query: 7   IVLCYSSLLF-GC--HSSISEITGIPQ--MSPMGSSLDENNRMPFLGIDFKNSDSTKKSY 61
           I L +  + + GC  H     IT  P   +  M S   +N + P  G  F N D+     
Sbjct: 5   ITLLFPLIFYVGCATHPMDPTITMTPPKYVEEMPSKTQDNIQNP--GSLFTNGDN----- 57

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS-------LHRKLSG 114
                    LF D++A  V D++TV   I +Q    +Q  +  N +       L   +SG
Sbjct: 58  ---------LFSDTKAKKVNDVVTV--LITEQIKQSSQASKKLNEANTDAGGILDASISG 106

Query: 115 GFSLFGQQT-----------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILE 163
                G++            P MN N  + G G      S  R E+    I+A +  IL 
Sbjct: 107 SAYFGGREEKLAKTGISLNLPSMNSNRTFQGSG------SQQRNEQFQTTISARIVKILA 160

Query: 164 NGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG---RTT 220
           NGN  I G++E+ V+ + + + ++G++RP+D+   N++    IA+A+I+Y  +G   R T
Sbjct: 161 NGNYYIYGTREIYVDGQKQIIKISGVIRPEDISPDNTIDSKYIADAKIAYETEGDIKRYT 220

Query: 221 E 221
           E
Sbjct: 221 E 221


>gi|292492366|ref|YP_003527805.1| flagellar L-ring protein [Nitrosococcus halophilus Nc4]
 gi|291580961|gb|ADE15418.1| flagellar L-ring protein [Nitrosococcus halophilus Nc4]
          Length = 265

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 80/170 (47%), Gaps = 20/170 (11%)

Query: 70  ALFKDSRALNVGDILTV------DIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           +LF D RA   GD+LT+      D   +     D +T  S  N     L G    F   T
Sbjct: 86  SLFTDYRARQAGDVLTIVLEERTDAEKESDTAIDKETSYSLTNP---TLLGSAVQF--DT 140

Query: 124 PQM-------NGNLNYDGG--GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
           P+        N +L       GA SG G  S+  +L+  I   V  +L NGNLI+ G + 
Sbjct: 141 PKWFPLASNKNNSLEMAAAVEGAFSGSGDSSQNNRLDGHITVTVAEVLPNGNLIVQGEKV 200

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           + +N     L ++GIV P+D+   N+VS  ++A+ R++Y G G T +  R
Sbjct: 201 ITINQGNEYLRISGIVSPRDIQPDNTVSSLRLADVRLAYVGDGATQDANR 250


>gi|258622491|ref|ZP_05717513.1| Flagellar L-ring protein precursor [Vibrio mimicus VM573]
 gi|258625231|ref|ZP_05720143.1| Flagellar L-ring protein precursor [Vibrio mimicus VM603]
 gi|262173357|ref|ZP_06041034.1| flagellar L-ring protein FlgH [Vibrio mimicus MB-451]
 gi|258582478|gb|EEW07315.1| Flagellar L-ring protein precursor [Vibrio mimicus VM603]
 gi|258585191|gb|EEW09918.1| Flagellar L-ring protein precursor [Vibrio mimicus VM573]
 gi|261890715|gb|EEY36702.1| flagellar L-ring protein FlgH [Vibrio mimicus MB-451]
          Length = 225

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 82/160 (51%), Gaps = 4/160 (2%)

Query: 59  KSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           KS SL+R  ++  LF+D RA  VGDILTV +  + ++    + G          L     
Sbjct: 47  KSGSLYRHQYSMTLFQDRRAYRVGDILTVQLSEETES--SKKAGTKYGKGTDTNLGIAAP 104

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
             G +  + + +L+ +G  +  G  S S+  KL   I   V  +L NG L ISG + + +
Sbjct: 105 TLGSEKLR-DFSLSLEGERSFDGNASSSQGNKLQGAITVTVREVLPNGVLRISGEKWLSL 163

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           N     + +TGIVR  D+  +N VS  +I +ARI+Y G+G
Sbjct: 164 NQGDEFIRLTGIVRVDDISRNNQVSSLRIGDARITYAGRG 203


>gi|109947537|ref|YP_664765.1| flagellar basal body L-ring protein [Helicobacter acinonychis str.
           Sheeba]
 gi|109714758|emb|CAJ99766.1| flagellar L-ring protein FlgH [Helicobacter acinonychis str.
           Sheeba]
          Length = 232

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 46  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 105

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              ++  + ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 106 EKKKKEAEYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 165

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 166 NKEVLVDGEKQVLKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 225

Query: 232 IENLSP 237
           +E   P
Sbjct: 226 METQMP 231


>gi|294635613|ref|ZP_06714090.1| flagellar L-ring protein FlgH [Edwardsiella tarda ATCC 23685]
 gi|291091065|gb|EFE23626.1| flagellar L-ring protein FlgH [Edwardsiella tarda ATCC 23685]
          Length = 236

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 83/177 (46%), Gaps = 14/177 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN-------SLHRKLSGGFSLFG 120
           +  LF+D R  N+GDILT+ ++ +  A   +    SRN        ++ R L G   LFG
Sbjct: 66  YQPLFEDRRPRNIGDILTIVLQENVSASKSSSANASRNGGSKFDFATVPRYLEG---LFG 122

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N+  +G    +GKG  +     +  I   V  +L NGNL + G +++ +N  
Sbjct: 123 N----ARANMEVNGENQFNGKGGANANNTFSGTITVTVADVLSNGNLKVVGEKQIAINQG 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              +  +G+V P+ +  +NSV   ++A+ARI Y G G   E        +   NLSP
Sbjct: 179 TEYIRFSGVVNPRTISGNNSVPSTQVADARIEYVGSGYINEAQNMGWMQRFFLNLSP 235


>gi|311694364|gb|ADP97237.1| flagellar basal body L-ring protein [marine bacterium HP15]
          Length = 233

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 80/149 (53%), Gaps = 9/149 (6%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN--SLHRKLSGGFSLFGQQTPQMNG 128
            + D+ ALNVGD+LTV+++    A  + +T  +++N  +L      G   FG  T   N 
Sbjct: 70  FYGDTVALNVGDVLTVNLQESTSASKNAETSITKDNETTLPNPTILGKDNFGINT-SFNH 128

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
             ++ G   +    S++ +      I   VT +L NG L I G + + + +    + +TG
Sbjct: 129 ERDFQGAAEADQSNSLAGS------ITVTVTEVLPNGVLRIRGEKWLSLTNGDEYIRLTG 182

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +VRPQD+   N+V+ ++IA+AR +YGG G
Sbjct: 183 LVRPQDIQPDNTVASNRIADARFAYGGTG 211


>gi|282599764|ref|ZP_05971783.2| flagellar L-ring protein FlgH [Providencia rustigianii DSM 4541]
 gi|282567731|gb|EFB73266.1| flagellar L-ring protein FlgH [Providencia rustigianii DSM 4541]
          Length = 254

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 81/178 (45%), Gaps = 16/178 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM- 126
           +  LF+D R  NVGDILT++++ +  A        S+N+S +   SG         P   
Sbjct: 84  YQPLFEDRRPRNVGDILTINLQENVSA--------SKNSSANANRSGKTGFLAAILPGFM 135

Query: 127 -------NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                  N  ++  G    +GKG  +        I   V  +L NGNL + G + + +N 
Sbjct: 136 QGWLGGSNTEIDVKGNSDFTGKGGANANNTFKGTITVTVDQLLANGNLHVVGEKRIAINQ 195

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              S+  +G+V P+ + A N+VS  ++A+ARI Y G G   E        +   N+SP
Sbjct: 196 GTESIRFSGVVNPRTIGADNNVSSTQVADARIEYVGDGYINESQTMGWLQRFFLNVSP 253


>gi|332558505|ref|ZP_08412827.1| FlgH [Rhodobacter sphaeroides WS8N]
 gi|332276217|gb|EGJ21532.1| FlgH [Rhodobacter sphaeroides WS8N]
          Length = 222

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 86/175 (49%), Gaps = 11/175 (6%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ--TGRSRNNSLHRKLSGGFSLFGQQTP 124
           S      D RA  VGDI+TVD        FD +    +S++ S  RK      L    T 
Sbjct: 56  SRGLFVSDRRAARVGDIVTVD--------FDEKFSASKSQSASGSRKSDYAIDLPDALTL 107

Query: 125 QMN-GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
            ++ G L+       SGKG+ S++  L   ++  VT +L  GNL I G + + +N+    
Sbjct: 108 GLDDGVLDNSTDQGFSGKGAASQSNSLRGRMSVSVTRVLPGGNLEIMGQKLLTLNNGNEY 167

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           + + G+VRP+D+   N V+ D+IA A I Y G G T +  +P    + +  +SPL
Sbjct: 168 VRLKGVVRPEDIGPDNVVTSDRIAHAEIKYIGAGDTADTAKPGWLRRGLSVVSPL 222


>gi|221639492|ref|YP_002525754.1| Flagellar L-ring protein [Rhodobacter sphaeroides KD131]
 gi|221160273|gb|ACM01253.1| Flagellar L-ring protein precursor [Rhodobacter sphaeroides KD131]
          Length = 218

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 86/175 (49%), Gaps = 11/175 (6%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ--TGRSRNNSLHRKLSGGFSLFGQQTP 124
           S      D RA  VGDI+TVD        FD +    +S++ S  RK      L    T 
Sbjct: 52  SRGLFVSDRRAARVGDIVTVD--------FDEKFSASKSQSASGSRKSDYAIDLPDALTL 103

Query: 125 QMN-GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
            ++ G L+       SGKG+ S++  L   ++  VT +L  GNL I G + + +N+    
Sbjct: 104 GLDDGVLDNSTDQGFSGKGAASQSNSLRGRMSVSVTRVLPGGNLEIMGQKLLTLNNGNEY 163

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           + + G+VRP+D+   N V+ D+IA A I Y G G T +  +P    + +  +SPL
Sbjct: 164 VRLKGVVRPEDIGPDNVVTSDRIAHAEIKYIGAGDTADTAKPGWLRRGLSVVSPL 218


>gi|126462481|ref|YP_001043595.1| flagellar L-ring protein [Rhodobacter sphaeroides ATCC 17029]
 gi|126104145|gb|ABN76823.1| flagellar L-ring protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 222

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 86/175 (49%), Gaps = 11/175 (6%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ--TGRSRNNSLHRKLSGGFSLFGQQTP 124
           S      D RA  VGDI+TVD        FD +    +S++ S  RK      L    T 
Sbjct: 56  SRGLFVSDRRAARVGDIVTVD--------FDEKFSASKSQSASGSRKSDYAIDLPDALTL 107

Query: 125 QMN-GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
            ++ G L+       SGKG+ S++  L   ++  VT +L  GNL I G + + +N+    
Sbjct: 108 GLDDGVLDNSTDQGFSGKGAASQSNSLRGRMSVSVTRVLPGGNLEIMGQKLLTLNNGNEY 167

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           + + G+VRP+D+   N V+ D+IA A I Y G G T +  +P    + +  +SPL
Sbjct: 168 VRLKGVVRPEDIGPDNVVTSDRIAHAEIKYIGAGDTADTAKPGWLRRGLSVVSPL 222


>gi|289208117|ref|YP_003460183.1| flagellar L-ring protein [Thioalkalivibrio sp. K90mix]
 gi|288943748|gb|ADC71447.1| flagellar L-ring protein [Thioalkalivibrio sp. K90mix]
          Length = 232

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 77/160 (48%), Gaps = 26/160 (16%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSL-------------HRKLSGGFS 117
           LF+D +A  VGDILTV +    QA     T   +++SL             HR    G  
Sbjct: 64  LFEDYKARQVGDILTVILAESTQAQKSASTSTQKDSSLDLGNLQAFGGEATHR----GRP 119

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           LFG          ++DG G SS      ++ +L+  I   V  +L NGNL++ G + + +
Sbjct: 120 LFGASNTSTR---DFDGSGDSS------QSNQLDGEITVTVAEVLPNGNLVVQGEKWLGI 170

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           N     +   GIVRP DV  +N+V   ++A AR+ YGG G
Sbjct: 171 NQGEEYVRFRGIVRPVDVTTNNTVLSTQVANARVYYGGTG 210


>gi|163856438|ref|YP_001630736.1| flagellar basal body L-ring protein [Bordetella petrii DSM 12804]
 gi|163260166|emb|CAP42468.1| flagellar basal-body L-ring protein FlgH [Bordetella petrii]
          Length = 227

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 79/159 (49%), Gaps = 15/159 (9%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP-----Q 125
           LF+D R  NVGDI+T+        V + +T  ++N + +   SG   L    TP      
Sbjct: 61  LFEDRRPRNVGDIVTI--------VLNERTNAAKNVATNTDRSGNVGLGIAATPGFMDSW 112

Query: 126 MNGNLNYDGGGA--SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
            N  LN D  G+  +SGKG  S        I   V  +L NGNL ++G +++ +N     
Sbjct: 113 ANAKLNTDASGSNKASGKGDSSANNTFTGTITTTVIGVLPNGNLQVAGEKQIAINRGSEY 172

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
           +  +G+V P+ +   NSVS  ++A+ARI Y  KG   E+
Sbjct: 173 VRFSGVVDPRSITGANSVSSTQVADARIEYRSKGVMDEV 211


>gi|77463649|ref|YP_353153.1| flagellar L-ring protein [Rhodobacter sphaeroides 2.4.1]
 gi|77388067|gb|ABA79252.1| Flagellar L-ring protein [Rhodobacter sphaeroides 2.4.1]
          Length = 222

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 86/175 (49%), Gaps = 11/175 (6%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ--TGRSRNNSLHRKLSGGFSLFGQQTP 124
           S      D RA  VGDI+TVD        FD +    +S++ S  RK      L    T 
Sbjct: 56  SRGLFVSDRRAARVGDIVTVD--------FDEKFSASKSQSASGSRKSDYAIDLPDALTL 107

Query: 125 QMN-GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
            ++ G L+       SGKG+ S++  L   ++  VT +L  GNL I G + + +N+    
Sbjct: 108 GLDDGVLDNSTDQGFSGKGAASQSNSLRGRMSVSVTRVLPGGNLEIMGQKLLTLNNGNEY 167

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           + + G+VRP+D+   N V+ D+IA A I Y G G T +  +P    + +  +SPL
Sbjct: 168 VRLKGVVRPEDIGPDNVVTSDRIAHAEIKYIGAGDTADTAKPGWLRRGLSVVSPL 222


>gi|149908756|ref|ZP_01897417.1| flagellar L-ring protein precursor [Moritella sp. PE36]
 gi|149808298|gb|EDM68237.1| flagellar L-ring protein precursor [Moritella sp. PE36]
          Length = 229

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 78/152 (51%), Gaps = 7/152 (4%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF-GQQTPQMNGN 129
           +F+D RA  VGDILTV +    Q+     +G  +N+      +   S F    +  +  +
Sbjct: 66  MFQDRRAYKVGDILTVILEEQTQSSKRANSGIKKNSKGGGNYTSNLSSFDATGSFSLGSD 125

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
            +++GGG SS + ++S A      I   V  IL  G L I G + +++N     + +TG+
Sbjct: 126 RSFNGGGTSSQQNALSGA------ITVTVAEILPTGALRIRGEKWIKLNQGDEYIRLTGL 179

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           VR  D+D  N +S  ++A+A I+Y G+G   E
Sbjct: 180 VRVDDIDKSNRISSRRLADANITYAGRGELAE 211


>gi|149375031|ref|ZP_01892804.1| Flagellar basal body L-ring protein [Marinobacter algicola DG893]
 gi|149360920|gb|EDM49371.1| Flagellar basal body L-ring protein [Marinobacter algicola DG893]
          Length = 235

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 106/215 (49%), Gaps = 20/215 (9%)

Query: 5   SFIVLCYSSLLFGC--HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYS 62
           +F ++    +L GC   S    I   PQ +P+ +      R P  G  +++S    ++YS
Sbjct: 17  TFALVAILVVLQGCTAMSRPRAIPDDPQYAPVRAEA-MMQRDPESGAIYQSS----RNYS 71

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
           L        + D+ ALNVGDILTV +    +A  + ++  +++N +   L       G  
Sbjct: 72  L--------YGDTVALNVGDILTVTLEESTRASKNAESSITKDNEVS-MLDPQILGKGNI 122

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
               + NL  D      G+    ++  LN  I   VT +L NG L I G + + + +   
Sbjct: 123 GLATDFNLERD----FEGQAEADQSNSLNGNITVTVTEVLPNGVLHIRGEKWLSLTNGDE 178

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + +TG+VRP+D+   N+V+ ++IA+ARI+YGG G
Sbjct: 179 YIRLTGLVRPEDISPDNTVASNRIADARIAYGGTG 213


>gi|116626488|ref|YP_828644.1| flagellar L-ring protein [Candidatus Solibacter usitatus Ellin6076]
 gi|116229650|gb|ABJ88359.1| flagellar L-ring protein [Candidatus Solibacter usitatus Ellin6076]
          Length = 228

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 86/167 (51%), Gaps = 2/167 (1%)

Query: 73  KDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNY 132
           +D +A  V D++TV +  +  AV    T  +R +S    +S    +     P  N     
Sbjct: 63  RDLKASQVDDVITVLVVENASAVAKGTTKTARTSSTRNSVSALAGITKAAGPWAN-LAGV 121

Query: 133 DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP 192
           +G    +G+G+ +R   ++  + A V+ +L NG +++  ++EV VN E + + V GIVRP
Sbjct: 122 NGDTQLAGEGATTRDVVISTTLTARVSGVLPNGAMLVEATKEVEVNSEHQVITVRGIVRP 181

Query: 193 QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPP-IGHQLIENLSPL 238
            DV + N+V  D++ +  +   GKG   + +R P I ++++  L P 
Sbjct: 182 ADVASDNTVRSDRLGQLEVRVNGKGVVGDAIRRPFILYRILLGLLPF 228


>gi|319787118|ref|YP_004146593.1| flagellar L-ring protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317465630|gb|ADV27362.1| flagellar L-ring protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 229

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 82/161 (50%), Gaps = 18/161 (11%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ------- 122
           +L+ D  A +VGD+LT+++     A     T  S+++ L    +G  SLFG         
Sbjct: 60  SLYGDRIARDVGDLLTINLVESTTAQTSATTQVSKDSELS---TGVTSLFGGPVTYKGRD 116

Query: 123 --TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
             +   NG  ++DG G SS      ++ +L   +   V   L NGNL++ G + +R+N  
Sbjct: 117 ILSASANGERDFDGQGKSS------QSNRLQGSVTVSVIQRLPNGNLVVQGQKNLRLNQG 170

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
              + + GIVRPQD+   N+V   ++ EARI YGG+G   +
Sbjct: 171 DELVQIQGIVRPQDISRDNTVPSSRVGEARIVYGGRGAIAQ 211


>gi|300899453|ref|ZP_07117702.1| flagellar L-ring protein FlgH [Escherichia coli MS 198-1]
 gi|300356959|gb|EFJ72829.1| flagellar L-ring protein FlgH [Escherichia coli MS 198-1]
          Length = 253

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 80/152 (52%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   +NN++     G  ++FG    +++G 
Sbjct: 89  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKNNTVD---IGAPTIFGHTKDKLSGS 145

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 146 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 199

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 200 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 231


>gi|254516992|ref|ZP_05129050.1| flagellar L-ring protein FlgH [gamma proteobacterium NOR5-3]
 gi|219674497|gb|EED30865.1| flagellar L-ring protein FlgH [gamma proteobacterium NOR5-3]
          Length = 231

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 78/151 (51%), Gaps = 7/151 (4%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LF+D RA  +GDI++V +     A     T  S++ S+        ++ G      NG  
Sbjct: 62  LFEDVRAHEIGDIVSVVLVESTSATKSADTDVSKDGSVSIVEP---TILGAPVTINNGRY 118

Query: 131 NY----DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           +         A   +GS +++ +LN  IA  V+ +L NGNL I G + +++N     + +
Sbjct: 119 SLGTELSSSSAFESEGSSNQSNRLNGSIAVQVSKVLPNGNLEIQGEKWIKINQGDEYIRL 178

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            GIVRP+D+   N++    +A+ARISYGG G
Sbjct: 179 RGIVRPEDLSPTNTIPSTLVADARISYGGTG 209


>gi|127512282|ref|YP_001093479.1| flagellar basal body L-ring protein [Shewanella loihica PV-4]
 gi|126637577|gb|ABO23220.1| flagellar L-ring protein [Shewanella loihica PV-4]
          Length = 234

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 88/159 (55%), Gaps = 6/159 (3%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQA--VFDNQTGRSRNNSLHRKLSGGFSL 118
           S+++DS A+ L+ D +AL VGDI+TV ++   +A    +N+  +  + +L    +GG ++
Sbjct: 57  SMYQDSQASSLYSDIKALKVGDIITVILQESTKAKKSANNELKKGSDLTLDPIYAGGGNV 116

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
               +P    +L Y     +  +    ++  L+  I+A V  +L NGNL+I G + + +N
Sbjct: 117 TISGSPI---DLRYKDSMNTKRESDADQSNSLSGSISANVMQVLNNGNLVIRGEKWITIN 173

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +    + +TGIVR QD+   N++   ++A ARI Y G G
Sbjct: 174 NGDEFVRLTGIVRSQDIRPDNTIDSQRVANARIQYSGTG 212


>gi|300722679|ref|YP_003711969.1| flagellar basal-body outer-membrane L ring protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629186|emb|CBJ89782.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Xenorhabdus
           nematophila ATCC 19061]
          Length = 263

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 78/179 (43%), Gaps = 16/179 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM- 126
           +  LF+D R  N+GD LT+        +       S+N+S +   SG        TP+  
Sbjct: 93  YQPLFEDRRPRNIGDTLTI--------ILQENVSASKNSSANASRSGKTGFAAALTPRFL 144

Query: 127 -------NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                    +L  +G     GKG  +        I   V  +L NGNL + G +++ +N 
Sbjct: 145 QGLIGSDKTDLGMEGNNEFGGKGGANANNTFKGTITVTVDTLLANGNLHVVGEKQIAINQ 204

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               +  +G+V P+ +  +N+VS +++A+ARI Y G G   E        +   N+SP 
Sbjct: 205 GTEFIRFSGVVNPRTITGNNTVSSNQVADARIEYVGDGYINEAQHMGWLQRFFMNISPF 263


>gi|304438317|ref|ZP_07398258.1| flagellar L-ring protein FlgH [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304368683|gb|EFM22367.1| flagellar L-ring protein FlgH [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 199

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 84/170 (49%), Gaps = 21/170 (12%)

Query: 57  TKKSYSLWRDSHA----ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR-- 110
           T  + SLW++++     ++F D RA NVGDI+T+ I           T  +RN+S  +  
Sbjct: 23  TAAAESLWKNANGYTTKSVFTDHRASNVGDIVTIVISES------TTTSATRNSSNEKSG 76

Query: 111 --KLSGGFSLFG-QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
             KL GG  +F   Q    +G+  +      + KGS S   ++   +   ++ I   GN 
Sbjct: 77  SVKLGGGIGIFDFLQAASASGSDKF------TAKGSASATNRVAGNVTVTISEITPAGNF 130

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++ G+Q +  N     +   GI RP+D+ A N+V   ++A+A + + GKG
Sbjct: 131 VLEGTQSIWQNRNEHKITFRGICRPEDISASNTVLSTRVADATVRFDGKG 180


>gi|268589979|ref|ZP_06124200.1| flagellar L-ring protein FlgH [Providencia rettgeri DSM 1131]
 gi|291314697|gb|EFE55150.1| flagellar L-ring protein FlgH [Providencia rettgeri DSM 1131]
          Length = 260

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 80/178 (44%), Gaps = 16/178 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM- 126
           +  LF+D R  NVGDILT++++ +  A        S+N+S +   SG         P   
Sbjct: 90  YQPLFEDRRPRNVGDILTINLQENVSA--------SKNSSANANRSGKTGFLAAILPGFM 141

Query: 127 -------NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                  N  L+  G    SGKG  +        I   V  +L NGNL + G + + +N 
Sbjct: 142 QGWIGGKNTELDIKGNSDFSGKGGANANNTFKGTITVTVDQLLANGNLHVVGEKRIAINQ 201

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              S+  +G+V P+ + + N VS  ++A+ARI Y G G   E        +   N+SP
Sbjct: 202 GTESIRFSGVVNPRTIGSDNHVSSTQVADARIEYVGDGYINESQNMGWLQRFFLNVSP 259


>gi|149191156|ref|ZP_01869414.1| flagellar L-ring protein precursor [Vibrio shilonii AK1]
 gi|148834994|gb|EDL51973.1| flagellar L-ring protein precursor [Vibrio shilonii AK1]
          Length = 247

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 80/149 (53%), Gaps = 9/149 (6%)

Query: 71  LFKDSRALNVGDILTV--DIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           LF+D RA  VGDILTV  D + +       Q G+  + ++    + G + + + +  ++ 
Sbjct: 84  LFQDRRAYRVGDILTVMLDEKTESDKSASTQYGKDSSATIAAP-TLGTTTYAEGSAAIDA 142

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
             ++DG  AS+   S+S +      I   V  +L NG L + G + +++N     + +TG
Sbjct: 143 TRDFDGAAASTQGNSLSGS------ITVTVYDVLPNGVLRVRGEKWLKLNQGDEYIRLTG 196

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            VR  D+ A N++S  +IA+ARI+Y G+G
Sbjct: 197 NVRVDDIQADNTLSSQRIADARITYAGRG 225


>gi|323171067|gb|EFZ56716.1| flagellar L-ring family protein [Escherichia coli LT-68]
          Length = 221

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 79/152 (51%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++FG    +++G 
Sbjct: 57  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPTIFGHTKDKLSGS 113

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R       I   V A+  NG L I G + + +N     + 
Sbjct: 114 IDANRDFDGSATSQQQNSLRRE------ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 167

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 168 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 199


>gi|254459364|ref|ZP_05072785.1| flagellar L-ring protein FlgH [Campylobacterales bacterium GD 1]
 gi|207083977|gb|EDZ61268.1| flagellar L-ring protein FlgH [Campylobacterales bacterium GD 1]
          Length = 240

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 115/247 (46%), Gaps = 33/247 (13%)

Query: 9   LCYSSLLF--GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSY----S 62
           + + ++LF  GC ++++E               E N  P   ++   S   K+ Y    S
Sbjct: 10  MSFYAILFLSGCTANLTE--------------PEINFEPPAYVEQMPSKEDKQDYTSIGS 55

Query: 63  LWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
           ++      LF D +A++V DI  V + I + A   +   +  + +    L GG       
Sbjct: 56  IFGQGDNPLFSDHKAMHVNDI--VRVVISENAQSSSTAAKDLSEADTSALGGGTFAATGG 113

Query: 123 TP-------QMNG--NLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
            P       ++NG  N+ + G   S+  G GS ++       ++A +  +++NGN  ISG
Sbjct: 114 NPAVSSYANKLNGLSNIGFTGTSTSTYQGAGSATKDASFTTTVSARIVKVMQNGNYFISG 173

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            +E+ V+++ + + ++G++RP D+D +N +   +++EA+I Y  +G      +   G ++
Sbjct: 174 KREILVDEQKQIIQISGVIRPYDIDQYNKIDSAQMSEAKILYQTQGDVDRATKQGWGTKI 233

Query: 232 IENLSPL 238
           I+   P 
Sbjct: 234 IQAAWPF 240


>gi|22127324|ref|NP_670747.1| flagellar basal body L-ring protein [Yersinia pestis KIM 10]
 gi|45442799|ref|NP_994338.1| flagellar basal body L-ring protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108809052|ref|YP_652968.1| flagellar basal body L-ring protein [Yersinia pestis Antiqua]
 gi|108810751|ref|YP_646518.1| flagellar basal body L-ring protein [Yersinia pestis Nepal516]
 gi|145597820|ref|YP_001161896.1| flagellar basal body L-ring protein [Yersinia pestis Pestoides F]
 gi|150260246|ref|ZP_01916974.1| lateral flagellar basal body L-ring protein [Yersinia pestis
           CA88-4125]
 gi|162420326|ref|YP_001604844.1| flagellar basal body L-ring protein [Yersinia pestis Angola]
 gi|165924849|ref|ZP_02220681.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165939042|ref|ZP_02227594.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166008703|ref|ZP_02229601.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212115|ref|ZP_02238150.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399084|ref|ZP_02304608.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167418950|ref|ZP_02310703.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425067|ref|ZP_02316820.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167466334|ref|ZP_02331038.1| flagellar L-ring protein FlgH [Yersinia pestis FV-1]
 gi|218927915|ref|YP_002345790.1| flagellar basal body L-ring protein [Yersinia pestis CO92]
 gi|229837411|ref|ZP_04457574.1| Flagellar L-ring protein flgH [Yersinia pestis Pestoides A]
 gi|229840626|ref|ZP_04460785.1| Flagellar L-ring protein flgH [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229842823|ref|ZP_04462975.1| Flagellar L-ring protein flgH [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229900948|ref|ZP_04516072.1| Flagellar L-ring protein flgH [Yersinia pestis Nepal516]
 gi|270487669|ref|ZP_06204743.1| flagellar L-ring protein FlgH [Yersinia pestis KIM D27]
 gi|294502792|ref|YP_003566854.1| flagellar L-ring protein precursor [Yersinia pestis Z176003]
 gi|81594556|sp|Q8ZHZ5|FLGH1_YERPE RecName: Full=Flagellar L-ring protein 1; AltName: Full=Basal body
           L-ring protein 1; Flags: Precursor
 gi|226701939|sp|A9R6X4|FLGH_YERPG RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|21960405|gb|AAM86998.1|AE013948_6 putative flagellar l-ring protein [Yersinia pestis KIM 10]
 gi|45437665|gb|AAS63215.1| putative flagellar L-ring protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|108774399|gb|ABG16918.1| flagellar L-ring protein [Yersinia pestis Nepal516]
 gi|108780965|gb|ABG15023.1| putative flagellar L-ring protein [Yersinia pestis Antiqua]
 gi|115346526|emb|CAL19403.1| putative flagellar L-ring protein [Yersinia pestis CO92]
 gi|145209516|gb|ABP38923.1| flagellar L-ring protein [Yersinia pestis Pestoides F]
 gi|149289654|gb|EDM39731.1| lateral flagellar basal body L-ring protein [Yersinia pestis
           CA88-4125]
 gi|162353141|gb|ABX87089.1| flagellar L-ring protein FlgH [Yersinia pestis Angola]
 gi|165912998|gb|EDR31623.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165923049|gb|EDR40200.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165992042|gb|EDR44343.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206861|gb|EDR51341.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962944|gb|EDR58965.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167051588|gb|EDR62996.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055830|gb|EDR65611.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229682287|gb|EEO78379.1| Flagellar L-ring protein flgH [Yersinia pestis Nepal516]
 gi|229690090|gb|EEO82147.1| Flagellar L-ring protein flgH [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229696992|gb|EEO87039.1| Flagellar L-ring protein flgH [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229705534|gb|EEO91544.1| Flagellar L-ring protein flgH [Yersinia pestis Pestoides A]
 gi|262360824|gb|ACY57545.1| flagellar L-ring protein precursor [Yersinia pestis D106004]
 gi|262364769|gb|ACY61326.1| flagellar L-ring protein precursor [Yersinia pestis D182038]
 gi|270336173|gb|EFA46950.1| flagellar L-ring protein FlgH [Yersinia pestis KIM D27]
 gi|294353251|gb|ADE63592.1| flagellar L-ring protein precursor [Yersinia pestis Z176003]
 gi|320016708|gb|ADW00280.1| Flagellar L-ring protein flgH [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 221

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (50%), Gaps = 19/155 (12%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
           +L +D RA  +GDILTV        + D  T  S+    +       SL     P++ G 
Sbjct: 57  SLLQDRRAYRIGDILTV--------ILDESTQSSKQAKTNFGKKNDMSL---GVPEVLGK 105

Query: 130 LNYDGGGASSGK----GSISRAEKLNLLIAAIVTAI---LENGNLIISGSQEVRVNDEIR 182
                GG+ SGK    GS + A++ N+L  +I  A+   L NG L+I G + + +N    
Sbjct: 106 KLNKFGGSISGKRDFDGSATSAQQ-NMLRGSITVAVHQVLPNGVLVIRGEKWLTLNQGDE 164

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + VTG+VR  DV   NSVS  +IA ARISY G+G
Sbjct: 165 YMRVTGLVRADDVARDNSVSSQRIANARISYAGRG 199


>gi|146277705|ref|YP_001167864.1| flagellar L-ring protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145555946|gb|ABP70559.1| flagellar L-ring protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 222

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 81/168 (48%), Gaps = 5/168 (2%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
              D RA  VGDI+T+D      A        SR+N     L    +L        +G L
Sbjct: 60  FVSDRRAARVGDIVTIDFAEKFSASKSQTATGSRSNDYALDLPDALTLGLD-----DGAL 114

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
           +     + +G+G+ S++  L   ++  VT +L  GNL I G + + +N+    + + G+V
Sbjct: 115 DNSTSQSFAGRGAASQSNSLRGRMSVSVTRVLPGGNLEIMGQKLLTLNNGNEYVRLKGVV 174

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           RP+D+   N VS D+IA A I Y G G T +  +P    + +  +SPL
Sbjct: 175 RPEDIGPDNVVSSDRIAHAEIKYVGAGDTADTAKPGWLRRGLSVVSPL 222


>gi|317010605|gb|ADU84352.1| flagellar basal body L-ring protein [Helicobacter pylori
           SouthAfrica7]
          Length = 237

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              ++  + ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 EKKKKEAEYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|260768779|ref|ZP_05877713.1| flagellar L-ring protein FlgH [Vibrio furnissii CIP 102972]
 gi|260616809|gb|EEX41994.1| flagellar L-ring protein FlgH [Vibrio furnissii CIP 102972]
          Length = 219

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 80/149 (53%), Gaps = 9/149 (6%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           LF+D RA  VGDILTV +  + +       + G++ N SL+   + G  +F   +   +G
Sbjct: 56  LFQDRRAYRVGDILTVLLNEKTESDKSATTKYGKNSNASLNVP-TLGTHVFDNLSASASG 114

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           N ++ G  AS    S+S +      I   V  +L NG L + G + +++N     + +TG
Sbjct: 115 NRDFAGSAASKQGNSLSGS------ITVTVYQVLPNGVLRVRGEKWLKLNQGDEFIRLTG 168

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            VR  D+ A N++S  +IA+ARI+Y G+G
Sbjct: 169 NVRASDISADNTLSSQRIADARITYAGRG 197


>gi|51597634|ref|YP_071825.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis IP
           32953]
 gi|153949468|ref|YP_001399637.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis IP
           31758]
 gi|81638506|sp|Q666C4|FLGH2_YERPS RecName: Full=Flagellar L-ring protein 2; AltName: Full=Basal body
           L-ring protein 2; Flags: Precursor
 gi|51590916|emb|CAH22572.1| putative flagellar L-ring protein [Yersinia pseudotuberculosis IP
           32953]
 gi|152960963|gb|ABS48424.1| flagellar L-ring protein FlgH [Yersinia pseudotuberculosis IP
           31758]
          Length = 221

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (50%), Gaps = 19/155 (12%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
           +L +D RA  +GDILTV        + D  T  S+    +       SL     P++ G 
Sbjct: 57  SLLQDRRAYRIGDILTV--------ILDESTQSSKQAKTNFGKKNDMSL---GVPEVLGK 105

Query: 130 LNYDGGGASSGK----GSISRAEKLNLLIAAIVTAI---LENGNLIISGSQEVRVNDEIR 182
                GG+ SGK    GS + A++ N+L  +I  A+   L NG L+I G + + +N    
Sbjct: 106 KLNKFGGSISGKRDFDGSATSAQQ-NMLRGSITVAVHQVLPNGVLVIRGEKWLTLNQGDE 164

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + VTG+VR  DV   NSVS  +IA ARISY G+G
Sbjct: 165 YMRVTGLVRADDVARDNSVSSQRIANARISYAGRG 199


>gi|15606795|ref|NP_214175.1| flagellar L-ring protein FlgH [Aquifex aeolicus VF5]
 gi|6225345|sp|O67609|FLGH_AQUAE RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|2984027|gb|AAC07570.1| flagellar L-ring protein FlgH [Aquifex aeolicus VF5]
          Length = 216

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 78/159 (49%), Gaps = 7/159 (4%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL++   +A L+   RA  VGD++ + +     A+    T   R+ S    +S   S FG
Sbjct: 41  SLFKSPQSAYLYGSVRASEVGDVIYIRVIESINAIESVSTNVGRSTSFSNAIS---SFFG 97

Query: 121 QQTPQMNGNLNYDGGG--ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
              P    NL   G    AS G     ++  L   +A  V  +  NG +++   + + VN
Sbjct: 98  VH-PATLKNLGAGGKSSFASKGGSKFQQSGVLTTTLAGRVVKVFPNGTMLVEAKKYIEVN 156

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
              R   + GIVRP+D+D++N+V+ DKIA+  I + G+G
Sbjct: 157 GVKREFLLRGIVRPEDIDSNNTVTSDKIADMEIFFEGRG 195


>gi|15611377|ref|NP_223028.1| flagellar basal body L-ring protein [Helicobacter pylori J99]
 gi|14548056|sp|Q9ZMB3|FLGH_HELPJ RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|4154828|gb|AAD05882.1| FLAGELLAR L-RING PROTEIN PRECURSOR (BASAL BODY L-RING PROTEIN)
           [Helicobacter pylori J99]
          Length = 237

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIVVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              ++  + ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKKEAEYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|212709495|ref|ZP_03317623.1| hypothetical protein PROVALCAL_00537 [Providencia alcalifaciens DSM
           30120]
 gi|212687833|gb|EEB47361.1| hypothetical protein PROVALCAL_00537 [Providencia alcalifaciens DSM
           30120]
          Length = 245

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 76/162 (46%), Gaps = 16/162 (9%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM- 126
           +  LF+D R  NVGDILT++++ +  A        S+N+S +   SG         P   
Sbjct: 75  YQPLFEDRRPRNVGDILTINLQENVSA--------SKNSSANANRSGKTGFLAAILPGFM 126

Query: 127 -------NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                  N  ++  G    +GKG  +        I   V  +L NGNL + G + + +N 
Sbjct: 127 QGWLGGSNTEIDVKGNSDFNGKGGANANNTFKGTITVTVDQLLANGNLHVVGEKRIAINQ 186

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
              S+  +G+V P+ + A N+VS  ++A+ARI Y G G   E
Sbjct: 187 GTESIRFSGVVNPRTIGADNNVSSTQVADARIEYVGDGYINE 228


>gi|317013771|gb|ADU81207.1| flagellar basal body L-ring protein [Helicobacter pylori
           Gambia94/24]
          Length = 237

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              ++  + ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKKEAEYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|315180482|gb|ADT87396.1| flagellar L-ring protein precursor H [Vibrio furnissii NCTC 11218]
          Length = 234

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 80/149 (53%), Gaps = 9/149 (6%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           LF+D RA  VGDILTV +  + +       + G++ N SL+   + G  +F   +   +G
Sbjct: 71  LFQDRRAYRVGDILTVLLNEKTESDKSATTKYGKNSNASLNVP-TLGTHVFDNLSASASG 129

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           N ++ G  AS    S+S +      I   V  +L NG L + G + +++N     + +TG
Sbjct: 130 NRDFAGSAASKQGNSLSGS------ITVTVYQVLPNGVLRVRGEKWLKLNQGDEFIRLTG 183

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            VR  D+ A N++S  +IA+ARI+Y G+G
Sbjct: 184 NVRASDISADNTLSSQRIADARITYAGRG 212


>gi|15644953|ref|NP_207123.1| flagellar basal body L-ring protein [Helicobacter pylori 26695]
 gi|14548024|sp|O25092|FLGH_HELPY RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|2313423|gb|AAD07392.1| flagellar basal-body L-ring protein (flgH) [Helicobacter pylori
           26695]
          Length = 237

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              ++  + ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKKEAEYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|312884831|ref|ZP_07744523.1| flagellar basal body L-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367483|gb|EFP95043.1| flagellar basal body L-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 223

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 84/162 (51%), Gaps = 10/162 (6%)

Query: 59  KSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQT--GRSRNNSLHRKLSGG 115
           K  SL+R +++ ALF+D RA  VGD+LTV +  + ++     T  G+S N        GG
Sbjct: 47  KHGSLYRHNYSMALFQDRRAYRVGDMLTVMLAEETESTKKANTKYGKSSNVGFGIPSLGG 106

Query: 116 FSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
            ++  +    ++    +DG   SS K       KL   I   V  +L NG L ISG + +
Sbjct: 107 NTI-DELEASVDAKRGFDGSATSSQK------NKLEGSITVTVHEVLPNGVLRISGEKWL 159

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           R+N     + +TG+VR  D+  +N V   +I +ARI+Y G+G
Sbjct: 160 RLNQGDEFIRLTGMVRVDDISRNNQVFSSRIGDARITYAGRG 201


>gi|77165835|ref|YP_344360.1| flagellar L-ring protein [Nitrosococcus oceani ATCC 19707]
 gi|110816532|sp|Q3J8L6|FLGH_NITOC RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|76884149|gb|ABA58830.1| Flagellar L-ring protein [Nitrosococcus oceani ATCC 19707]
          Length = 234

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 79/165 (47%), Gaps = 10/165 (6%)

Query: 70  ALFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRK--LSGGFSLFGQQTPQ 125
           +LF D RA  +GD++TV +  R D +   D    R  + SL     L  G          
Sbjct: 55  SLFTDYRARQIGDVITVVLEERTDAEKGSDTAIDRDTSYSLTNPTLLGSGVQFNTPNWLP 114

Query: 126 MNGN------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           +  N      +     GA SG G  S+  +LN  I   V  +L NGNL+I G + V +N 
Sbjct: 115 LASNQDNSLEMAVKAKGAFSGGGDSSQNNRLNGHITVTVAEVLPNGNLVIRGEKVVTINH 174

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
               + ++GIV  +D+   N+VS  K+A+AR++Y G G T E  R
Sbjct: 175 GNEYIKISGIVNRRDIKPDNTVSSLKLADARLAYVGDGATHEANR 219


>gi|186896768|ref|YP_001873880.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|186699794|gb|ACC90423.1| flagellar L-ring protein [Yersinia pseudotuberculosis PB1/+]
          Length = 212

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (50%), Gaps = 19/155 (12%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
           +L +D RA  +GDILTV        + D  T  S+    +       SL     P++ G 
Sbjct: 48  SLLQDRRAYRIGDILTV--------ILDESTQSSKQAKTNFGKKNDMSL---GVPEVLGK 96

Query: 130 LNYDGGGASSGK----GSISRAEKLNLLIAAIVTAI---LENGNLIISGSQEVRVNDEIR 182
                GG+ SGK    GS + A++ N+L  +I  A+   L NG L+I G + + +N    
Sbjct: 97  KLNKFGGSISGKRDFDGSATSAQQ-NMLRGSITVAVHQVLPNGVLVIRGEKWLTLNQGDE 155

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + VTG+VR  DV   NSVS  +IA ARISY G+G
Sbjct: 156 YMRVTGLVRADDVARDNSVSSQRIANARISYAGRG 190


>gi|218703528|ref|YP_002411047.1| flagellar basal body L-ring protein [Escherichia coli UMN026]
 gi|293403358|ref|ZP_06647449.1| flgH [Escherichia coli FVEC1412]
 gi|298378969|ref|ZP_06988850.1| flgH [Escherichia coli FVEC1302]
 gi|59889783|emb|CAH19139.1| Lateral flagellar L-ring protein (FlgH-like) [Escherichia coli]
 gi|218430625|emb|CAR11491.1| Flagellar L-ring protein 2 precursor (Basal body L-ring protein 2)
           (FlgH-like) [Escherichia coli UMN026]
 gi|284920047|emb|CBG33104.1| lateral flagellar L-ring protein (FlgH-like) [Escherichia coli 042]
 gi|291429211|gb|EFF02231.1| flgH [Escherichia coli FVEC1412]
 gi|298280082|gb|EFI21586.1| flgH [Escherichia coli FVEC1302]
          Length = 221

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 80/152 (52%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   +NN++     G  ++FG    +++G 
Sbjct: 57  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKNNTVD---IGAPTIFGHTKDKLSGS 113

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 114 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 167

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 168 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 199


>gi|307637019|gb|ADN79469.1| flagellar L0 ring protein [Helicobacter pylori 908]
 gi|325995612|gb|ADZ51017.1| Flagellar basal body L-ring protein [Helicobacter pylori 2018]
 gi|325997208|gb|ADZ49416.1| Flagellar basal body L-ring protein [Helicobacter pylori 2017]
          Length = 237

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 94/186 (50%), Gaps = 10/186 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF----DNQTGRSRNNSLHRKLSGGFS 117
           SL+      LF D RA+   D++T+ +     A +    D ++    N++  R    G  
Sbjct: 51  SLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPPRLTYNGLD 110

Query: 118 LFGQQTPQ-MNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
              ++  + ++   NY+   +S+     G GS  ++E L ++++A +  +LENGN  I G
Sbjct: 111 ERKKKEAEYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYG 170

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
           ++EV V+ E + L V+G++RP D++ +N++    +A+A+I Y   G  ++  +       
Sbjct: 171 NKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADA 230

Query: 232 IENLSP 237
           +E   P
Sbjct: 231 METQMP 236


>gi|187478188|ref|YP_786212.1| flagellar basal body L-ring protein [Bordetella avium 197N]
 gi|115422774|emb|CAJ49302.1| flagellar L-ring protein [Bordetella avium 197N]
          Length = 229

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 79/159 (49%), Gaps = 15/159 (9%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ----- 125
           LF+D R  NVGDI+TV        + + +T  ++  + +   SGG  L     P+     
Sbjct: 63  LFEDRRPRNVGDIVTV--------MLEEKTNAAKGVATNTSRSGGAKLGVAAAPKFMDGV 114

Query: 126 MNGNLNYD--GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
           +N  L+ D  G   + G G+ S        I   V  +L NGNL I+G +++ +N     
Sbjct: 115 VNNKLDTDITGDNTAKGTGNSSANNSFTGSITTTVVGVLPNGNLQIAGEKQIAINRGSEY 174

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
           + ++G+V P+ +   NSVS  ++A+ARI Y  KG   E+
Sbjct: 175 VRLSGVVDPRSITGTNSVSSTRVADARIEYRSKGVMDEV 213


>gi|254433426|ref|ZP_05046934.1| flagellar L-ring protein FlgH [Nitrosococcus oceani AFC27]
 gi|207089759|gb|EDZ67030.1| flagellar L-ring protein FlgH [Nitrosococcus oceani AFC27]
          Length = 255

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 79/165 (47%), Gaps = 10/165 (6%)

Query: 70  ALFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRK--LSGGFSLFGQQTPQ 125
           +LF D RA  +GD++TV +  R D +   D    R  + SL     L  G          
Sbjct: 76  SLFTDYRARQIGDVITVVLEERTDAEKGSDTAIDRDTSYSLTNPTLLGSGVQFNTPNWLP 135

Query: 126 MNGN------LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           +  N      +     GA SG G  S+  +LN  I   V  +L NGNL+I G + V +N 
Sbjct: 136 LASNQDNSLEMAVKAKGAFSGGGDSSQNNRLNGHITVTVAEVLPNGNLVIRGEKVVTINH 195

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
               + ++GIV  +D+   N+VS  K+A+AR++Y G G T E  R
Sbjct: 196 GNEYIKISGIVNRRDIKPDNTVSSLKLADARLAYVGDGATHEANR 240


>gi|291334317|gb|ADD93978.1| flagellar L ring protein FlgH [uncultured marine bacterium
           MedDCM-OCT-S09-C247]
          Length = 225

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 94/181 (51%), Gaps = 5/181 (2%)

Query: 62  SLWRDSHAALFK-DSRALNVGDILTVDIRIDDQAVFDNQTG--RSRNNSLH-RKLSGGFS 117
           ++++ +  +LF  ++RA  +GDILTV      QA         RS  NSL    +     
Sbjct: 46  TIYQQNKGSLFAMEARAHRIGDILTVSFTESFQATKSQNAASTRSSENSLTLPTVMKKLP 105

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           + G+  P+  G L   G    SG GS +++  L  LI+  V  +  NGNL I G +++ +
Sbjct: 106 VIGKGIPEA-GELASSGESKFSGSGSSNQSNSLTGLISVHVVRVFTNGNLEILGQKKLTL 164

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N+    + V+GIVRP+D+ + N V  D+IA A I+Y G G T    R     +++E ++P
Sbjct: 165 NNGDEYIRVSGIVRPRDISSDNIVQSDRIANADINYIGAGDTARSGRKGWYTKMLETITP 224

Query: 238 L 238
           L
Sbjct: 225 L 225


>gi|238927615|ref|ZP_04659375.1| flagellar L-ring protein [Selenomonas flueggei ATCC 43531]
 gi|238884540|gb|EEQ48178.1| flagellar L-ring protein [Selenomonas flueggei ATCC 43531]
          Length = 213

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 82/166 (49%), Gaps = 13/166 (7%)

Query: 57  TKKSYSLWRDSHA----ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
           T  + SLW++++     A+F D RA  VGDI+T+ I           +   ++ S+  KL
Sbjct: 37  TAAAESLWKNTNGYATKAVFADHRASGVGDIVTIVISESTTTSATRNSANEKSGSV--KL 94

Query: 113 SGGFSLFG-QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
            GG  +F   Q    +G+  +      + KGS S   ++   +   ++ I  +GN ++ G
Sbjct: 95  GGGIGIFDFLQAASASGSDKF------TAKGSASATNRVAGNVTVTISEITPSGNFVLEG 148

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +Q +  N     +   GI RP+D+ A N+V   ++A+A + + GKG
Sbjct: 149 TQSIWQNRNEHKITFRGICRPEDISASNTVLSTRVADATVRFDGKG 194


>gi|329898286|ref|ZP_08272369.1| Flagellar L-ring protein FlgH [gamma proteobacterium IMCC3088]
 gi|328920851|gb|EGG28294.1| Flagellar L-ring protein FlgH [gamma proteobacterium IMCC3088]
          Length = 226

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 86/179 (48%), Gaps = 10/179 (5%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR---NNSLHRKLSGGFSLFGQQT 123
           S  +LF+  R   VGDI+T+ +    QA  +      R   NN L  +  G   LF  QT
Sbjct: 51  SGLSLFEGQREWYVGDIVTIVLSETTQASRNTNLSTERVSENNVLGTR--GPSELF-PQT 107

Query: 124 PQMNGNLNY---DGGGA-SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             +   L Y   DG    S G GS ++   L  +I A+VT +L NGNL++ G +++ + +
Sbjct: 108 GFIGKALPYLKRDGATVKSEGGGSTAQNASLEGVITAMVTEVLPNGNLVVQGEKQLSMTE 167

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               + V GIVR  D+   NSV   ++A A+I+Y G G      +P     ++    PL
Sbjct: 168 GSEFIQVRGIVRSTDIQMDNSVLSQRLANAQIAYKGTGDLATSTQPGWLTSMLFKFWPL 226


>gi|37525844|ref|NP_929188.1| flagellar basal body L-ring protein [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36785273|emb|CAE14214.1| Flagellar L-ring protein precursor (Basal body L-ring protein)
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|37681980|gb|AAQ97868.1| FlgH [Photorhabdus luminescens]
          Length = 250

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 86/176 (48%), Gaps = 10/176 (5%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN--NSLHRKLSGGFS---LFGQQ 122
           +  LF+D R  N+GD LT+ ++ +  A  ++    SRN  N+    L+  F    + G +
Sbjct: 80  YQPLFEDRRPRNIGDTLTITLQENVSASKNSSANASRNGKNTFSAALTPRFLKGLIGGDK 139

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           T     +L+ +      GKG  +        I   V  +L NGNL + G +++ +N    
Sbjct: 140 T-----DLDMEAENTFGGKGGANANNTFKGTITVTVDRLLANGNLHVVGEKQIAINQGTE 194

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            +  +G+V P+ ++A+N+VS +++A+ARI Y G G   E        +   N++P 
Sbjct: 195 FIRFSGVVNPRTINANNTVSSNQVADARIEYVGNGYINEAQNMGWLQRFFLNVAPF 250


>gi|260886213|ref|ZP_05897476.1| flagellar L-ring protein FlgH [Selenomonas sputigena ATCC 35185]
 gi|330839791|ref|YP_004414371.1| flagellar L-ring protein [Selenomonas sputigena ATCC 35185]
 gi|260863932|gb|EEX78432.1| flagellar L-ring protein FlgH [Selenomonas sputigena ATCC 35185]
 gi|329747555|gb|AEC00912.1| flagellar L-ring protein [Selenomonas sputigena ATCC 35185]
          Length = 201

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 81/180 (45%), Gaps = 15/180 (8%)

Query: 62  SLWRDSHAA----LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           SLW D+       +F D +A NVGD LT  I I ++        R    S   KL+ G  
Sbjct: 30  SLWADATEGTSYGVFADRKAHNVGDTLT--IVISEKTTTTQTKSRKNGKSASTKLNAGAG 87

Query: 118 LFGQQTPQMNGNLNYDGGGASSGK--GSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
           +F   T           GG+ S K  GS   +   +  IA  V  +  NGN+++ G+Q +
Sbjct: 88  IFDFLTAA-------SAGGSDSWKADGSAKDSSNFSGNIAVTVVEVQPNGNMVVEGTQSI 140

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
             N +   + + GIVR  DV   N+V   K+A+A + + GKG      R  I  Q++  L
Sbjct: 141 WQNKDEHKITLRGIVRRDDVTYENTVPSTKVADATVRFDGKGPLNAKQRQGILTQILNIL 200


>gi|330502737|ref|YP_004379606.1| flagellar basal body L-ring protein [Pseudomonas mendocina NK-01]
 gi|328917023|gb|AEB57854.1| flagellar basal body L-ring protein [Pseudomonas mendocina NK-01]
          Length = 228

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 84/163 (51%), Gaps = 11/163 (6%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT----PQM 126
           L+ D +A  +GD++T+ +    QA  +  +   +++S +  ++   SLFG       P  
Sbjct: 55  LYDDRKAFRIGDVITITLNERTQASKNANSNIKKDSSANLGVT---SLFGSTPSATNPLT 111

Query: 127 NGNLN----YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
            GN++    +DG   +SG G   ++  L+  I   V  +L NG L + G + + +N    
Sbjct: 112 GGNMSLGAQFDGQREASGSGQTGQSNSLSGSITVTVAEVLPNGILAVRGEKWMTLNTGDE 171

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            + ++G+VR  D+   N+V+  +IA+ARI+Y G G   +  +P
Sbjct: 172 LVRISGLVRADDIATDNTVASTRIADARITYSGTGAFADASQP 214


>gi|187731524|ref|YP_001880750.1| flagellar basal body L-ring protein [Shigella boydii CDC 3083-94]
 gi|226701933|sp|B2U541|FLGH_SHIB3 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|187428516|gb|ACD07790.1| flagellar L-ring protein FlgH [Shigella boydii CDC 3083-94]
          Length = 232

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSVNASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+VS  ++ +ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVSSTQVVDARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|224584316|ref|YP_002638114.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224468843|gb|ACN46673.1| flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
          Length = 221

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 51  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQG---LFG 107

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M       GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 108 NSRADMEA----SGGNSFNGKGGANASNTFSGTLTVTVVQVLANGNLHVVGEKQIAINQG 163

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 164 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 221


>gi|88911317|sp|Q7N5M7|FLGH_PHOLL RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 229

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 86/176 (48%), Gaps = 10/176 (5%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN--NSLHRKLSGGFS---LFGQQ 122
           +  LF+D R  N+GD LT+ ++ +  A  ++    SRN  N+    L+  F    + G +
Sbjct: 59  YQPLFEDRRPRNIGDTLTITLQENVSASKNSSANASRNGKNTFSAALTPRFLKGLIGGDK 118

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           T     +L+ +      GKG  +        I   V  +L NGNL + G +++ +N    
Sbjct: 119 T-----DLDMEAENTFGGKGGANANNTFKGTITVTVDRLLANGNLHVVGEKQIAINQGTE 173

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            +  +G+V P+ ++A+N+VS +++A+ARI Y G G   E        +   N++P 
Sbjct: 174 FIRFSGVVNPRTINANNTVSSNQVADARIEYVGNGYINEAQNMGWLQRFFLNVAPF 229


>gi|88799024|ref|ZP_01114605.1| Flagellar basal body L-ring protein [Reinekea sp. MED297]
 gi|88778251|gb|EAR09445.1| Flagellar basal body L-ring protein [Reinekea sp. MED297]
          Length = 229

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 83/159 (52%), Gaps = 9/159 (5%)

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTV--DIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           SL+ D++  +L+ D +A  VGDI+TV  D +        + T ++   ++     GG   
Sbjct: 55  SLYADAYGMSLYGDKKARRVGDIITVLLDEQTQGSKSSASNTSKTSEATISAPSVGGIGP 114

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
             Q    + G+ ++      SG+G   ++  L+  I   V+ +L NG L + G + + +N
Sbjct: 115 IDQLGASIQGDRSF------SGRGDADQSNSLSGNITVTVSEVLPNGVLRVRGEKWITLN 168

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +    + + G++RP D++  N+VS  K+A+ARISY G G
Sbjct: 169 NGSEFIRIQGMLRPDDINLDNTVSSQKLADARISYSGAG 207


>gi|325916944|ref|ZP_08179188.1| flagellar basal body L-ring protein [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536847|gb|EGD08599.1| flagellar basal body L-ring protein [Xanthomonas vesicatoria ATCC
           35937]
          Length = 230

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 80/151 (52%), Gaps = 8/151 (5%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN- 129
           L+ D RA +VGD+LTV++     A     T  S+ +++        +L G     +NG  
Sbjct: 62  LYGDRRARDVGDLLTVNLVESTTASSTANTSISKADTVDMSTP---TLLGVPL-TVNGTD 117

Query: 130 --LNYDGGGAS-SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
              N+  G  S +GKG+ +++ ++   +   V   L NGNL+I G + +R+      + V
Sbjct: 118 VLRNFTNGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDELVQV 177

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            GIVR  D+   N+V   K+A+ARI+YGG+G
Sbjct: 178 QGIVRAADIGPDNTVPSSKVADARIAYGGRG 208


>gi|308050369|ref|YP_003913935.1| flagellar L-ring protein [Ferrimonas balearica DSM 9799]
 gi|307632559|gb|ADN76861.1| flagellar L-ring protein [Ferrimonas balearica DSM 9799]
          Length = 228

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 80/160 (50%), Gaps = 8/160 (5%)

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR---KLSGGFS 117
           S++ D +A  L+ D +AL VGD++TV +    +A        +++N +        GG  
Sbjct: 51  SIFNDGYANELYSDIKALKVGDVITVMLSEQTKAKKSASNEITKDNKMQLDPISAGGGPI 110

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
               QT  ++    +D    S    S S A      I+  V  +L NGNL+I G + + +
Sbjct: 111 TVNGQTIDLSYKEKFDMSRESDADQSNSLAGS----ISVNVLQVLANGNLVIRGEKWITI 166

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ND    + +TGIVRP+D+  +N++   ++A ARI Y G G
Sbjct: 167 NDGDEFIRITGIVRPRDISPNNTIESTRVANARIQYSGTG 206


>gi|213026918|ref|ZP_03341365.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
          Length = 187

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 17  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQG---LFG 73

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M       GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 74  NSRADMEA----SGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 129

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 130 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 187


>gi|260597448|ref|YP_003210019.1| flagellar basal body L-ring protein [Cronobacter turicensis z3032]
 gi|260216625|emb|CBA29923.1| Flagellar L-ring protein [Cronobacter turicensis z3032]
          Length = 232

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 86/178 (48%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  NVGD LT++++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNVGDTLTIELQENVSASKSSSANASRDGKTNFGLDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   +++  GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADISASGGNTFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|146305253|ref|YP_001185718.1| flagellar basal body L-ring protein [Pseudomonas mendocina ymp]
 gi|145573454|gb|ABP82986.1| flagellar L-ring protein [Pseudomonas mendocina ymp]
          Length = 220

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 89/180 (49%), Gaps = 24/180 (13%)

Query: 47  LGIDFKNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN 105
           L +D+    +T  S  L+R  ++ +L  D RA+ VGDILTV        V D  T  S++
Sbjct: 34  LALDYSQPPTT--SGGLFRSGYSGSLVGDKRAVRVGDILTV--------VLDESTQSSKS 83

Query: 106 NSLHRKLSGGFSL-----FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLL---IAAI 157
                  S G S+      G+Q  Q+  +   +       KGS +R+ + N L   IA  
Sbjct: 84  AGTSFGKSSGVSVGIPTVLGKQYDQLESSAEAE----RDFKGS-ARSSQQNTLRGSIAVT 138

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NG L+I G + +R+N     + + G+VR  D++  N VS   +A ARISY G+G
Sbjct: 139 VHQVLPNGTLLIKGEKALRLNQGDEYIRLVGLVRVDDINRSNQVSSQNVANARISYAGRG 198


>gi|161503732|ref|YP_001570844.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865079|gb|ABX21702.1| hypothetical protein SARI_01817 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 235

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M  +    GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 122 NSRADMEAS----GGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|156934437|ref|YP_001438353.1| flagellar basal body L-ring protein [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156532691|gb|ABU77517.1| hypothetical protein ESA_02268 [Cronobacter sakazakii ATCC BAA-894]
          Length = 235

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 86/178 (48%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  NVGD LT++++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNVGDTLTIELQENVSASKSSSANASRDGKTSFGLDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   +++  GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 122 N----ARADVSASGGNTFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|62179697|ref|YP_216114.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|200389737|ref|ZP_03216348.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205357317|ref|ZP_02346782.2| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|62127330|gb|AAX65033.1| flagellar biosynthesis, basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|199602182|gb|EDZ00728.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205322411|gb|EDZ10250.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|320086380|emb|CBY96153.1| Flagellar L-ring protein 2 Basal body L-ring protein 2; Flags:
           Precursor [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|322714167|gb|EFZ05738.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323129450|gb|ADX16880.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323252628|gb|EGA36466.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
          Length = 235

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M  +    GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 122 NSRADMEAS----GGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|16760056|ref|NP_455673.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16764536|ref|NP_460151.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29142173|ref|NP_805515.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56413833|ref|YP_150908.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362756|ref|YP_002142393.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|207857312|ref|YP_002243963.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213051797|ref|ZP_03344675.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213582040|ref|ZP_03363866.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213865502|ref|ZP_03387621.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|238911000|ref|ZP_04654837.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|61224052|sp|P0A1N8|FLGH_SALTY RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|61224053|sp|P0A1N9|FLGH_SALTI RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|81360360|sp|Q5PGU6|FLGH_SALPA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|88911319|sp|Q57QH8|FLGH_SALCH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701930|sp|B5QXY5|FLGH_SALEP RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701932|sp|B5BBA9|FLGH_SALPK RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|25373428|pir||AE0640 flagellar L-ring protein precursor [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|153973|gb|AAA27068.1| flgH flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Typhimurium]
 gi|16419697|gb|AAL20110.1| flagellar biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16502350|emb|CAD08304.1| flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137803|gb|AAO69364.1| flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56128090|gb|AAV77596.1| flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197094233|emb|CAR59738.1| flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|206709115|emb|CAR33448.1| flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261246391|emb|CBG24200.1| Basal body L-ring protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992954|gb|ACY87839.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157721|emb|CBW17213.1| Flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912167|dbj|BAJ36141.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|322616550|gb|EFY13459.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620509|gb|EFY17373.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622503|gb|EFY19348.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629654|gb|EFY26429.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632626|gb|EFY29372.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636879|gb|EFY33582.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322641583|gb|EFY38221.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644073|gb|EFY40619.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650027|gb|EFY46445.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653952|gb|EFY50275.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658484|gb|EFY54746.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663342|gb|EFY59544.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322670076|gb|EFY66216.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674860|gb|EFY70951.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676670|gb|EFY72737.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682592|gb|EFY78611.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686655|gb|EFY82634.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323195769|gb|EFZ80945.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198339|gb|EFZ83443.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204839|gb|EFZ89833.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323209180|gb|EFZ94117.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323217860|gb|EGA02575.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222148|gb|EGA06532.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224920|gb|EGA09178.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229662|gb|EGA13785.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323232887|gb|EGA16983.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240622|gb|EGA24664.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242936|gb|EGA26957.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323250253|gb|EGA34142.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323258844|gb|EGA42497.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323261033|gb|EGA44626.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266942|gb|EGA50427.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269983|gb|EGA53432.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326623705|gb|EGE30050.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|332988071|gb|AEF07054.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 232

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M  +    GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 NSRADMEAS----GGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|293395586|ref|ZP_06639869.1| flagellar L-ring protein FlgH [Serratia odorifera DSM 4582]
 gi|291421905|gb|EFE95151.1| flagellar L-ring protein FlgH [Serratia odorifera DSM 4582]
          Length = 219

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 79/177 (44%), Gaps = 14/177 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS-------LHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SRN S         R L G   LFG
Sbjct: 49  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRNGSSKFGVATAPRYLDG---LFG 105

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M       G     GKG  +     N  I   V  +L NGNL + G +++ +N  
Sbjct: 106 NARADME----MSGDNTFGGKGGANANNTFNGTITVTVNQVLANGNLHVVGEKQIAINQG 161

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              +  +G+V P+ +  +NSV+  ++A+ARI Y G G   E        +   NLSP
Sbjct: 162 TEFIRFSGVVNPRTISGNNSVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNLSP 218


>gi|194444848|ref|YP_002040434.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194451511|ref|YP_002045179.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194469566|ref|ZP_03075550.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194734750|ref|YP_002114179.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195874175|ref|ZP_03080178.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197248047|ref|YP_002146863.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197265095|ref|ZP_03165169.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197300930|ref|ZP_03166241.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|198244937|ref|YP_002215957.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|204930741|ref|ZP_03221614.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205358037|ref|ZP_02575136.2| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205358793|ref|ZP_02659164.2| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205359396|ref|ZP_02669711.2| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205360098|ref|ZP_03224515.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205360746|ref|ZP_02686000.2| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|213424683|ref|ZP_03357448.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|194403511|gb|ACF63733.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194409815|gb|ACF70034.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194455930|gb|EDX44769.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194710252|gb|ACF89473.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195630338|gb|EDX48964.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197211750|gb|ACH49147.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197243350|gb|EDY25970.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197289795|gb|EDY29156.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197939453|gb|ACH76786.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|204320200|gb|EDZ05404.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205328053|gb|EDZ14817.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205331927|gb|EDZ18691.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205336407|gb|EDZ23171.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205340986|gb|EDZ27750.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205347398|gb|EDZ34029.1| flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|321223798|gb|EFX48861.1| Flagellar L-ring protein FlgH [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
          Length = 221

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 51  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQG---LFG 107

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M  +    GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 108 NSRADMEAS----GGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 163

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 164 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 221


>gi|224823773|ref|ZP_03696882.1| flagellar L-ring protein [Lutiella nitroferrum 2002]
 gi|224604228|gb|EEG10402.1| flagellar L-ring protein [Lutiella nitroferrum 2002]
          Length = 227

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 80/150 (53%), Gaps = 5/150 (3%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG---GFSLFGQQTPQMN 127
           LF+   A  +GDI+ ++I         + T  SR N+L  K++G   G S+ G      +
Sbjct: 58  LFEQQSARYIGDIVKIEIAESLSGSNKSGTSGSRKNAL--KVAGPGAGSSMTGLLKWIFD 115

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            +++  G  + SGKG  + +  L   +AA V  IL NGNL+++G + +  +    +L  +
Sbjct: 116 IDVDASGSDSFSGKGENTNSNVLKGKLAASVINILPNGNLVVAGEKSIAQHGNSNTLRFS 175

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           G+V P D+ A N VS D +A+AR   GG+G
Sbjct: 176 GVVSPNDIKAGNLVSSDNVADARFELGGRG 205


>gi|205353082|ref|YP_002226883.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|226701931|sp|B5RBC1|FLGH_SALG2 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|205272863|emb|CAR37792.1| Flagellar L-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
          Length = 232

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M  +    GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 NSRADMEAS----GGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYLNEAQNMGWLQRFFLNLSPM 232


>gi|326628162|gb|EGE34505.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 235

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M  +    GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 122 NSRADMEAS----GGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYLNEAQNMGWLQRFFLNLSPM 235


>gi|323495374|ref|ZP_08100451.1| flagellar basal body L-ring protein [Vibrio brasiliensis LMG 20546]
 gi|323310297|gb|EGA63484.1| flagellar basal body L-ring protein [Vibrio brasiliensis LMG 20546]
          Length = 259

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 82/159 (51%), Gaps = 5/159 (3%)

Query: 69  AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           ++L+ DS+   +GDI+TV +    +A   +    S+NN           + GQQ    + 
Sbjct: 93  SSLYDDSKPRGIGDIITVTLDESTKAAKSSDADLSKNNDASMD---PLEVGGQQLNVGDY 149

Query: 129 NLNYD--GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           N +Y+     + SG  + +++  ++  I   V  +L NGNL+I G + + +N     + +
Sbjct: 150 NFSYNLSNDNSFSGSAAANQSNSISGSITVEVIEVLANGNLVIRGEKWLTLNTGDEYIRL 209

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           +G +RP D+D  N+++ ++I+ ARI Y G G   ++  P
Sbjct: 210 SGTIRPDDIDYDNTIASNRISNARIQYSGTGTQQDMQEP 248


>gi|157146223|ref|YP_001453542.1| flagellar basal body L-ring protein [Citrobacter koseri ATCC
           BAA-895]
 gi|157083428|gb|ABV13106.1| hypothetical protein CKO_01980 [Citrobacter koseri ATCC BAA-895]
          Length = 250

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 80  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 136

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M       GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 137 NARADMEA----SGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 192

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 193 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 250


>gi|317492425|ref|ZP_07950854.1| flagellar L-ring protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919764|gb|EFV41094.1| flagellar L-ring protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 250

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 75/170 (44%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  LF+D R  NVGD LT+ ++ +  A   +    SRN     +++              
Sbjct: 80  YQPLFEDRRPRNVGDTLTISLQENVSASKSSSANASRNGKSSFEVATAPRYLEGLLGNAR 139

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            ++N  G     GKG  +     N  I   V  +L NGNL + G +++ +N     +  +
Sbjct: 140 ADMNMSGDNEFGGKGGANANNTFNGTITVTVAEVLANGNLKVVGEKQIAINQGTEFIRFS 199

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP
Sbjct: 200 GVVNPRTISGSNSVVSTQVADARIEYVGSGYINEAQNMGWLQRFFLNLSP 249


>gi|283850809|ref|ZP_06368095.1| flagellar L-ring protein [Desulfovibrio sp. FW1012B]
 gi|283573732|gb|EFC21706.1| flagellar L-ring protein [Desulfovibrio sp. FW1012B]
          Length = 241

 Score = 68.6 bits (166), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 109/254 (42%), Gaps = 40/254 (15%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           F+++     L  C  +  +   +PQ++P  +        P  G  F  +  T        
Sbjct: 7   FLLVLAGCSLAACAPASKKAAPMPQVTPTVAKAPPPAENP--GSVFSQNQPT-------- 56

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
                LF D+RA  +GDILT++I    ++    +T   +N+     + G  S FG +   
Sbjct: 57  ----FLFDDTRARRIGDILTINIVDTSKSDLKAET---KNDKTASNVLGVGSYFGNK--D 107

Query: 126 MNGNLNYDGGGASSG---------------------KGSISRAEKLNLLIAAIVTAILEN 164
           + GNL+   GG + G                     KG   R   +   I   +  IL  
Sbjct: 108 LAGNLSGQLGGPNFGMKGLVGSDPMVSTNTAEKFQSKGETKRESAVTAAIGCRIVNILPG 167

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G + + G+++ RVN+E + + V G+VRP DV   N+V   ++A+ +I Y G+G   +  +
Sbjct: 168 GVMQVEGARQTRVNNENQIIVVRGLVRPIDVGPDNTVPSTQLADCQIEYYGEGDLADRQK 227

Query: 225 PPIGHQLIENLSPL 238
                ++++N+ P 
Sbjct: 228 SGWLTRILDNVWPF 241


>gi|300936129|ref|ZP_07151068.1| flagellar L-ring protein FlgH [Escherichia coli MS 21-1]
 gi|300458707|gb|EFK22200.1| flagellar L-ring protein FlgH [Escherichia coli MS 21-1]
          Length = 246

 Score = 68.6 bits (166), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 80/152 (52%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++FG    +++G 
Sbjct: 82  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPTIFGHTKDKLSGS 138

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 139 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 192

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 193 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 224


>gi|161614596|ref|YP_001588561.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161363960|gb|ABX67728.1| hypothetical protein SPAB_02346 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 202

 Score = 68.6 bits (166), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 32  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQG---LFG 88

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M  +    GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 89  NSRADMEAS----GGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 144

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 145 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 202


>gi|312962292|ref|ZP_07776783.1| Flagellar L-ring protein [Pseudomonas fluorescens WH6]
 gi|311283219|gb|EFQ61809.1| Flagellar L-ring protein [Pseudomonas fluorescens WH6]
          Length = 231

 Score = 68.6 bits (166), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 88/178 (49%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGFSLFG----QQTP 124
           L+ D +A  VGDI+T+ +    QA    ++Q G++   SL     G  SLFG       P
Sbjct: 58  LYSDRKAFRVGDIITITLNEKTQASKNANSQIGKTSKASL-----GLTSLFGGVPNTNNP 112

Query: 125 QMNGNLNYDGG----GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
             +G+L+ D G     A++GK + ++   L   I   V  +L NG + + G + + +N  
Sbjct: 113 LGSGDLSLDAGYSGDRATNGKSAAAQGNTLTGSITVTVADVLPNGIIAVRGEKWMTLNTG 172

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+V   +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 173 DELVRIAGMVRADDIATDNTVPSTRIADARITYSGTGSFADASQPGWFDRFF--LSPL 228


>gi|327393474|dbj|BAK10896.1| flagellar L-ring protein precursor FlgH [Pantoea ananatis AJ13355]
          Length = 234

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 82/180 (45%), Gaps = 16/180 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS-------LHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   + +  SRN S       +   L+G     G
Sbjct: 62  YQPLFEDRRPRNIGDTLTITLQENVSASKSSTSNASRNGSGSLGITAVPTGLAGLAGASG 121

Query: 121 QQTPQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           ++        N+  GG +  +GKG  S        I   V  +L NGNL + G +++ +N
Sbjct: 122 EKA-------NFAAGGKNDFAGKGGASANNTFTGTITVTVDQVLSNGNLHVVGEKQIEIN 174

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
                +  +G+V P+ + A N+V    +A+ARI Y G G   E        +   N+SP 
Sbjct: 175 QGTEFIRFSGVVNPRTISASNAVLSTAVADARIEYVGNGYINEAQNMGWLQRFFLNISPF 234


>gi|291617023|ref|YP_003519765.1| FlgH [Pantoea ananatis LMG 20103]
 gi|291152053|gb|ADD76637.1| FlgH [Pantoea ananatis LMG 20103]
          Length = 236

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 82/180 (45%), Gaps = 16/180 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS-------LHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   + +  SRN S       +   L+G     G
Sbjct: 64  YQPLFEDRRPRNIGDTLTITLQENVSASKSSTSNASRNGSGSLGITAVPTGLAGLAGASG 123

Query: 121 QQTPQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           ++        N+  GG +  +GKG  S        I   V  +L NGNL + G +++ +N
Sbjct: 124 EKA-------NFAAGGKNDFAGKGGASANNTFTGTITVTVDQVLSNGNLHVVGEKQIEIN 176

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
                +  +G+V P+ + A N+V    +A+ARI Y G G   E        +   N+SP 
Sbjct: 177 QGTEFIRFSGVVNPRTISASNAVLSTAVADARIEYVGNGYINEAQNMGWLQRFFLNISPF 236


>gi|331671807|ref|ZP_08372603.1| flagellar L-ring protein FlgH [Escherichia coli TA280]
 gi|331070796|gb|EGI42155.1| flagellar L-ring protein FlgH [Escherichia coli TA280]
          Length = 246

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 80/152 (52%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++FG    +++G 
Sbjct: 82  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPAIFGHTKDKLSGS 138

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 139 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 192

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 193 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 224


>gi|213648929|ref|ZP_03378982.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
          Length = 211

 Score = 68.2 bits (165), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 41  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQG---LFG 97

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M  +    GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 98  NSRADMEAS----GGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 153

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 154 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 211


>gi|293408370|ref|ZP_06652209.1| flagellar L-ring protein FlgH [Escherichia coli B354]
 gi|291471548|gb|EFF14031.1| flagellar L-ring protein FlgH [Escherichia coli B354]
          Length = 221

 Score = 68.2 bits (165), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 80/152 (52%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++FG    +++G 
Sbjct: 57  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPTIFGHTKDKLSGS 113

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 114 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 167

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 168 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 199


>gi|291277382|ref|YP_003517154.1| putative flagellar L-ring protein precursor [Helicobacter mustelae
           12198]
 gi|290964576|emb|CBG40429.1| putative flagellar L-ring protein precursor [Helicobacter mustelae
           12198]
          Length = 231

 Score = 68.2 bits (165), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 60/102 (58%), Gaps = 5/102 (4%)

Query: 121 QQTPQMNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
           +QT  ++   NY     SS     G G+ S++E L+L+I A +  +LENGN  I G +++
Sbjct: 109 RQTQDLDDRTNYTMTKPSSNSTFKGGGTQSKSESLSLVITARIVKVLENGNYFIYGKKDI 168

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            V+ E + + V+G+VRP D++  N+V    +A+A+I Y   G
Sbjct: 169 LVDGEKQMIEVSGVVRPYDINRDNTVESKYLADAKIQYANVG 210


>gi|195953749|ref|YP_002122039.1| flagellar L-ring protein [Hydrogenobaculum sp. Y04AAS1]
 gi|195933361|gb|ACG58061.1| flagellar L-ring protein [Hydrogenobaculum sp. Y04AAS1]
          Length = 224

 Score = 68.2 bits (165), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 100/220 (45%), Gaps = 33/220 (15%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           +F V   S LL  C S+   +  +P  +P                  +N +  K S  + 
Sbjct: 10  AFNVTMLSLLLNSCASTPHHLKYLPYSTPS-----------------QNLNYVKGSLYVP 52

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGFSLFGQQ 122
               A L+ D RA  VGD++ + +     AV    NQT RS  ++ +  +S   S FG  
Sbjct: 53  DSPMANLYSDQRAFAVGDLVHILVSESVNAVESISNQTQRS--STFNDAVS---SFFGLP 107

Query: 123 TPQMNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           +  +  NL   G GASS      +G+ S++      I A V  +  NGNL+I G + + +
Sbjct: 108 SSTLR-NL---GVGASSNNQQKAQGTESQSGVFTTTITAYVKRVYPNGNLLIEGHKIIYL 163

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           N+  R + + GIVRPQD+D  ++V    IA   I Y G G
Sbjct: 164 NNVERVITLRGIVRPQDIDNTDTVPSQDIANLEILYQGHG 203


>gi|288940412|ref|YP_003442652.1| flagellar L-ring protein [Allochromatium vinosum DSM 180]
 gi|288895784|gb|ADC61620.1| flagellar L-ring protein [Allochromatium vinosum DSM 180]
          Length = 231

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 79/152 (51%), Gaps = 4/152 (2%)

Query: 69  AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           AALF+D +AL VGD++TV +     A   + T  +++++    + G  ++ G+     + 
Sbjct: 59  AALFEDRKALRVGDLVTVMLNEKTNAKKSSATSTAKDSNATMDV-GNVTIAGRTVLAADA 117

Query: 129 NL---NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
            L   +   G    G G  S++ + +  I   V  +L NGNL+I G + + +N     + 
Sbjct: 118 QLLGLSSKAGRTFDGSGDSSQSNQFSGEITVTVAEVLPNGNLVIQGEKWLGINQGNEFVR 177

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           + GIVRP D+   N V+  +IA A++ YGG G
Sbjct: 178 LRGIVRPVDITKDNKVNSTQIANAQLYYGGTG 209


>gi|191168479|ref|ZP_03030267.1| flagellar L-ring protein FlgH [Escherichia coli B7A]
 gi|190901498|gb|EDV61259.1| flagellar L-ring protein FlgH [Escherichia coli B7A]
          Length = 232

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   N  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFNGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|309798073|ref|ZP_07692448.1| flagellar L-ring protein FlgH [Escherichia coli MS 145-7]
 gi|308118356|gb|EFO55618.1| flagellar L-ring protein FlgH [Escherichia coli MS 145-7]
          Length = 235

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   N  +   V  +L NGNL + G +++ +N  
Sbjct: 122 N----ARADVEASGGNTFNGKGGANASNTFNGTLTVTVDQVLVNGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|256020231|ref|ZP_05434096.1| flagellar basal body L-ring protein [Shigella sp. D9]
 gi|301645416|ref|ZP_07245357.1| flagellar L-ring protein FlgH [Escherichia coli MS 146-1]
 gi|307136861|ref|ZP_07496217.1| flagellar basal body L-ring protein [Escherichia coli H736]
 gi|331640716|ref|ZP_08341863.1| flagellar L-ring protein FlgH [Escherichia coli H736]
 gi|331666549|ref|ZP_08367423.1| flagellar L-ring protein FlgH [Escherichia coli TA271]
 gi|332281393|ref|ZP_08393806.1| lateral flagellar L-ring protein [Shigella sp. D9]
 gi|301076300|gb|EFK91106.1| flagellar L-ring protein FlgH [Escherichia coli MS 146-1]
 gi|315616824|gb|EFU97441.1| flagellar L-ring family protein [Escherichia coli 3431]
 gi|323181550|gb|EFZ66970.1| flagellar L-ring family protein [Escherichia coli 1357]
 gi|323191541|gb|EFZ76802.1| flagellar L-ring family protein [Escherichia coli RN587/1]
 gi|331040090|gb|EGI12298.1| flagellar L-ring protein FlgH [Escherichia coli H736]
 gi|331065773|gb|EGI37657.1| flagellar L-ring protein FlgH [Escherichia coli TA271]
 gi|332103745|gb|EGJ07091.1| lateral flagellar L-ring protein [Shigella sp. D9]
          Length = 221

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 80/152 (52%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++FG    +++G 
Sbjct: 57  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPTIFGHTKDKLSGS 113

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 114 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 167

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 168 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 199


>gi|331645421|ref|ZP_08346525.1| flagellar L-ring protein FlgH [Escherichia coli M605]
 gi|331045583|gb|EGI17709.1| flagellar L-ring protein FlgH [Escherichia coli M605]
          Length = 246

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 80/152 (52%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++FG    +++G 
Sbjct: 82  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPTIFGHTKDKLSGS 138

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 139 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 192

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 193 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 224


>gi|170021357|ref|YP_001726311.1| flagellar basal body L-ring protein [Escherichia coli ATCC 8739]
 gi|169756285|gb|ACA78984.1| flagellar L-ring protein [Escherichia coli ATCC 8739]
          Length = 221

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 80/152 (52%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++FG    +++G 
Sbjct: 57  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPTIFGHTKDKLSGS 113

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 114 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 167

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 168 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 199


>gi|237731010|ref|ZP_04561491.1| flagellar basal body L-ring protein [Citrobacter sp. 30_2]
 gi|226906549|gb|EEH92467.1| flagellar basal body L-ring protein [Citrobacter sp. 30_2]
          Length = 235

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            +      ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 122 NE----RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|291085565|ref|ZP_06353368.2| flagellar L-ring protein FlgH [Citrobacter youngae ATCC 29220]
 gi|291071310|gb|EFE09419.1| flagellar L-ring protein FlgH [Citrobacter youngae ATCC 29220]
          Length = 235

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            +      ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 122 NE----RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|261253611|ref|ZP_05946184.1| flagellar L-ring protein FlgH [Vibrio orientalis CIP 102891]
 gi|260937002|gb|EEX92991.1| flagellar L-ring protein FlgH [Vibrio orientalis CIP 102891]
          Length = 260

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 80/159 (50%), Gaps = 5/159 (3%)

Query: 69  AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           ++L+ DS+   +GDI+TV +     A   +    S+NN           + GQQ    + 
Sbjct: 94  SSLYDDSKPRGIGDIITVTLDESTNASKSSDADLSKNNDATMD---PLEVGGQQLNIGDY 150

Query: 129 NLNYD--GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           N +Y+     + SG  + +++  L+  I   V  +L NGNL+I G + + +N     + +
Sbjct: 151 NFSYNLSNDNSFSGSAAANQSNSLSGSITVEVIEVLANGNLVIRGEKWLTLNTGDEYIRL 210

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           +G +RP D+D  N+++  +I+ ARI Y G G   ++  P
Sbjct: 211 SGTIRPDDIDYQNTIASTRISNARIQYSGTGTQQDMQEP 249


>gi|121997316|ref|YP_001002103.1| flagellar L-ring protein [Halorhodospira halophila SL1]
 gi|121588721|gb|ABM61301.1| flagellar L-ring protein [Halorhodospira halophila SL1]
          Length = 228

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 98/217 (45%), Gaps = 11/217 (5%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
           L+ GC +++         +P+     E + +    +D  +    +       +    LF+
Sbjct: 7   LIRGCAAALVAGVAAAACTPLPQEAPEPSPITAPRVDVPDDPDERTGSVFDEERSMRLFE 66

Query: 74  DSRALNVGDILTVDIR--IDDQAVFDNQTGRSRNNSLHRKLSGG--FSLFGQQTP-QMNG 128
           D  A   GD++TV I   I      +++  R +   +     GG    +FG+    +  G
Sbjct: 67  DRSARRTGDLITVVIEEEIAGDRSINSEMARQQEADMPAPQIGGEDLEIFGRPFAFEQEG 126

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
             +++GGG      S  +   L   I A+V     NG+L+I G + VRV+    +L ++G
Sbjct: 127 EASFEGGG------SADQETNLTGTINAVVVDTTPNGHLVIRGEKNVRVSQGQETLRISG 180

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           IVR  DV A+N VS +++A  ++ Y G+   ++  +P
Sbjct: 181 IVRTDDVGANNEVSSNRVANMQVGYTGEEALSDSAQP 217


>gi|290474976|ref|YP_003467860.1| flagellar basal-body outer-membrane L (lipopolysaccharide layer)
           ring protein [Xenorhabdus bovienii SS-2004]
 gi|289174293|emb|CBJ81083.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Xenorhabdus
           bovienii SS-2004]
          Length = 250

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 79/179 (44%), Gaps = 16/179 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ-- 125
           +  LF+D R  N+GD LT+        +       S+N+S +   SG        TP+  
Sbjct: 80  YQPLFEDRRPRNIGDTLTI--------ILQENVSASKNSSANASRSGKTGFTAALTPRFL 131

Query: 126 ---MNGN---LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
              M G+   L+ +G     GKG  +        I   V  +L NGNL   G +++ +N 
Sbjct: 132 KGLMGGDKTDLSMEGDSEFGGKGGANANNTFRGTITVTVDRLLANGNLHAVGEKQIAINQ 191

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               +  +G+V P+ +   N+VS +++A+ARI Y G G   E        +   N+SP 
Sbjct: 192 GTEFIRFSGVVNPRTITGTNTVSSNQVADARIEYVGDGYINEAQTMGWLQRFFMNISPF 250


>gi|229591868|ref|YP_002873987.1| flagellar basal body L-ring protein [Pseudomonas fluorescens SBW25]
 gi|259645995|sp|C3K0W0|FLGH_PSEFS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|229363734|emb|CAY51138.1| flagellar L-ring protein [Pseudomonas fluorescens SBW25]
          Length = 231

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 86/178 (48%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGFSLFGQ----QTP 124
           L+ D +A  VGDI+T+ +    QA    ++Q G++    +     G  SLFG       P
Sbjct: 58  LYSDRKAFRVGDIITITLNEKTQASKNANSQVGKTSKTGI-----GLTSLFGAVPNTNNP 112

Query: 125 QMNGNLN----YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
             +G+L+    Y G  A++GK S  +   L   I   V  +L NG + + G + + +N  
Sbjct: 113 LGDGDLSLSAGYSGDRATNGKSSAGQGNSLTGSITVTVADVLPNGIIAVRGEKWMTLNTG 172

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+V   +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 173 DELVRIAGMVRADDISTDNTVPSTRIADARITYSGTGSFADASQPGWFDRFF--LSPL 228


>gi|21231394|ref|NP_637311.1| flagellar basal body L-ring protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768553|ref|YP_243315.1| flagellar basal body L-ring protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188991638|ref|YP_001903648.1| flagellar basal body L-ring protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|31076713|sp|Q8P9B9|FLGH_XANCP RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|81305475|sp|Q4UUH8|FLGH_XANC8 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701938|sp|B0RT13|FLGH_XANCB RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|21113059|gb|AAM41235.1| flagellar L-ring protein [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66573885|gb|AAY49295.1| flagellar L-ring protein [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167733398|emb|CAP51599.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 230

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 79/156 (50%), Gaps = 18/156 (11%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS---------GGFSLFGQ 121
           L+ D RA +VGD+LTV++  +  A     T  S+ +++               G  +   
Sbjct: 62  LYGDRRARDVGDLLTVNLVENTTASSTANTSISKADTVDMSTPTLLGVPLTVNGIDVLRN 121

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
            T   +G+ ++DG      KG+ +++ ++   +   V   L NGNL+I G + +R+    
Sbjct: 122 ST---SGDRSFDG------KGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGD 172

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
             + V GIVR  D+   NSV   K+A+ARI+YGG+G
Sbjct: 173 ELVQVQGIVRAADIAPDNSVPSSKVADARIAYGGRG 208


>gi|283784087|ref|YP_003363952.1| lateral flagellar L-ring protein [Citrobacter rodentium ICC168]
 gi|282947541|emb|CBG87094.1| lateral flagellar L-ring protein [Citrobacter rodentium ICC168]
          Length = 221

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 78/152 (51%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   +NN++     G  + FG     ++G 
Sbjct: 57  SLTADRRAYRVGDILTVLLEESTQSSKQAKTNFGKNNTVD---IGAPTFFGHTKKNLSGS 113

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V ++  NG L I G + + +N     + 
Sbjct: 114 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHSVQPNGILEIRGEKWLTLNQGDEYIR 167

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 168 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 199


>gi|307823534|ref|ZP_07653763.1| flagellar L-ring protein [Methylobacter tundripaludum SV96]
 gi|307735519|gb|EFO06367.1| flagellar L-ring protein [Methylobacter tundripaludum SV96]
          Length = 236

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 97/214 (45%), Gaps = 22/214 (10%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           I++   SLL  C       T IPQ  P  + +   +  P      +NS S    Y    D
Sbjct: 20  ILVVELSLLQAC-------TPIPQRDPAFAPVAPADLRP----PVQNSGSI---YQSGYD 65

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           +   LF+D  A  VGDILT+ +    QA   +     + N +  ++    S+FG     +
Sbjct: 66  TR--LFEDQTAKRVGDILTITLLEKTQAKKADDLNTKKENKMTAEVP---SMFGIAASAL 120

Query: 127 NGN---LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
            G     +        G G+  ++  L+  I+  V  +L NGNL + G + V +N     
Sbjct: 121 TGQSLQTSLQSSKEFKGTGAADQSNSLSGNISVTVVDVLPNGNLNVRGEKRVTLNQGDEF 180

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           + ++GIVRP D+ + N ++ DK+A+  I Y G+G
Sbjct: 181 IRLSGIVRPVDITSSNIITSDKVADVTIMYVGEG 214


>gi|306814072|ref|ZP_07448245.1| flagellar basal body L-ring protein [Escherichia coli NC101]
 gi|305852709|gb|EFM53157.1| flagellar basal body L-ring protein [Escherichia coli NC101]
          Length = 232

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+VS  ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVSSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|89092139|ref|ZP_01165094.1| Flagellar basal body L-ring protein [Oceanospirillum sp. MED92]
 gi|89083874|gb|EAR63091.1| Flagellar basal body L-ring protein [Oceanospirillum sp. MED92]
          Length = 225

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 80/159 (50%), Gaps = 24/159 (15%)

Query: 71  LFKDSRALNVGDILTVDIR--IDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D RA  VGDILT+ ++     Q     +  +S N SL +      +L GQ T  +NG
Sbjct: 57  LYGDGRAHRVGDILTITLQESTSSQKSAKTELDKSSNLSLAQP-----TLLGQ-TVDING 110

Query: 129 ----------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                      L++DG G+S        +  L   I   V  +L NG L++ G + + +N
Sbjct: 111 RPLSATLNGPTLDFDGEGSSD------MSNNLTGNITVTVHDVLPNGVLLVKGEKWLTLN 164

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
                + ++G+VRPQD+ + NSV   K+A+ARI+Y G G
Sbjct: 165 QGDEYIRISGMVRPQDIGSDNSVMSTKLADARITYSGTG 203


>gi|311280014|ref|YP_003942245.1| flagellar L-ring protein [Enterobacter cloacae SCF1]
 gi|308749209|gb|ADO48961.1| flagellar L-ring protein [Enterobacter cloacae SCF1]
          Length = 232

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 83/175 (47%), Gaps = 8/175 (4%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+     K + GFS   +    + 
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDG----KTNFGFSTVPRYLEGLF 117

Query: 128 GNLNYD----GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
           GN   D    GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     
Sbjct: 118 GNARADVDASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEF 177

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 IRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|146311249|ref|YP_001176323.1| flagellar basal body L-ring protein [Enterobacter sp. 638]
 gi|145318125|gb|ABP60272.1| flagellar L-ring protein [Enterobacter sp. 638]
          Length = 235

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNIGDTLTIQLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 122 N----ARADVEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|325923277|ref|ZP_08184950.1| flagellar basal body L-ring protein [Xanthomonas gardneri ATCC
           19865]
 gi|325546204|gb|EGD17385.1| flagellar basal body L-ring protein [Xanthomonas gardneri ATCC
           19865]
          Length = 230

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 80/153 (52%), Gaps = 12/153 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG--GFSLFGQQTPQM-- 126
           L+ D RA +VGD+LTV++  +  A     T  S+ +++        G  L    T  +  
Sbjct: 62  LYGDRRARDVGDLLTVNLVENTTASSTANTSISKADTVDMSTPTLLGVPLTVNGTDVLRN 121

Query: 127 --NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
             +G+ ++DG      KG+ +++ ++   +   V   L NGNL+I G + +R+      +
Sbjct: 122 STSGDRSFDG------KGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDELV 175

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            V GIVR  D+   N+V   K+A+ARI+YGG+G
Sbjct: 176 QVQGIVRAADISPDNTVPSSKVADARIAYGGRG 208


>gi|195940719|ref|ZP_03086101.1| flagellar basal body L-ring protein [Escherichia coli O157:H7 str.
           EC4024]
          Length = 232

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  NVGD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNVGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   +L   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADLEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGTNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|149911699|ref|ZP_01900307.1| Flagellar basal body L-ring protein [Moritella sp. PE36]
 gi|149805229|gb|EDM65246.1| Flagellar basal body L-ring protein [Moritella sp. PE36]
          Length = 251

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 75/148 (50%), Gaps = 7/148 (4%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR---KLSGGFSLFGQQTPQMN 127
           +F D +A  VGDI+TV +     A     +   ++NS       L G   + G  T  + 
Sbjct: 84  IFSDIKARRVGDIITVMLTESTSAKKQASSNLGKDNSFELDPVNLGGEDVVIGGYT--IE 141

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
           G+LN     + SG GS  ++  L   I+  V  +L N NL+I G + + +N+    + +T
Sbjct: 142 GSLNQKS--SFSGNGSADQSNSLKGNISVTVVRVLPNNNLVIRGEKWLMLNNGSEYIRLT 199

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGG 215
           G++RPQDVDA N V    IA ARI YG 
Sbjct: 200 GLLRPQDVDADNKVDSSLIANARIQYGA 227


>gi|186477700|ref|YP_001859170.1| flagellar basal body L-ring protein [Burkholderia phymatum STM815]
 gi|184194159|gb|ACC72124.1| flagellar L-ring protein [Burkholderia phymatum STM815]
          Length = 236

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 83/167 (49%), Gaps = 15/167 (8%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL-SGGF-- 116
           S++   +A   LF+D R  NVGDILT+ I  +  A   +    +RN      + + GF  
Sbjct: 61  SIYNPGYAGRPLFEDQRPRNVGDILTIVISENINATKSSGANTNRNGETKFGVPTAGFLG 120

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGK--GSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
            LFG+        +N D  GA++ K  G  + +   +  I   V  +  NGNL++SG ++
Sbjct: 121 GLFGK--------VNLDATGANTFKATGGANASNTFSGTITVTVIGVQPNGNLVVSGEKQ 172

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           + +N     +  +G+V P  + + N+V   ++A+A+I Y  KG   E
Sbjct: 173 MLINQGNEFVRFSGVVNPNTISSLNAVYSTQVADAKIEYSAKGYIDE 219


>gi|148980299|ref|ZP_01815986.1| flagellar L-ring protein precursor H [Vibrionales bacterium SWAT-3]
 gi|145961318|gb|EDK26628.1| flagellar L-ring protein precursor H [Vibrionales bacterium SWAT-3]
          Length = 240

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 76/149 (51%), Gaps = 9/149 (6%)

Query: 71  LFKDSRALNVGDILTV--DIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           LF+D RA  VGDILTV  D + +       Q G+  + ++     G    F   +  ++ 
Sbjct: 77  LFQDRRAYRVGDILTVLLDEKTESDKSASTQYGKDSSANITAPTLGN-KTFEDVSASVDA 135

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
             ++DG  AS    S+S +      I   V  +L NG L + G + +++N     + +TG
Sbjct: 136 TRDFDGAAASKQGNSLSGS------ITVTVYNVLPNGVLRVRGEKWLKLNQGDEYIRLTG 189

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            VR  D+ A N++S  +IA+ARI+Y G+G
Sbjct: 190 NVRVDDIQADNTLSSQRIADARITYAGRG 218


>gi|294140188|ref|YP_003556166.1| flagellar L-ring protein FlgH [Shewanella violacea DSS12]
 gi|293326657|dbj|BAJ01388.1| flagellar L-ring protein FlgH [Shewanella violacea DSS12]
          Length = 228

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 95/193 (49%), Gaps = 24/193 (12%)

Query: 45  PFLGIDFKNSDSTK--KSYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTG 101
           P+    +  + +TK   + S+++ S A+ L+ D +AL VGDI+TV +    QA       
Sbjct: 32  PYYAPVYPEAPATKIVATGSMYQASQASSLYSDIKALKVGDIITVILMEQTQA------K 85

Query: 102 RSRNNSLHRKL----------SGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLN 151
           +S +N + +            SG  S+ GQ       +L Y     +  +    ++  L+
Sbjct: 86  KSASNEIKKGTDLTLDPIYVGSGNISISGQAL-----DLRYKDSMNTKRESDADQSNSLS 140

Query: 152 LLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARI 211
             I+A V  +L NGNL+I G + + +N+    + +TG+VR QD+   N++   ++A ARI
Sbjct: 141 GSISANVMQVLNNGNLVIRGEKWISINNGDEFVRLTGLVRSQDIRPDNTIDSTRVANARI 200

Query: 212 SYGGKGRTTELLR 224
            Y G G   ++ +
Sbjct: 201 QYSGTGTFADVQK 213


>gi|170682469|ref|YP_001742376.1| flagellar basal body L-ring protein [Escherichia coli SMS-3-5]
 gi|188494218|ref|ZP_03001488.1| flagellar L-ring protein FlgH [Escherichia coli 53638]
 gi|306813300|ref|ZP_07447493.1| flagellar basal body L-ring protein [Escherichia coli NC101]
 gi|170520187|gb|ACB18365.1| lateral flagellar L-ring protein LfgH [Escherichia coli SMS-3-5]
 gi|188489417|gb|EDU64520.1| flagellar L-ring protein FlgH [Escherichia coli 53638]
 gi|305854063|gb|EFM54502.1| flagellar basal body L-ring protein [Escherichia coli NC101]
          Length = 221

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 80/152 (52%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++FG    +++G 
Sbjct: 57  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPTIFGHTKDKLSGS 113

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 114 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 167

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 168 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 199


>gi|295097200|emb|CBK86290.1| Flagellar basal body L-ring protein [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 237

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 82/174 (47%), Gaps = 6/174 (3%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM- 126
           +  +F+D R  +VGD LT+ ++ +  A   +    +RN S    L    ++ G     + 
Sbjct: 67  YQPMFEDRRPRSVGDTLTILLQENVSASKSSSASANRNGSAGMGL---LAMPGSSNSWLG 123

Query: 127 NGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
           NG  +++  G S  SGKG  +        I   V  +L NGNL + G +++ +N     +
Sbjct: 124 NGKADFNAEGKSDFSGKGGAAARNTFTGTITVTVNKLLPNGNLQVVGEKQIAINQGTEFI 183

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
             +G+V P+ +   N+V   ++A+ARI Y G G   E        +L  NLSP 
Sbjct: 184 RFSGVVNPRTISGANTVPSTQVADARIEYVGNGYINEAQTMGWLQRLFLNLSPF 237


>gi|332305618|ref|YP_004433469.1| flagellar L-ring protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172947|gb|AEE22201.1| flagellar L-ring protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 230

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 76/156 (48%), Gaps = 8/156 (5%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK----LSGGFSLFGQ 121
           D   +L+ D +A  VGDI+TV ++ +  A     T  S+ ++L       L G     G 
Sbjct: 57  DMANSLYSDVKARRVGDIITVSLQENTSATKSAGTTTSKESALDVNPIIGLGGNALNIGS 116

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
           Q+ Q    L  D     +G  S +++  L+  I+  V  +  N NL++ G + + +N+  
Sbjct: 117 QSVQ----LGVDSSNEFTGDASANQSNNLSGDISVTVMKVFPNQNLLVRGEKWLTLNNGN 172

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
             + +TG+VRP D+   N V   KIA ARI Y G G
Sbjct: 173 EYIRLTGVVRPADISPTNEVISTKIANARIQYSGTG 208


>gi|322832567|ref|YP_004212594.1| flagellar L-ring protein [Rahnella sp. Y9602]
 gi|321167768|gb|ADW73467.1| flagellar L-ring protein [Rahnella sp. Y9602]
          Length = 243

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 81/178 (45%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH-------RKLSGGFSLFG 120
           +  LF+D R  NVGD LT+ ++ +  A   +    SRN +         R L G   LFG
Sbjct: 73  YQPLFEDRRPRNVGDTLTIVLQENVSASKSSSANASRNGATSFGAATAPRYLEG---LFG 129

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   +L+  G    +GKG  +     +  +   V  +L NGNL + G +++ +N  
Sbjct: 130 NA----RADLDMTGANTFAGKGGAAANNTFSGTLTVTVGEVLANGNLKVVGEKQIEINQG 185

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSPL
Sbjct: 186 TEFIRFSGVVNPRTISGSNAVISTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPL 243


>gi|283477479|emb|CAY73395.1| Flagellar L-ring protein precursor [Erwinia pyrifoliae DSM 12163]
          Length = 237

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 96/218 (44%), Gaps = 35/218 (16%)

Query: 30  QMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIR 89
           QM+P G+S          G  F++  +    Y         +F+D R  NVGD LT+ ++
Sbjct: 46  QMAPTGAS----------GSLFQSGQAMNYGYQ-------PMFEDRRPRNVGDTLTILLQ 88

Query: 90  IDDQAVFDNQTGRSRNNS-------LHRKLSGGFSLFGQQTPQMNGNLNYDGGGAS--SG 140
            +  A   +    +RN S       +   +SG            NG L+++  G S  +G
Sbjct: 89  ENVSASKSSSASANRNGSAGMGLEVVPSSVSGALG---------NGKLDFNAEGQSDFAG 139

Query: 141 KGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNS 200
           KG  +        I   V  +L NGNL + G +++ +N     +  +G+V P+ +   N+
Sbjct: 140 KGGAAARNTFTGTITVTVNQLLPNGNLQVVGEKQIAINQGTEFIRFSGVVNPRTISGSNT 199

Query: 201 VSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VS  ++++ARI Y G G   E        +++ N+SP 
Sbjct: 200 VSSTQVSDARIEYVGNGYINESQNMGWLQRVLLNISPF 237


>gi|293605006|ref|ZP_06687402.1| flagellar L-ring protein [Achromobacter piechaudii ATCC 43553]
 gi|292816611|gb|EFF75696.1| flagellar L-ring protein [Achromobacter piechaudii ATCC 43553]
          Length = 229

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 77/159 (48%), Gaps = 15/159 (9%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM---- 126
           LF+D R  NVGDI+T+        V + +T  S+N + +   +G  +L     P      
Sbjct: 63  LFEDRRPRNVGDIVTI--------VLNERTNASKNVATNTNRTGSATLGIAAAPSFMDSW 114

Query: 127 -NGNLNYD--GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
              NLN D  GG  + GKG  +        I   V  ++ NGNL ++G +++ +N     
Sbjct: 115 AGANLNTDAKGGNVAQGKGDSTANNAFTGTITTTVVGVMSNGNLQVAGEKQIAINRGSEY 174

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
           +   G+V P+ +   N+VS  ++A+ARI Y  KG   E+
Sbjct: 175 VRFAGVVDPRSITGTNTVSSTQVADARIEYRSKGVMDEV 213


>gi|259907637|ref|YP_002647993.1| Flagellar L-ring protein, FlgH [Erwinia pyrifoliae Ep1/96]
 gi|224963259|emb|CAX54743.1| Flagellar L-ring protein, FlgH [Erwinia pyrifoliae Ep1/96]
 gi|310764857|gb|ADP09807.1| Flagellar L-ring protein, FlgH [Erwinia sp. Ejp617]
          Length = 245

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 96/218 (44%), Gaps = 35/218 (16%)

Query: 30  QMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIR 89
           QM+P G+S          G  F++  +    Y         +F+D R  NVGD LT+ ++
Sbjct: 54  QMAPTGAS----------GSLFQSGQAMNYGYQ-------PMFEDRRPRNVGDTLTILLQ 96

Query: 90  IDDQAVFDNQTGRSRNNS-------LHRKLSGGFSLFGQQTPQMNGNLNYDGGGAS--SG 140
            +  A   +    +RN S       +   +SG            NG L+++  G S  +G
Sbjct: 97  ENVSASKSSSASANRNGSAGMGLEVVPSSVSGALG---------NGKLDFNAEGQSDFAG 147

Query: 141 KGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNS 200
           KG  +        I   V  +L NGNL + G +++ +N     +  +G+V P+ +   N+
Sbjct: 148 KGGAAARNTFTGTITVTVNQLLPNGNLQVVGEKQIAINQGTEFIRFSGVVNPRTISGSNT 207

Query: 201 VSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           VS  ++++ARI Y G G   E        +++ N+SP 
Sbjct: 208 VSSTQVSDARIEYVGNGYINESQNMGWLQRVLLNISPF 245


>gi|226327741|ref|ZP_03803259.1| hypothetical protein PROPEN_01614 [Proteus penneri ATCC 35198]
 gi|225203445|gb|EEG85799.1| hypothetical protein PROPEN_01614 [Proteus penneri ATCC 35198]
          Length = 247

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 79/178 (44%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS-------LHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A  ++    SRN           R L G   LFG
Sbjct: 77  YQPLFEDRRPRNIGDTLTITLQENVSASKNSSANASRNGKAGFLASITPRFLEG---LFG 133

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M    N D GG    KG  +        I   V  +L NGNL + G +++ +N  
Sbjct: 134 NNRADMGMEGNSDFGG----KGGANANNTFKGTITVTVDQLLANGNLHVIGEKQIAINQG 189

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP 
Sbjct: 190 TEFIRFSGVVNPRTISGSNTVNSTQVADARIEYIGDGYINEAQSMGWLQRFFLNVSPF 247


>gi|319944132|ref|ZP_08018410.1| flagellar L-ring protein FlgH [Lautropia mirabilis ATCC 51599]
 gi|319742626|gb|EFV95035.1| flagellar L-ring protein FlgH [Lautropia mirabilis ATCC 51599]
          Length = 253

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 81/153 (52%), Gaps = 14/153 (9%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN--- 127
           +F+D RA   GD+LT  I I+++ V  +    S N+++ RK  GG + FG   P +    
Sbjct: 88  MFEDRRARQPGDMLT--ILIEERLVAKH----SSNSTIDRK-GGGSAKFGA-LPFVKADK 139

Query: 128 -GNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
            G L  D   ++S  GKG+     +    I   V  +L NGNL++SG ++V +N  + +L
Sbjct: 140 LGKLGLDASTSNSFEGKGAAGNENQFAGTITVTVVDVLPNGNLVVSGEKQVGINQGVETL 199

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
              G+V P  +   N+VS  ++A+AR+   G G
Sbjct: 200 KFAGVVDPLTIMPGNTVSSTQVADARMQVRGAG 232


>gi|126668561|ref|ZP_01739515.1| Flagellar basal body L-ring protein [Marinobacter sp. ELB17]
 gi|126626966|gb|EAZ97609.1| Flagellar basal body L-ring protein [Marinobacter sp. ELB17]
          Length = 233

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 80/155 (51%), Gaps = 21/155 (13%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN--------NSLHRKLSGGFSLFGQQ 122
            + D+ ALNVGD+LTV +    +A  + +T  S++        N L R   G  +   QQ
Sbjct: 70  FYGDTVALNVGDVLTVTLSESTRASKNAETSISKDSDISLTEPNILGRNQLGLATAIEQQ 129

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                   +++G   +    S++ +      I   VT +L NG L I G + + + +   
Sbjct: 130 R-------DFEGAAEADQSNSLAGS------ITVTVTEVLPNGVLRIRGEKWLSLTNGEE 176

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + +TG+VRPQD+   N+++ ++IA+ARI+YGG G
Sbjct: 177 YIRLTGLVRPQDIKPDNTLASNRIADARIAYGGTG 211


>gi|109899399|ref|YP_662654.1| flagellar basal body L-ring protein [Pseudoalteromonas atlantica
           T6c]
 gi|109701680|gb|ABG41600.1| flagellar L-ring protein [Pseudoalteromonas atlantica T6c]
          Length = 230

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 75/156 (48%), Gaps = 8/156 (5%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK----LSGGFSLFGQ 121
           D   +L+ D +A  VGDI+TV +  +  A     T  S+ ++L       L G     G 
Sbjct: 57  DMANSLYSDVKARRVGDIITVSLEENTSATKSAGTTTSKESALDVNPIVGLGGNAVNIGS 116

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
           Q+ Q    L  D     +G  S +++  L+  I+  V  +  N NL++ G + + +N+  
Sbjct: 117 QSIQ----LGVDSSNEFTGDASANQSNNLSGDISVTVMKVFPNQNLLVRGEKWLTLNNGN 172

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
             + +TG+VRP D+   N +   KIA ARI Y G G
Sbjct: 173 EYIRLTGVVRPADISPTNEIVSTKIANARIQYSGTG 208


>gi|84388094|ref|ZP_00990990.1| flagellar L-ring protein precursor [Vibrio splendidus 12B01]
 gi|84377161|gb|EAP94031.1| flagellar L-ring protein precursor [Vibrio splendidus 12B01]
          Length = 258

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 87/167 (52%), Gaps = 6/167 (3%)

Query: 62  SLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+  +H  +++ DS+   +GDI+TV +  + +A        S++N    +     ++ G
Sbjct: 84  SLFNVNHIGSMYDDSKPRGIGDIITVALDENTRATKKANADMSKSNDASME---PLAVGG 140

Query: 121 QQTPQMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           Q+      N +YD    ++  G  S +++  ++  I   V  +L NGNL++ G + + +N
Sbjct: 141 QELTIDKYNFSYDLSNTNTFAGDASANQSNSISGYITVEVIEVLANGNLVVRGEKWMTLN 200

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
                + ++G +RP D+D  N+++ ++++ ARI Y G G   ++  P
Sbjct: 201 TGDEYIRLSGTIRPDDIDFENTIASNRVSNARIQYSGTGVQKDMQEP 247


>gi|224825780|ref|ZP_03698884.1| flagellar L-ring protein [Lutiella nitroferrum 2002]
 gi|224602004|gb|EEG08183.1| flagellar L-ring protein [Lutiella nitroferrum 2002]
          Length = 215

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 75/151 (49%), Gaps = 12/151 (7%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF---SLFGQQTPQM 126
           +L  DSRA  VGD LTV +    QA         +  +L  K SG     ++ G +T  +
Sbjct: 52  SLVTDSRAYRVGDALTVVLEETTQA-------SKKAGALLDKKSGASIQPTILGSKT--I 102

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           N  +  D      G  S ++   L+  ++ IV  +L NG L++ G +++ +N     L +
Sbjct: 103 NTKVGIDADRTFDGSSSSTQQNALSGALSVIVHQVLPNGLLLVKGEKQLTLNQGEEYLQL 162

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            G VR  D+D  N VS  +IA ARI+Y G+G
Sbjct: 163 AGYVRVDDIDTDNRVSSQRIANARIAYSGRG 193


>gi|254712017|ref|ZP_05173828.1| flagellar basal body L-ring protein [Brucella ceti M644/93/1]
 gi|254715086|ref|ZP_05176897.1| flagellar basal body L-ring protein [Brucella ceti M13/05/1]
 gi|261216796|ref|ZP_05931077.1| flagellar L-ring protein [Brucella ceti M13/05/1]
 gi|261319663|ref|ZP_05958860.1| flagellar L-ring protein [Brucella ceti M644/93/1]
 gi|260921885|gb|EEX88453.1| flagellar L-ring protein [Brucella ceti M13/05/1]
 gi|261292353|gb|EEX95849.1| flagellar L-ring protein [Brucella ceti M644/93/1]
          Length = 121

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 47/91 (51%), Gaps = 3/91 (3%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
           LL GC +   EI   P +SP+ + L   N   F G   +     K SYSLW       FK
Sbjct: 17  LLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQFNGYPAR---PGKASYSLWDQRSTNFFK 73

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSR 104
           D RA   GD+LTV I I+D+A  DN+T R R
Sbjct: 74  DPRAATPGDVLTVIISINDRANLDNKTDRER 104


>gi|218549193|ref|YP_002382984.1| flagellar basal body L-ring protein [Escherichia fergusonii ATCC
           35469]
 gi|226701924|sp|B7LT58|FLGH_ESCF3 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|218356734|emb|CAQ89362.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           fergusonii ATCC 35469]
          Length = 232

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 86/178 (48%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   +++  GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVDASGGNSFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|239995122|ref|ZP_04715646.1| flagellar basal body L-ring protein [Alteromonas macleodii ATCC
           27126]
          Length = 226

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 82/161 (50%), Gaps = 9/161 (5%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLH--RKLSGGF 116
           SL+R   A  L+ D  A  VGDI+TV +  + QA    D  T +  N +L+    L+G  
Sbjct: 48  SLFRSQLANNLYSDVTARRVGDIITVTLSENTQASKSADTSTAKDSNVNLNPITGLAGQA 107

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
              G ++ Q+  + + D     SG  + +++  LN  I+  V  +L N NL+I G + + 
Sbjct: 108 INIGGESVQLGISSSRD----FSGDATANQSNSLNGAISVTVVDVLPNSNLVIRGEKWLT 163

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +N     + +TGI+RP D+   N +   K+A ARI Y G G
Sbjct: 164 LNQGDEYIRLTGIIRPADISPENEIVSTKVANARIQYSGTG 204


>gi|94969952|ref|YP_592000.1| flagellar L-ring protein [Candidatus Koribacter versatilis
           Ellin345]
 gi|94552002|gb|ABF41926.1| flagellar L-ring protein [Candidatus Koribacter versatilis
           Ellin345]
          Length = 240

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 87/175 (49%), Gaps = 14/175 (8%)

Query: 58  KKSYSLWRDSHAALF---KDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG 114
           K + SLW D  + LF    D +A  V DI+T+ +    ++     TG   + +  R  +G
Sbjct: 59  KTTGSLWTD-ESPLFMIANDLKARRVHDIVTIAV---SESTLAQATG---DVTSQRDYAG 111

Query: 115 GFSLFGQQTPQMNGNLNYDGGGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
             ++         G +N     +SS    GKG+ +    L   +AA V A++ NGN+++ 
Sbjct: 112 NSAITALGGHVSTGGVNPLFAASSSTSLKGKGASNSQSTLRTTLAAEVVAVMTNGNMVVE 171

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
             + V++N+E+R++ + G+VRP D+   N VS   +A   I   GKG  ++  RP
Sbjct: 172 ARRSVKMNNELRTVILRGVVRPGDISPSNVVSSAALANLEIEMKGKGVVSDGTRP 226


>gi|260774941|ref|ZP_05883842.1| flagellar L-ring protein FlgH [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609196|gb|EEX35354.1| flagellar L-ring protein FlgH [Vibrio coralliilyticus ATCC BAA-450]
          Length = 259

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 81/159 (50%), Gaps = 5/159 (3%)

Query: 69  AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           ++L+ DS+   VGDI+TV +  + +A   +    S+NN           + GQQ    + 
Sbjct: 93  SSLYDDSKPRGVGDIITVTLDENTKAAKSSDADLSKNNDASMDP---LEVGGQQLNIGDY 149

Query: 129 NLNYD--GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           N +Y+       SG  + +++  ++  I   V  +L NGNL+I G + + +N     + +
Sbjct: 150 NFSYNLSNDNKFSGSAAANQSNSISGSITVEVVEVLANGNLVIRGEKWLTLNTGDEYIRL 209

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           +G +RP D+   N+++ ++I+ ARI Y G G   ++  P
Sbjct: 210 SGTIRPDDISYENTIASNRISNARIRYSGTGTQQDMQEP 248


>gi|284920902|emb|CBG33965.1| flagellar L-ring protein [Escherichia coli 042]
          Length = 232

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|330899407|gb|EGH30826.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330943211|gb|EGH45618.1| flagellar basal body L-ring protein [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330975979|gb|EGH76045.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 237

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 83/178 (46%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D +A  +GDI+T+ +  R+       +   ++ NNS+     G  SLFG      N 
Sbjct: 64  LYGDRKAFRIGDIITITLSERMAASKAATSAMSKNSNNSI-----GLTSLFGSGLTTNNP 118

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N  Y+G   + G G  +++  L   +   V  +L NG L + G + + +N  
Sbjct: 119 IGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILAVRGEKWMTLNTG 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 179 DELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 234


>gi|114320060|ref|YP_741743.1| flagellar L-ring protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226454|gb|ABI56253.1| flagellar L-ring protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 224

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 110/227 (48%), Gaps = 23/227 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKS 60
           + ++ F+ L  ++L  GC        G+P  +P    L E         + +N+ +  ++
Sbjct: 5   LIKWLFMALAVTALA-GC-------AGMPDQAPKPLPLPE-----IAEPERQNNGAIYQA 51

Query: 61  YSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
               R     LF+D R+  VGD++TV    +  A   N +  ++++S         ++ G
Sbjct: 52  GGEQR-----LFEDRRSRRVGDVITVLFEENTDASKSNSSSMTKSSSAELPAP---TVAG 103

Query: 121 QQTPQMNGNLNYDGGG--ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           +   +    L +D     + SG G+  ++ +L   + AIVT  + NG L+I G +++ +N
Sbjct: 104 RGATRGGVPLEFDAQADRSFSGDGAADQSNQLTGTLTAIVTDTMPNGYLVIEGQKKLTLN 163

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
                + ++GIVRP DV A N+VS  ++A A+I+Y G G   +  RP
Sbjct: 164 QGAEYVTISGIVRPDDVGADNTVSSLRVANAQIAYTGTGALADSNRP 210


>gi|324113874|gb|EGC07848.1| flagellar L-ring protein [Escherichia fergusonii B253]
 gi|325497613|gb|EGC95472.1| flagellar basal body L-ring protein [Escherichia fergusonii ECD227]
          Length = 246

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 86/178 (48%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 76  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 132

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   +++  GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 133 NA----RADVDASGGNSFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 188

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 189 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 246


>gi|91776312|ref|YP_546068.1| flagellar L-ring protein [Methylobacillus flagellatus KT]
 gi|122399643|sp|Q1GZW0|FLGH_METFK RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|91710299|gb|ABE50227.1| flagellar L-ring protein [Methylobacillus flagellatus KT]
          Length = 222

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 77/151 (50%), Gaps = 13/151 (8%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           ++  L +D RA  VGD + ++I  +  A        S++ +++  ++G   LFG   P+ 
Sbjct: 56  TYRPLLEDKRARLVGDTIVINITENTSATKSGSNSASKSGAVNAGITG---LFGHNVPKA 112

Query: 127 NGNLN----YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           + N      YD   AS+ +   +        I+A VT +L NG+L++SG ++V  +    
Sbjct: 113 SFNAASDNAYDDAAASNSRNVFTGT------ISATVTEVLPNGHLVVSGEKQVAFDRGTE 166

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISY 213
            +  +G+V P  V A NSV   ++A+ARI Y
Sbjct: 167 FVRFSGVVDPMYVAAGNSVPSSRVADARIEY 197


>gi|296102905|ref|YP_003613051.1| lagellar L-ring protein precursor FlgH [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295057364|gb|ADF62102.1| lagellar L-ring protein precursor FlgH [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295096222|emb|CBK85312.1| Flagellar basal body L-ring protein [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 235

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  NVGD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNVGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 122 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGTNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|300817267|ref|ZP_07097485.1| flagellar L-ring protein FlgH [Escherichia coli MS 107-1]
 gi|300530243|gb|EFK51305.1| flagellar L-ring protein FlgH [Escherichia coli MS 107-1]
          Length = 221

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 79/152 (51%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++FG    +++G 
Sbjct: 57  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPTIFGHTKDKLSGS 113

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 114 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 167

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+ R  D+   NSVS  +IA+ARISY G+G
Sbjct: 168 LSGLARADDIQNDNSVSSQRIADARISYAGRG 199


>gi|289679020|ref|ZP_06499910.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           syringae FF5]
          Length = 185

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 83/178 (46%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D +A  +GDI+T+ +  R+       +   ++ NNS+     G  SLFG      N 
Sbjct: 12  LYGDRKAFRIGDIITITLSERMAASKAATSAMSKNSNNSI-----GLTSLFGSGLTTNNP 66

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N  Y+G   + G G  +++  L   +   V  +L NG L + G + + +N  
Sbjct: 67  IGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILAVRGEKWMTLNTG 126

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 127 DELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 182


>gi|320179220|gb|EFW54178.1| Flagellar L-ring protein FlgH [Shigella boydii ATCC 9905]
          Length = 232

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|168699691|ref|ZP_02731968.1| Flagellar L-ring protein [Gemmata obscuriglobus UQM 2246]
          Length = 205

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 93/212 (43%), Gaps = 53/212 (25%)

Query: 56  STKKSYSLW--RD-SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL 112
           +T ++ SLW  RD  +A LF+D+RA  VGD+L V I   +  V + Q  R  N +     
Sbjct: 5   ATSRADSLWERRDPRYAYLFQDNRARAVGDVLVVTI--TENTVSNEQDARQLNRT---AT 59

Query: 113 SGGFSLF---------------------------GQQTPQMNGNLNYDGGGASSGKGSIS 145
           SGG   F                           G   P  + +LN++G   S+   + +
Sbjct: 60  SGGNVQFFGGGNVTPNNNGGGGGTGLGTVNSSGVGFTLPGGSTSLNFNGAAQSTVTHTFT 119

Query: 146 RAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDK 205
                   +A  V  I+ NGNL++ G +   V  E R L +TGIVR QD+   N V    
Sbjct: 120 DR------MAVTVVDIMPNGNLVVEGYKSRVVQGEERVLRLTGIVRQQDIGVGNVVGSGN 173

Query: 206 IAEARISYGGKG---RTTE---------LLRP 225
           +A  R+SY G+G   RTT          LLRP
Sbjct: 174 VANFRVSYLGRGPGSRTTRQSYLGRLGNLLRP 205


>gi|148976397|ref|ZP_01813103.1| flagellar L-ring protein precursor H [Vibrionales bacterium SWAT-3]
 gi|145964220|gb|EDK29476.1| flagellar L-ring protein precursor H [Vibrionales bacterium SWAT-3]
          Length = 258

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 87/167 (52%), Gaps = 6/167 (3%)

Query: 62  SLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+  +H  +++ DS+   +GDI+TV +  + +A        S++N    +     ++ G
Sbjct: 84  SLFNVNHIGSMYDDSKPRGIGDIITVALDENTRATKKANADMSKSNDASME---PLAVGG 140

Query: 121 QQTPQMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           Q+      N +YD    ++  G  S +++  ++  I   V  +L NGNL++ G + + +N
Sbjct: 141 QELTIDKYNFSYDLSNTNTFAGDASANQSNSISGYITVEVIEVLANGNLVVRGEKWMTLN 200

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
                + ++G +RP D+D  N+++ ++++ ARI Y G G   ++  P
Sbjct: 201 TGDEYIRLSGTIRPDDIDFDNTIASNRVSNARIQYSGTGVQQDMQEP 247


>gi|327480023|gb|AEA83333.1| flagellar basal body L-ring protein [Pseudomonas stutzeri DSM 4166]
          Length = 231

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 79/163 (48%), Gaps = 11/163 (6%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ----- 125
           L+ D +A  VGDI+T+ +    QA  +  +  S+++S +  L    SLFG          
Sbjct: 58  LYDDRKAHRVGDIITITLNERTQASKNATSKLSKDSSANIGLG---SLFGGAVSMANPLT 114

Query: 126 ---MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
              MN    Y+    +SG G   ++  L+  I   V+ +L NG L + G + + +N    
Sbjct: 115 GNSMNLGAEYEASRDTSGSGQAGQSNSLSGSITVTVSEVLPNGILAVRGEKWMTLNTGDE 174

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            + + G+VR  D+   N+V   +IA+ARI+Y G G   +  +P
Sbjct: 175 LVRIAGLVRADDISTDNTVPSTRIADARITYSGTGAFADASQP 217


>gi|260866416|ref|YP_003232818.1| putative lateral flagellar protein of basal-body outer-membrane L
           ring [Escherichia coli O111:H- str. 11128]
 gi|257762772|dbj|BAI34267.1| predicted lateral flagellar protein of basal-body outer-membrane L
           ring [Escherichia coli O111:H- str. 11128]
          Length = 246

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 79/152 (51%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++F     +++G 
Sbjct: 82  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPTIFSHTKDKLSGS 138

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 139 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 192

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 193 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 224


>gi|332088745|gb|EGI93857.1| flagellar L-ring family protein [Shigella boydii 5216-82]
          Length = 232

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----TRADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|301029706|ref|ZP_07192760.1| flagellar L-ring protein FlgH [Escherichia coli MS 196-1]
 gi|299877394|gb|EFI85605.1| flagellar L-ring protein FlgH [Escherichia coli MS 196-1]
 gi|332092936|gb|EGI98004.1| flagellar L-ring family protein [Shigella dysenteriae 155-74]
          Length = 217

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 47  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 103

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 104 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 159

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 160 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 217


>gi|312882656|ref|ZP_07742393.1| flagellar basal body L-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309369617|gb|EFP97132.1| flagellar basal body L-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 259

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 83/161 (51%), Gaps = 5/161 (3%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           S ++L+ DS+   +GDI+TV +    +A   +    S+NN+         S+ GQ+    
Sbjct: 91  SASSLYDDSKPRGIGDIITVTLNESTKAAKSSDADLSKNNAASMD---PLSVGGQELSIG 147

Query: 127 NGNLNYD--GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
             N +Y+     + +G  + +++  L+  I   V  +L NGNL+I G + + +N     +
Sbjct: 148 EYNFSYELSNDNSFTGSAAANQSNSLSGSITVEVIEVLANGNLVIRGEKWLTLNTGDEYI 207

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            ++G +R  D+ + N+++ ++I+ ARI Y G G   ++  P
Sbjct: 208 RLSGTIRSDDITSDNTIASNRISNARIQYSGTGNQQDMQEP 248


>gi|239907790|ref|YP_002954531.1| flagellar L-ring protein [Desulfovibrio magneticus RS-1]
 gi|239797656|dbj|BAH76645.1| flagellar L-ring protein [Desulfovibrio magneticus RS-1]
          Length = 241

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 108/260 (41%), Gaps = 41/260 (15%)

Query: 1   MYRYSFIVLCY-SSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R   I L   ++ + GC  +  +    PQM+P  +        P  G  +  S  T  
Sbjct: 1   MRRTPLIPLALIAAAVVGCAPATKQAAPAPQMTPPVAKAPPPADNP--GSIYSQSQPT-- 56

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
                      LF D+RA  +GDILTV+I    ++    +T   R  S    +   FS  
Sbjct: 57  ----------FLFDDTRARRIGDILTVNIVDTSKSDLKAETKNDRTASNELGVQNYFS-- 104

Query: 120 GQQTPQMNGNLNYDGGGASSG---------------------KGSISRAEKLNLLIAAIV 158
                 + GNL+   GG + G                     KG   R   +   I A +
Sbjct: 105 ---NKNVAGNLSGQLGGPNFGMNGLIGSDPIVKTNTAQKFQSKGETKRESAVTASIGARI 161

Query: 159 TAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
             IL  G + + G+++ RVNDE + + + G+VRP D+  +N+V    +A+ +I Y G+G 
Sbjct: 162 VNILPGGVMQVEGARQTRVNDENQIIVIKGLVRPIDIGPNNTVLSTMLADCQIEYYGEGD 221

Query: 219 TTELLRPPIGHQLIENLSPL 238
             +  +     ++++N+ P 
Sbjct: 222 LADRQKSGWLTRILDNVWPF 241


>gi|90021852|ref|YP_527679.1| Hpt sensor hybrid histidine kinase [Saccharophagus degradans 2-40]
 gi|89951452|gb|ABD81467.1| Hpt sensor hybrid histidine kinase [Saccharophagus degradans 2-40]
          Length = 230

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 77/151 (50%), Gaps = 7/151 (4%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           LF D +AL VGDI+TV ++    +   +  G  ++N + +   G  ++FG      N  L
Sbjct: 63  LFSDRKALRVGDIITVVLQERTSSKKSSNIGVKKDNDISQ---GSSTVFGTTPGLGNLGL 119

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILE---NGNLIISGSQEVRVNDEIRSLNVT 187
             D  G    KG  + +++ N L  +I   ++E   NG L I G + + +N     + V+
Sbjct: 120 GLDVQGEREFKGE-ADSDQSNQLTGSITVTVVEVYPNGTLSIRGEKWMTLNRGDEFIRVS 178

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
           G+VRP DV   N+V   KIA A ISY G+G 
Sbjct: 179 GLVRPDDVGPDNTVVSTKIANAHISYSGEGE 209


>gi|209773348|gb|ACI84986.1| flagellar basal body L-ring protein FlgH [Escherichia coli]
 gi|320643091|gb|EFX12292.1| flagellar basal body L-ring protein [Escherichia coli O157:H- str.
           493-89]
 gi|320648549|gb|EFX17204.1| flagellar basal body L-ring protein [Escherichia coli O157:H- str.
           H 2687]
          Length = 232

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSASASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|15801196|ref|NP_287213.1| flagellar basal body L-ring protein [Escherichia coli O157:H7
           EDL933]
 gi|15830711|ref|NP_309484.1| flagellar basal body L-ring protein [Escherichia coli O157:H7 str.
           Sakai]
 gi|16129042|ref|NP_415597.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli str. K-12 substr. MG1655]
 gi|30062615|ref|NP_836786.1| flagellar basal body L-ring protein [Shigella flexneri 2a str.
           2457T]
 gi|56479816|ref|NP_706997.2| flagellar basal body L-ring protein [Shigella flexneri 2a str. 301]
 gi|74311640|ref|YP_310059.1| flagellar basal body L-ring protein [Shigella sonnei Ss046]
 gi|89107925|ref|AP_001705.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli str. K-12 substr. W3110]
 gi|157155075|ref|YP_001462313.1| flagellar basal body L-ring protein [Escherichia coli E24377A]
 gi|157160606|ref|YP_001457924.1| flagellar basal body L-ring protein [Escherichia coli HS]
 gi|168747145|ref|ZP_02772167.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758628|ref|ZP_02783635.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764491|ref|ZP_02789498.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4501]
 gi|168767738|ref|ZP_02792745.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773924|ref|ZP_02798931.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783609|ref|ZP_02808616.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4076]
 gi|168790014|ref|ZP_02815021.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str. EC869]
 gi|168802024|ref|ZP_02827031.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str. EC508]
 gi|170080730|ref|YP_001730050.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli str. K-12 substr. DH10B]
 gi|188495438|ref|ZP_03002708.1| flagellar L-ring protein FlgH [Escherichia coli 53638]
 gi|191172379|ref|ZP_03033920.1| flagellar L-ring protein FlgH [Escherichia coli F11]
 gi|193064518|ref|ZP_03045598.1| flagellar L-ring protein FlgH [Escherichia coli E22]
 gi|193069519|ref|ZP_03050473.1| flagellar L-ring protein FlgH [Escherichia coli E110019]
 gi|194438092|ref|ZP_03070185.1| flagellar L-ring protein FlgH [Escherichia coli 101-1]
 gi|195935469|ref|ZP_03080851.1| flagellar basal body L-ring protein [Escherichia coli O157:H7 str.
           EC4024]
 gi|208807280|ref|ZP_03249617.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816016|ref|ZP_03257195.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4045]
 gi|208822634|ref|ZP_03262953.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4042]
 gi|209398398|ref|YP_002269925.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4115]
 gi|209918333|ref|YP_002292417.1| flagellar basal body L-ring protein [Escherichia coli SE11]
 gi|217328301|ref|ZP_03444383.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           TW14588]
 gi|218553657|ref|YP_002386570.1| flagellar basal body L-ring protein [Escherichia coli IAI1]
 gi|218557961|ref|YP_002390874.1| flagellar basal body L-ring protein [Escherichia coli S88]
 gi|218689032|ref|YP_002397244.1| flagellar basal body L-ring protein [Escherichia coli ED1a]
 gi|218694613|ref|YP_002402280.1| flagellar basal body L-ring protein [Escherichia coli 55989]
 gi|218704487|ref|YP_002412006.1| flagellar basal body L-ring protein [Escherichia coli UMN026]
 gi|238900333|ref|YP_002926129.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli BW2952]
 gi|254161185|ref|YP_003044293.1| flagellar basal body L-ring protein [Escherichia coli B str.
           REL606]
 gi|254792461|ref|YP_003077298.1| flagellar basal body L-ring protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|256018664|ref|ZP_05432529.1| flagellar basal body L-ring protein [Shigella sp. D9]
 gi|256023223|ref|ZP_05437088.1| flagellar basal body L-ring protein [Escherichia sp. 4_1_40B]
 gi|260843319|ref|YP_003221097.1| flagellar protein FlgH of basal-body outer-membrane L ring
           [Escherichia coli O103:H2 str. 12009]
 gi|260854562|ref|YP_003228453.1| flagellar protein FlgH of basal-body outer-membrane L ring
           [Escherichia coli O26:H11 str. 11368]
 gi|260867442|ref|YP_003233844.1| flagellar protein FlgH of basal-body outer-membrane L ring
           [Escherichia coli O111:H- str. 11128]
 gi|261227016|ref|ZP_05941297.1| flagellar L-ring protein [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256250|ref|ZP_05948783.1| flagellar L-ring protein [Escherichia coli O157:H7 str. FRIK966]
 gi|291282099|ref|YP_003498917.1| Flagellar L-ring protein precursor [Escherichia coli O55:H7 str.
           CB9615]
 gi|293404363|ref|ZP_06648357.1| flagellar L-ring protein [Escherichia coli FVEC1412]
 gi|293414372|ref|ZP_06657021.1| flagellar L-ring protein FlgH [Escherichia coli B185]
 gi|293433369|ref|ZP_06661797.1| flagellar L-ring protein FlgH [Escherichia coli B088]
 gi|297516690|ref|ZP_06935076.1| flagellar basal body L-ring protein [Escherichia coli OP50]
 gi|298380143|ref|ZP_06989748.1| flagellar L-ring protein [Escherichia coli FVEC1302]
 gi|307137714|ref|ZP_07497070.1| flagellar basal body L-ring protein [Escherichia coli H736]
 gi|307310143|ref|ZP_07589793.1| flagellar L-ring protein [Escherichia coli W]
 gi|309788148|ref|ZP_07682754.1| flagellar L-ring family protein [Shigella dysenteriae 1617]
 gi|312968847|ref|ZP_07783054.1| flagellar L-ring family protein [Escherichia coli 2362-75]
 gi|312971216|ref|ZP_07785394.1| flagellar L-ring family protein [Escherichia coli 1827-70]
 gi|331657141|ref|ZP_08358103.1| flagellar L-ring protein FlgH [Escherichia coli TA206]
 gi|331667479|ref|ZP_08368343.1| flagellar L-ring protein FlgH [Escherichia coli TA271]
 gi|331682581|ref|ZP_08383200.1| flagellar L-ring protein FlgH [Escherichia coli H299]
 gi|62288091|sp|P0A6S0|FLGH_ECOLI RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|62288092|sp|P0A6S1|FLGH_ECO57 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|62288093|sp|P0A6S2|FLGH_SHIFL RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|110816543|sp|Q3Z338|FLGH_SHISS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|166988327|sp|A7ZKI4|FLGH_ECO24 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|166988328|sp|A7ZZ37|FLGH_ECOHS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701918|sp|B7MJ67|FLGH_ECO45 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701919|sp|B5YVU9|FLGH_ECO5E RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701921|sp|B7M955|FLGH_ECO8A RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701922|sp|B1X9J2|FLGH_ECODH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701923|sp|B6I9F5|FLGH_ECOSE RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789281|sp|B7LG13|FLGH_ECO55 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789282|sp|B7MTL0|FLGH_ECO81 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|259645994|sp|C4ZS19|FLGH_ECOBW RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|12514620|gb|AAG55825.1|AE005318_2 flagellar biosynthesis, basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein [Escherichia
           coli O157:H7 str. EDL933]
 gi|1787319|gb|AAC74163.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli str. K-12 substr. MG1655]
 gi|13360921|dbj|BAB34880.1| flagellar basal body L-ring protein FlgH [Escherichia coli O157:H7
           str. Sakai]
 gi|30040861|gb|AAP16592.1| flagellar basal body L-ring protein FlgH [Shigella flexneri 2a str.
           2457T]
 gi|56383367|gb|AAN42704.2| flagellar basal body L-ring protein FlgH [Shigella flexneri 2a str.
           301]
 gi|73855117|gb|AAZ87824.1| flagellar protein for basal-body outer-membrane L ring [Shigella
           sonnei Ss046]
 gi|85674831|dbj|BAA35888.2| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli str. K12 substr. W3110]
 gi|157066286|gb|ABV05541.1| flagellar L-ring protein FlgH [Escherichia coli HS]
 gi|157077105|gb|ABV16813.1| flagellar L-ring protein FlgH [Escherichia coli E24377A]
 gi|169888565|gb|ACB02272.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli str. K-12 substr. DH10B]
 gi|187770494|gb|EDU34338.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4196]
 gi|188018204|gb|EDU56326.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4113]
 gi|188490637|gb|EDU65740.1| flagellar L-ring protein FlgH [Escherichia coli 53638]
 gi|188999115|gb|EDU68101.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354588|gb|EDU73007.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4401]
 gi|189363176|gb|EDU81595.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365530|gb|EDU83946.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370490|gb|EDU88906.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str. EC869]
 gi|189375945|gb|EDU94361.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str. EC508]
 gi|190907263|gb|EDV66861.1| flagellar L-ring protein FlgH [Escherichia coli F11]
 gi|192927770|gb|EDV82384.1| flagellar L-ring protein FlgH [Escherichia coli E22]
 gi|192957267|gb|EDV87716.1| flagellar L-ring protein FlgH [Escherichia coli E110019]
 gi|194423028|gb|EDX39022.1| flagellar L-ring protein FlgH [Escherichia coli 101-1]
 gi|208727081|gb|EDZ76682.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4206]
 gi|208732664|gb|EDZ81352.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4045]
 gi|208738119|gb|EDZ85802.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4042]
 gi|209159798|gb|ACI37231.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC4115]
 gi|209773350|gb|ACI84987.1| flagellar basal body L-ring protein FlgH [Escherichia coli]
 gi|209773352|gb|ACI84988.1| flagellar basal body L-ring protein FlgH [Escherichia coli]
 gi|209773354|gb|ACI84989.1| flagellar basal body L-ring protein FlgH [Escherichia coli]
 gi|209773356|gb|ACI84990.1| flagellar basal body L-ring protein FlgH [Escherichia coli]
 gi|209911592|dbj|BAG76666.1| flagellar basal-body L-ring protein FlgH [Escherichia coli SE11]
 gi|217318728|gb|EEC27154.1| flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           TW14588]
 gi|218351345|emb|CAU97051.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli 55989]
 gi|218360425|emb|CAQ97979.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli IAI1]
 gi|218364730|emb|CAR02420.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli S88]
 gi|218426596|emb|CAR07424.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli ED1a]
 gi|218431584|emb|CAR12463.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli UMN026]
 gi|222032832|emb|CAP75571.1| flagellar L-ring protein [Escherichia coli LF82]
 gi|238861116|gb|ACR63114.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli BW2952]
 gi|242376883|emb|CAQ31600.1| flagellar L-ring protein FlgH; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein, subunit of
           Flagellar Motor Complex and Flagellum [Escherichia coli
           BL21(DE3)]
 gi|253973086|gb|ACT38757.1| flagellar L-ring protein precursor H [Escherichia coli B str.
           REL606]
 gi|253977300|gb|ACT42970.1| flagellar L-ring protein precursor H [Escherichia coli BL21(DE3)]
 gi|254591861|gb|ACT71222.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli O157:H7 str. TW14359]
 gi|257753211|dbj|BAI24713.1| flagellar protein FlgH of basal-body outer-membrane L ring
           [Escherichia coli O26:H11 str. 11368]
 gi|257758466|dbj|BAI29963.1| flagellar protein FlgH of basal-body outer-membrane L ring
           [Escherichia coli O103:H2 str. 12009]
 gi|257763798|dbj|BAI35293.1| flagellar protein FlgH of basal-body outer-membrane L ring
           [Escherichia coli O111:H- str. 11128]
 gi|290761972|gb|ADD55933.1| Flagellar L-ring protein precursor [Escherichia coli O55:H7 str.
           CB9615]
 gi|291324188|gb|EFE63610.1| flagellar L-ring protein FlgH [Escherichia coli B088]
 gi|291428949|gb|EFF01974.1| flagellar L-ring protein [Escherichia coli FVEC1412]
 gi|291434430|gb|EFF07403.1| flagellar L-ring protein FlgH [Escherichia coli B185]
 gi|294491179|gb|ADE89935.1| flagellar L-ring protein FlgH [Escherichia coli IHE3034]
 gi|298279841|gb|EFI21349.1| flagellar L-ring protein [Escherichia coli FVEC1302]
 gi|306909861|gb|EFN40355.1| flagellar L-ring protein [Escherichia coli W]
 gi|307627451|gb|ADN71755.1| flagellar basal body L-ring protein [Escherichia coli UM146]
 gi|308924000|gb|EFP69501.1| flagellar L-ring family protein [Shigella dysenteriae 1617]
 gi|309701351|emb|CBJ00652.1| flagellar L-ring protein [Escherichia coli ETEC H10407]
 gi|310336418|gb|EFQ01604.1| flagellar L-ring family protein [Escherichia coli 1827-70]
 gi|312286249|gb|EFR14162.1| flagellar L-ring family protein [Escherichia coli 2362-75]
 gi|312945641|gb|ADR26468.1| flagellar basal body L-ring protein [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|313650469|gb|EFS14876.1| flagellar L-ring family protein [Shigella flexneri 2a str. 2457T]
 gi|315135711|dbj|BAJ42870.1| flagellar basal body L-ring protein [Escherichia coli DH1]
 gi|315618249|gb|EFU98839.1| flagellar L-ring family protein [Escherichia coli 3431]
 gi|320189762|gb|EFW64418.1| Flagellar L-ring protein FlgH [Escherichia coli O157:H7 str.
           EC1212]
 gi|320196439|gb|EFW71062.1| Flagellar L-ring protein FlgH [Escherichia coli WV_060327]
 gi|320200975|gb|EFW75559.1| Flagellar L-ring protein FlgH [Escherichia coli EC4100B]
 gi|320637530|gb|EFX07330.1| flagellar basal body L-ring protein [Escherichia coli O157:H7 str.
           G5101]
 gi|320653863|gb|EFX21937.1| flagellar basal body L-ring protein [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659343|gb|EFX26912.1| flagellar basal body L-ring protein [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664478|gb|EFX31629.1| flagellar basal body L-ring protein [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323156886|gb|EFZ43020.1| flagellar L-ring family protein [Escherichia coli EPECa14]
 gi|323163704|gb|EFZ49524.1| flagellar L-ring family protein [Escherichia coli E128010]
 gi|323165589|gb|EFZ51376.1| flagellar L-ring family protein [Shigella sonnei 53G]
 gi|323175234|gb|EFZ60847.1| flagellar L-ring family protein [Escherichia coli LT-68]
 gi|323175690|gb|EFZ61284.1| flagellar L-ring family protein [Escherichia coli 1180]
 gi|323185798|gb|EFZ71159.1| flagellar L-ring family protein [Escherichia coli 1357]
 gi|323190591|gb|EFZ75863.1| flagellar L-ring family protein [Escherichia coli RN587/1]
 gi|323379082|gb|ADX51350.1| flagellar L-ring protein [Escherichia coli KO11]
 gi|323937819|gb|EGB34083.1| flagellar L-ring protein [Escherichia coli E1520]
 gi|323942548|gb|EGB38715.1| flagellar L-ring protein [Escherichia coli E482]
 gi|323947619|gb|EGB43623.1| flagellar L-ring protein [Escherichia coli H120]
 gi|323953235|gb|EGB49101.1| flagellar L-ring protein [Escherichia coli H252]
 gi|323957903|gb|EGB53615.1| flagellar L-ring protein [Escherichia coli H263]
 gi|323962678|gb|EGB58256.1| flagellar L-ring protein [Escherichia coli H489]
 gi|323967020|gb|EGB62446.1| flagellar L-ring protein [Escherichia coli M863]
 gi|323973332|gb|EGB68521.1| flagellar L-ring protein [Escherichia coli TA007]
 gi|323976548|gb|EGB71636.1| flagellar L-ring protein [Escherichia coli TW10509]
 gi|324117350|gb|EGC11257.1| flagellar L-ring protein [Escherichia coli E1167]
 gi|326339301|gb|EGD63115.1| Flagellar L-ring protein FlgH [Escherichia coli O157:H7 str. 1125]
 gi|326344738|gb|EGD68486.1| Flagellar L-ring protein FlgH [Escherichia coli O157:H7 str. 1044]
 gi|327253478|gb|EGE65116.1| flagellar L-ring family protein [Escherichia coli STEC_7v]
 gi|331055389|gb|EGI27398.1| flagellar L-ring protein FlgH [Escherichia coli TA206]
 gi|331065064|gb|EGI36959.1| flagellar L-ring protein FlgH [Escherichia coli TA271]
 gi|331080212|gb|EGI51391.1| flagellar L-ring protein FlgH [Escherichia coli H299]
 gi|332342625|gb|AEE55959.1| flagellar L-ring family protein FlgH [Escherichia coli UMNK88]
 gi|332758239|gb|EGJ88562.1| flagellar L-ring family protein [Shigella flexneri 4343-70]
 gi|332759652|gb|EGJ89957.1| flagellar L-ring family protein [Shigella flexneri 2747-71]
 gi|332761425|gb|EGJ91709.1| flagellar L-ring family protein [Shigella flexneri K-671]
 gi|332767687|gb|EGJ97880.1| flagellar L-ring protein [Shigella flexneri 2930-71]
 gi|333004889|gb|EGK24409.1| flagellar L-ring family protein [Shigella flexneri VA-6]
 gi|333005370|gb|EGK24888.1| flagellar L-ring family protein [Shigella flexneri K-218]
 gi|333019475|gb|EGK38758.1| flagellar L-ring family protein [Shigella flexneri K-304]
          Length = 232

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|124268251|ref|YP_001022255.1| flagellar basal-body L-ring protein [Methylibium petroleiphilum
           PM1]
 gi|124261026|gb|ABM96020.1| flagellar basal-body L-ring protein [Methylibium petroleiphilum
           PM1]
          Length = 224

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 91/210 (43%), Gaps = 20/210 (9%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
           LLFGC +          M+P     D +  +P   +    +            S+  LF+
Sbjct: 16  LLFGCQA----------MAPKVDIADTSPVLPQAVV----APPVNNGAIFQGASYRPLFE 61

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYD 133
           D RA  VGD +TV I     A   + +   +N S++  +S     F    P      +  
Sbjct: 62  DHRARLVGDTITVQIVEKVAASQQSTSSIDKNGSVNGSISA-LPFFA---PNSFKRASAT 117

Query: 134 GGG--ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVR 191
           G    A  GKG+ + A   +  I A V  +L NG+L+ISG +++ VN  +  L  +G V 
Sbjct: 118 GSNEQAFEGKGTTASANTFSGTITATVINVLPNGHLVISGEKQIGVNQHVDVLRFSGQVD 177

Query: 192 PQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           P+ +   NSV+  +IA  RI   G+G   E
Sbjct: 178 PRAIQPGNSVASAQIANVRIEQRGRGAQAE 207


>gi|293409445|ref|ZP_06653021.1| flagellar L-ring protein FlgH [Escherichia coli B354]
 gi|291469913|gb|EFF12397.1| flagellar L-ring protein FlgH [Escherichia coli B354]
          Length = 232

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|289549016|ref|YP_003474004.1| flagellar L-ring protein [Thermocrinis albus DSM 14484]
 gi|289182633|gb|ADC89877.1| flagellar L-ring protein [Thermocrinis albus DSM 14484]
          Length = 223

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 87/177 (49%), Gaps = 10/177 (5%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGFSLFGQQT 123
           +   +L+ D++A  VGD++ V +     AV    NQT RS          G  SLFG   
Sbjct: 53  EGFVSLYSDTKARRVGDVIYVLLVESLNAVESVANQTSRSATFK-----EGVASLFGISK 107

Query: 124 PQMNGNLNYDGGGASSGKGS--ISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
             ++  L+  GGG  S KGS    ++  ++  +A  V  +  NG+++I   +    N+  
Sbjct: 108 DVLD-QLSAQGGGQMSTKGSGKFQQSAVISTRMAGRVMKVYPNGSMLIEAKKNFYWNNVS 166

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           R + + G+VR +D+DA N+VS DKIA   +   G+G T +   P    +L+  + P 
Sbjct: 167 REMVLRGVVRGEDIDATNTVSSDKIANLEVIVEGRGFTVDGGNPGWLARLLAKVLPF 223


>gi|194432358|ref|ZP_03064645.1| flagellar L-ring protein FlgH [Shigella dysenteriae 1012]
 gi|194419245|gb|EDX35327.1| flagellar L-ring protein FlgH [Shigella dysenteriae 1012]
          Length = 219

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 49  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 105

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 106 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 161

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 162 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 219


>gi|331672599|ref|ZP_08373388.1| flagellar L-ring protein FlgH [Escherichia coli TA280]
 gi|331070242|gb|EGI41608.1| flagellar L-ring protein FlgH [Escherichia coli TA280]
          Length = 235

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 122 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|300938644|ref|ZP_07153373.1| flagellar L-ring protein FlgH [Escherichia coli MS 21-1]
 gi|300456429|gb|EFK19922.1| flagellar L-ring protein FlgH [Escherichia coli MS 21-1]
          Length = 235

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKSNFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 122 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|307546965|ref|YP_003899444.1| flagellar basal body L-ring protein [Halomonas elongata DSM 2581]
 gi|307218989|emb|CBV44259.1| flagellar basal body L-ring protein [Halomonas elongata DSM 2581]
          Length = 241

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 76/182 (41%), Gaps = 25/182 (13%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ-- 125
           +  LF+D R   VGD+LT+        V D Q   S+N   +   +G  SL   Q P   
Sbjct: 74  YQPLFEDRRPRQVGDVLTI--------VLDEQVSASKNARSNADRNGSASLAFDQLPDAL 125

Query: 126 ---------MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
                    + G  ++ GGG +    S +        I   V  +L NGNL + G +++ 
Sbjct: 126 DTLAEYGFDIEGESDFAGGGGAQANNSFTGT------ITVSVIEVLNNGNLRVRGEKQIA 179

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLS 236
           +N     +   G+V P+ +   N+V    +A+ARI Y G G   E        +   N+S
Sbjct: 180 INQGTEFIRFGGVVNPRSITGKNTVPSTSVADARIEYVGDGYINEAQHMGWLQRFFLNIS 239

Query: 237 PL 238
           P 
Sbjct: 240 PF 241


>gi|237799212|ref|ZP_04587673.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022067|gb|EGI02124.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 237

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 83/178 (46%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D +A  VGDI+T+ +  R+       +   ++ NNS+     G  SLFG      N 
Sbjct: 64  LYGDRKAFRVGDIITITLSERMAASKAATSAMSKNSNNSI-----GLTSLFGSGLTTNNP 118

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N  Y+G   + G G  +++  L   +   V  +L NG L + G + + +N  
Sbjct: 119 IGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILSVRGEKWMTLNTG 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G++R  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 179 DELVRIAGLIRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 234


>gi|261856357|ref|YP_003263640.1| flagellar L-ring protein [Halothiobacillus neapolitanus c2]
 gi|261836826|gb|ACX96593.1| flagellar L-ring protein [Halothiobacillus neapolitanus c2]
          Length = 230

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 72/154 (46%), Gaps = 16/154 (10%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS--LHRKLSGGFSL-----FGQQT 123
           +F DSR   VGDILTV ++          TG S+ +S  +     GG S      FG   
Sbjct: 64  MFVDSRPYRVGDILTVVLQESMNGSKSATTGTSKADSVAITPPAIGGLSANLMNRFGASI 123

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
              N            G G+ ++   L   I+  V  +  NG+L + G + + +N     
Sbjct: 124 STAN---------QFKGDGTSAQTNSLRGQISVTVARVYANGSLFVQGQKYIGINQGTEY 174

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           + ++G+VRPQD+   N+V   +IA+A ISYGG G
Sbjct: 175 VRLSGLVRPQDIATDNTVLSTRIADAHISYGGTG 208


>gi|91210231|ref|YP_540217.1| flagellar basal body L-ring protein [Escherichia coli UTI89]
 gi|91071805|gb|ABE06686.1| flagellar basal body L-ring protein precursor [Escherichia coli
           UTI89]
          Length = 237

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 67  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 123

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 124 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 179

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 180 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 237


>gi|331646337|ref|ZP_08347440.1| flagellar L-ring protein FlgH [Escherichia coli M605]
 gi|331045089|gb|EGI17216.1| flagellar L-ring protein FlgH [Escherichia coli M605]
          Length = 235

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 122 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|281178188|dbj|BAI54518.1| flagellar basal-body L-ring protein FlgH [Escherichia coli SE15]
 gi|330910893|gb|EGH39403.1| flagellar L-ring protein FlgH [Escherichia coli AA86]
          Length = 232

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|110641255|ref|YP_668985.1| flagellar basal body L-ring protein [Escherichia coli 536]
 gi|110805096|ref|YP_688616.1| flagellar basal body L-ring protein [Shigella flexneri 5 str. 8401]
 gi|117623265|ref|YP_852178.1| flagellar basal body L-ring protein [Escherichia coli APEC O1]
 gi|170020525|ref|YP_001725479.1| flagellar basal body L-ring protein [Escherichia coli ATCC 8739]
 gi|237706935|ref|ZP_04537416.1| flagellar basal body L-ring protein [Escherichia sp. 3_2_53FAA]
 gi|253773897|ref|YP_003036728.1| flagellar basal body L-ring protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|300821140|ref|ZP_07101289.1| flagellar L-ring protein FlgH [Escherichia coli MS 119-7]
 gi|300899598|ref|ZP_07117837.1| flagellar L-ring protein FlgH [Escherichia coli MS 198-1]
 gi|300902470|ref|ZP_07120452.1| flagellar L-ring protein FlgH [Escherichia coli MS 84-1]
 gi|300918681|ref|ZP_07135262.1| flagellar L-ring protein FlgH [Escherichia coli MS 115-1]
 gi|300922605|ref|ZP_07138705.1| flagellar L-ring protein FlgH [Escherichia coli MS 182-1]
 gi|300928369|ref|ZP_07143903.1| flagellar L-ring protein FlgH [Escherichia coli MS 187-1]
 gi|300950174|ref|ZP_07164119.1| flagellar L-ring protein FlgH [Escherichia coli MS 116-1]
 gi|300954381|ref|ZP_07166835.1| flagellar L-ring protein FlgH [Escherichia coli MS 175-1]
 gi|301023266|ref|ZP_07187063.1| flagellar L-ring protein FlgH [Escherichia coli MS 69-1]
 gi|301304982|ref|ZP_07211084.1| flagellar L-ring protein FlgH [Escherichia coli MS 124-1]
 gi|301328551|ref|ZP_07221612.1| flagellar L-ring protein FlgH [Escherichia coli MS 78-1]
 gi|301644991|ref|ZP_07244957.1| flagellar L-ring protein FlgH [Escherichia coli MS 146-1]
 gi|331641623|ref|ZP_08342758.1| flagellar L-ring protein FlgH [Escherichia coli H736]
 gi|331652132|ref|ZP_08353151.1| flagellar L-ring protein FlgH [Escherichia coli M718]
 gi|331676870|ref|ZP_08377566.1| flagellar L-ring protein FlgH [Escherichia coli H591]
 gi|332279733|ref|ZP_08392146.1| flagellar basal body L-ring protein [Shigella sp. D9]
 gi|110342847|gb|ABG69084.1| flagellar L-ring protein precursor [Escherichia coli 536]
 gi|110614644|gb|ABF03311.1| flagellar L-ring protein precursor FlgH [Shigella flexneri 5 str.
           8401]
 gi|115512389|gb|ABJ00464.1| flagellar basal body L-ring protein precursor [Escherichia coli
           APEC O1]
 gi|169755453|gb|ACA78152.1| flagellar L-ring protein [Escherichia coli ATCC 8739]
 gi|226898145|gb|EEH84404.1| flagellar basal body L-ring protein [Escherichia sp. 3_2_53FAA]
 gi|253324941|gb|ACT29543.1| flagellar L-ring protein [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|260449781|gb|ACX40203.1| flagellar L-ring protein [Escherichia coli DH1]
 gi|281600497|gb|ADA73481.1| Flagellar L-ring protein precursor [Shigella flexneri 2002017]
 gi|300318617|gb|EFJ68401.1| flagellar L-ring protein FlgH [Escherichia coli MS 175-1]
 gi|300356869|gb|EFJ72739.1| flagellar L-ring protein FlgH [Escherichia coli MS 198-1]
 gi|300397111|gb|EFJ80649.1| flagellar L-ring protein FlgH [Escherichia coli MS 69-1]
 gi|300405502|gb|EFJ89040.1| flagellar L-ring protein FlgH [Escherichia coli MS 84-1]
 gi|300414175|gb|EFJ97485.1| flagellar L-ring protein FlgH [Escherichia coli MS 115-1]
 gi|300421082|gb|EFK04393.1| flagellar L-ring protein FlgH [Escherichia coli MS 182-1]
 gi|300450521|gb|EFK14141.1| flagellar L-ring protein FlgH [Escherichia coli MS 116-1]
 gi|300463627|gb|EFK27120.1| flagellar L-ring protein FlgH [Escherichia coli MS 187-1]
 gi|300526439|gb|EFK47508.1| flagellar L-ring protein FlgH [Escherichia coli MS 119-7]
 gi|300839700|gb|EFK67460.1| flagellar L-ring protein FlgH [Escherichia coli MS 124-1]
 gi|300844943|gb|EFK72703.1| flagellar L-ring protein FlgH [Escherichia coli MS 78-1]
 gi|301076720|gb|EFK91526.1| flagellar L-ring protein FlgH [Escherichia coli MS 146-1]
 gi|315060357|gb|ADT74684.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli W]
 gi|315253880|gb|EFU33848.1| flagellar L-ring protein FlgH [Escherichia coli MS 85-1]
 gi|315296710|gb|EFU56005.1| flagellar L-ring protein FlgH [Escherichia coli MS 16-3]
 gi|324007919|gb|EGB77138.1| flagellar L-ring protein FlgH [Escherichia coli MS 57-2]
 gi|324017417|gb|EGB86636.1| flagellar L-ring protein FlgH [Escherichia coli MS 117-3]
 gi|331038421|gb|EGI10641.1| flagellar L-ring protein FlgH [Escherichia coli H736]
 gi|331050410|gb|EGI22468.1| flagellar L-ring protein FlgH [Escherichia coli M718]
 gi|331075559|gb|EGI46857.1| flagellar L-ring protein FlgH [Escherichia coli H591]
 gi|332102085|gb|EGJ05431.1| flagellar basal body L-ring protein [Shigella sp. D9]
          Length = 235

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 122 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|170681726|ref|YP_001744101.1| flagellar basal body L-ring protein [Escherichia coli SMS-3-5]
 gi|331662485|ref|ZP_08363408.1| flagellar L-ring protein FlgH [Escherichia coli TA143]
 gi|170519444|gb|ACB17622.1| flagellar L-ring protein FlgH [Escherichia coli SMS-3-5]
 gi|331060907|gb|EGI32871.1| flagellar L-ring protein FlgH [Escherichia coli TA143]
          Length = 232

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKSNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|82777308|ref|YP_403657.1| flagellar basal body L-ring protein [Shigella dysenteriae Sd197]
 gi|110816542|sp|Q32ET9|FLGH_SHIDS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|81241456|gb|ABB62166.1| basal-body outer-membrane L ring protein [Shigella dysenteriae
           Sd197]
          Length = 232

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|238788318|ref|ZP_04632112.1| Flagellar L-ring protein [Yersinia frederiksenii ATCC 33641]
 gi|238723564|gb|EEQ15210.1| Flagellar L-ring protein [Yersinia frederiksenii ATCC 33641]
          Length = 238

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 76/170 (44%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  LF+D R  NVGD LT+ ++ +  A   +    SRN S    ++              
Sbjct: 68  YQPLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRYLEGLLGNAR 127

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            +++  G     GKG  +     N  I   V  +L NGNL + G +++ +N     +  +
Sbjct: 128 ADMDISGDNTFGGKGGANANNTFNGTITVTVNQVLANGNLHVVGEKQIAINQGTEFIRFS 187

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 188 GVVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNISP 237


>gi|207091665|ref|ZP_03239452.1| flagellar basal body L-ring protein [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 152

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 62/109 (56%), Gaps = 6/109 (5%)

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           N N+ GGG      S  ++E L ++++A +  +LENGN  I G++EV V+ E + L V+G
Sbjct: 49  NTNFKGGG------SQKKSEDLEIVLSARIIKVLENGNYFIYGNKEVLVDGEKQILKVSG 102

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           ++RP D++ +N++    +A+A+I Y   G  ++  +       +E   P
Sbjct: 103 VIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNKKKFAADAMETQMP 151


>gi|88813657|ref|ZP_01128886.1| Flagellar L-ring protein [Nitrococcus mobilis Nb-231]
 gi|88789075|gb|EAR20213.1| Flagellar L-ring protein [Nitrococcus mobilis Nb-231]
          Length = 221

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 75/149 (50%), Gaps = 5/149 (3%)

Query: 71  LFKDSRALNVGDILTV--DIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L++D  A  VGD +TV  D + D     + Q GR  + +L      G  L    TP    
Sbjct: 54  LYEDRTARRVGDTVTVTLDEQTDASKDANAQIGRQYSYALPTPTLMGKQLVYNGTPV--- 110

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           + + D      G GS +++  L+ ++ A +  +  NGN++I G + + +N     + ++G
Sbjct: 111 SFDIDSEQDFQGGGSATQSNALSGVLTATIVRVKPNGNMVIQGQKRLTLNRGDEYVTLSG 170

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            VRP D+   N+VS  ++A ARISY G G
Sbjct: 171 EVRPYDIGPGNTVSSSRVANARISYTGDG 199


>gi|218700418|ref|YP_002408047.1| flagellar basal body L-ring protein [Escherichia coli IAI39]
 gi|226701920|sp|B7NL55|FLGH_ECO7I RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|218370404|emb|CAR18211.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli IAI39]
          Length = 232

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|283834452|ref|ZP_06354193.1| flagellar L-ring protein FlgH [Citrobacter youngae ATCC 29220]
 gi|291069999|gb|EFE08108.1| flagellar L-ring protein FlgH [Citrobacter youngae ATCC 29220]
          Length = 248

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 79/152 (51%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQ----TPQ 125
           +L  D RA  VGDILTV +    Q+    +T   +NN++     G  +LFG      +  
Sbjct: 84  SLTADRRAYRVGDILTVMLEESTQSSKQAKTNFGKNNTVD---IGAPTLFGHTKDNLSAS 140

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           ++ N +++G   S  + S+ R E     I   V ++  NG L I G + + +N     + 
Sbjct: 141 VDANRDFNGTATSQQQNSL-RGE-----ITVSVHSVQSNGILEIRGEKWLTLNQGDEYIR 194

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 195 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 226


>gi|288549492|ref|ZP_05967237.2| flagellar L-ring protein FlgH [Enterobacter cancerogenus ATCC
           35316]
 gi|288318180|gb|EFC57118.1| flagellar L-ring protein FlgH [Enterobacter cancerogenus ATCC
           35316]
          Length = 235

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 65  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 121

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 122 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 TEFIRFSGVVNPRTISGTNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|225850283|ref|YP_002730517.1| flagellar L-ring protein FlgH [Persephonella marina EX-H1]
 gi|225645874|gb|ACO04060.1| flagellar L-ring protein FlgH [Persephonella marina EX-H1]
          Length = 151

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 65/124 (52%), Gaps = 2/124 (1%)

Query: 117 SLFGQQTPQMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
           ++ G+QTP  +       G  ++  G G   R  KL   I+A V  +  NGNL I G + 
Sbjct: 28  TIMGKQTPNKSPIAGLKAGSKNNFKGTGKTDRKAKLIATISARVVKVYPNGNLFIVGKKI 87

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
           V++N++ + L ++GIV+P  ++  NSV  D+I++  + Y GKG   +  +P    + +  
Sbjct: 88  VKINEDEQILKISGIVKPTYIEQDNSVLSDRISDMYVEYNGKGFIADNQKPGWLSRFLVK 147

Query: 235 LSPL 238
           + P 
Sbjct: 148 IWPF 151


>gi|213613178|ref|ZP_03371004.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
          Length = 216

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 79/161 (49%), Gaps = 14/161 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M  +    GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 NSRADMEAS----GGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
              +  +G+V P+ +   NSV   ++A+ARI Y G G   E
Sbjct: 175 TEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINE 215


>gi|327478812|gb|AEA82122.1| flagellar basal body L-ring protein [Pseudomonas stutzeri DSM 4166]
          Length = 222

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 81/159 (50%), Gaps = 12/159 (7%)

Query: 63  LWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF---SL 118
           L+R  +  +L  D RA+ VGDILT  I +D+      Q+ +S   S  ++ S G    ++
Sbjct: 50  LFRSGYGGSLVSDKRAVRVGDILT--IVLDES----TQSSKSAGTSFGKQSSIGVGVPTV 103

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
            G+  P +    + +   + S K S  +   L   IA  V  +L NG L++ G + +R+N
Sbjct: 104 LGKTYPDVETAASAERDFSGSAKSS--QQNTLRGSIAVTVHRVLPNGTLLVKGEKALRLN 161

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
                + + G+VR  D++  N VS   +A ARISY G+G
Sbjct: 162 QGDEYIRLAGLVRMDDINRFNQVSSQNVANARISYAGRG 200


>gi|271500069|ref|YP_003333094.1| flagellar L-ring protein [Dickeya dadantii Ech586]
 gi|270343624|gb|ACZ76389.1| flagellar L-ring protein [Dickeya dadantii Ech586]
          Length = 239

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 77/171 (45%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  +F+D R  NVGD LT+ ++ +  A  ++    SR+ S    ++    L         
Sbjct: 69  YQPMFEDRRPRNVGDTLTIVLQENVSASKNSSANASRDASSSFGMTTTPRLLEGPLGNNR 128

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
             L+  G  A +GKG  +        I   V  +L NGNL + G +++ VN     +  +
Sbjct: 129 AALDATGKDAFTGKGGANANNTFTGTITVTVDQVLTNGNLHVVGEKQIAVNQGTEFIRFS 188

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           G+V P+ +   N+V   ++A+AR+ Y G G   E        +   N+SP 
Sbjct: 189 GVVNPRTISGSNTVPSTQVADARMEYVGNGYINETQTMGWLQRFFLNVSPF 239


>gi|323178491|gb|EFZ64069.1| flagellar L-ring family protein [Escherichia coli 1180]
          Length = 221

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 79/152 (51%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++F     +++G 
Sbjct: 57  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPTIFSHTKDKLSGS 113

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 114 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 167

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 168 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 199


>gi|327254557|gb|EGE66173.1| flagellar L-ring family protein [Escherichia coli STEC_7v]
          Length = 221

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 78/152 (51%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++NS+        ++FG     ++G 
Sbjct: 57  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNSVDITAP---TVFGHTKNNLSGS 113

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 114 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 167

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 168 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 199


>gi|292487942|ref|YP_003530817.1| flagellar L-ring protein [Erwinia amylovora CFBP1430]
 gi|292899161|ref|YP_003538530.1| flagellar L-ring protein [Erwinia amylovora ATCC 49946]
 gi|291199009|emb|CBJ46120.1| flagellar L-ring protein [Erwinia amylovora ATCC 49946]
 gi|291553364|emb|CBA20409.1| Flagellar L-ring protein precursor [Erwinia amylovora CFBP1430]
 gi|312172063|emb|CBX80320.1| Flagellar L-ring protein precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 233

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 77/179 (43%), Gaps = 16/179 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM- 126
           +  LF+D R  N+GD LT+ ++ +  A   +     R+ S    L+         TP+  
Sbjct: 63  YQPLFEDRRPRNIGDTLTITLQENVSASKSSSANAGRDGSAEFGLTA--------TPRAL 114

Query: 127 -------NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                    NL   G     GKG  +        I   V  +L NGNL + G +++ +N 
Sbjct: 115 VGLLGGDKANLGGSGKNDFEGKGGATAKNTFTGTITVTVNQVLPNGNLNVVGEKQIEINQ 174

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               +  +G+V P+ + A NSV   ++A+ARI Y G G   E        +   N+SP+
Sbjct: 175 GTEFIRFSGVVNPRTISASNSVVSSQVADARIEYVGNGYINEAQTMGWLQRFFLNISPM 233


>gi|254508442|ref|ZP_05120562.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus 16]
 gi|219548652|gb|EED25657.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus 16]
          Length = 260

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 84/165 (50%), Gaps = 12/165 (7%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS--LFGQQTP 124
           S ++L+ DS+   VGDI+TV   +D++     +  +S N  + +K          G Q  
Sbjct: 91  STSSLYDDSKPRGVGDIITV--TLDEKT----KAAKSANADMSKKNDSSMEPLFVGGQEL 144

Query: 125 QMNGNLNY----DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
           ++ G+ N+    +     +G  S +++  L+  I   V  +L NGNL+I G + + +N  
Sbjct: 145 KVGGDYNFSYDLNNTNTFAGDASANQSNSLSGSITVEVIEVLGNGNLVIRGEKWLTLNTG 204

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
              + ++G +RP D+   N+++ ++++ ARI Y G G   ++  P
Sbjct: 205 DEYIRLSGTIRPDDISFDNTIASNRVSNARIQYSGTGTQQDMQEP 249


>gi|86146152|ref|ZP_01064478.1| flagellar L-ring protein precursor [Vibrio sp. MED222]
 gi|85836099|gb|EAQ54231.1| flagellar L-ring protein precursor [Vibrio sp. MED222]
          Length = 258

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 89/170 (52%), Gaps = 12/170 (7%)

Query: 62  SLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN--SLHRKLSGGFSL 118
           SL+  +H  +++ DS+   +GDI+TV +  + +A        S++N  S+     GG +L
Sbjct: 84  SLFNANHIGSMYDDSKPRGIGDIITVALDENTRATKKANADMSKSNDASMEPLAVGGENL 143

Query: 119 -FGQQTPQMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
             G+       N +YD    ++  G  S +++  ++  I   V  +L NGNL++ G + +
Sbjct: 144 ELGKY------NFSYDLSNTNTFAGDASANQSNSISGYITVEVIEVLANGNLVVRGEKWM 197

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            +N     + ++G +RP D+D  N+++ ++++ ARI Y G G   ++  P
Sbjct: 198 TLNTGDEYIRLSGTIRPDDIDFENTIASNRVSNARIQYSGTGVQKDMQEP 247


>gi|14548030|sp|P58205|FLGH_RHOSH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|11095161|gb|AAG29750.1|AF205139_2 flagellar L-ring protein [Rhodobacter sphaeroides]
          Length = 222

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 84/175 (48%), Gaps = 11/175 (6%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQ--TGRSRNNSLHRKLSGGFSLFGQQTP 124
           S      D RA  VGDI+TVD        FD +    +S++ S  RK      L    T 
Sbjct: 56  SRGLFVSDRRAARVGDIVTVD--------FDEKFSASKSQSASGSRKSDYAIDLPDALTL 107

Query: 125 QMN-GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
            ++ G L+       SGKG+ S++  L   ++  VT +L  GNL I G + + +N+    
Sbjct: 108 GLDDGVLDNSTDQGFSGKGAASQSNSLRGRMSVSVTRVLPGGNLEIMGQKLLTLNNGNEY 167

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           + + G+VRP+D+   N V+ D+IA A I Y G G T +        + +  +SPL
Sbjct: 168 VRLKGVVRPEDIGPDNVVTSDRIAHAEIKYIGAGDTADTANAGWLRRGLSVVSPL 222


>gi|300716221|ref|YP_003741024.1| flagellar L-ring protein [Erwinia billingiae Eb661]
 gi|299062057|emb|CAX59173.1| Flagellar L-ring protein [Erwinia billingiae Eb661]
          Length = 232

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 78/174 (44%), Gaps = 9/174 (5%)

Query: 68  HAALFKDSRALNVGDILTVDIR--IDDQAVFDNQTGRSRNNSLHRKLSGGFS--LFGQQT 123
           +  LF+D R  N+GD LT+ ++  +          GR  + +L   +    +  L G +T
Sbjct: 63  YQPLFEDRRPRNIGDTLTITLQENVSASKSSTASAGRDGSTTLGLTVPSSLTGLLGGDKT 122

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                N++  G    +GKG  +        I   V  +L NGNL + G +++ +N     
Sbjct: 123 -----NIDASGKNDFAGKGGATANNTFTGTITVTVNQVLPNGNLKVVGEKQIEINQGTEF 177

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP
Sbjct: 178 IRFSGVVNPRTISGSNAVVSTQVADARIEYVGNGYINEAQTMGWLQRFFLNLSP 231


>gi|188534167|ref|YP_001907964.1| flagellar basal body L-ring protein [Erwinia tasmaniensis Et1/99]
 gi|188029209|emb|CAO97081.1| Flagellar L-ring protein [Erwinia tasmaniensis Et1/99]
          Length = 233

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 78/175 (44%), Gaps = 8/175 (4%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG----FSLFGQQT 123
           +  LF+D R  N+GD LT+ ++ +  A   +     R+ S    L+        L G   
Sbjct: 63  YQPLFEDRRPRNIGDTLTITLQENVSASKSSSANAGRDGSAEFGLTATPRALVGLLGGDK 122

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
             + G+   D     SGKG  +        I   V  +L NGNL + G +++ +N     
Sbjct: 123 STLGGSGKND----FSGKGGATANNTFTGTITVTVNQVLPNGNLNVIGEKQIEINQGTEF 178

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +G+V P+ + A NSV   ++A+ARI Y G G   E        +   N+SP+
Sbjct: 179 IRFSGVVNPRTISASNSVVSTQVADARIEYVGNGYINEAQNMGWLQRFFLNISPM 233


>gi|323976266|gb|EGB71359.1| flagellar L-ring protein [Escherichia coli TW10509]
          Length = 221

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 78/152 (51%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++NS+        ++FG     ++G 
Sbjct: 57  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNSVDITAP---TVFGHTKNNLSGS 113

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 114 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 167

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY G+G
Sbjct: 168 LSGLVRADDIQNDNSVSSQRIADARISYAGRG 199


>gi|307293784|ref|ZP_07573628.1| flagellar L-ring protein [Sphingobium chlorophenolicum L-1]
 gi|306879935|gb|EFN11152.1| flagellar L-ring protein [Sphingobium chlorophenolicum L-1]
          Length = 218

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 82/174 (47%), Gaps = 9/174 (5%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS--LHRKLSGGFS-LFGQQTP 124
           +  L   +RA +VGDI+T+ +    QA   N    SR+ S  L    +G  S LF     
Sbjct: 51  YTPLTSGARATSVGDIITIVLVERTQATKSNSADTSRDGSIALTPPSTGPLSKLFSAS-- 108

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
               ++   G  A +GKG+ +++  LN  I   + A   NG +++ G + + +N     +
Sbjct: 109 ----DIGSSGSNAFTGKGAATQSNALNGEITVTIAATYPNGTMLVKGEKALTLNRGDEFI 164

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            ++G+VR  D+   N ++  ++A+A+I Y GKG      R     +    +SP 
Sbjct: 165 QISGLVRQADIGPDNRIASTRVADAKIIYTGKGEIARASRQGWLQRFFSMISPF 218


>gi|294013089|ref|YP_003546549.1| flagellar L-ring protein precursor FlgH [Sphingobium japonicum
           UT26S]
 gi|292676419|dbj|BAI97937.1| flagellar L-ring protein precursor FlgH [Sphingobium japonicum
           UT26S]
          Length = 219

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 80/180 (44%), Gaps = 21/180 (11%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  L   +RA +VGDI+T+ +    QA   N    SR+ S+              TP   
Sbjct: 52  YTPLTSGARATSVGDIITIVLVERTQATKSNSADTSRDGSIA------------LTPPST 99

Query: 128 GNLNY---------DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           G L+           G  A +GKG+ +++  LN  I   + A   NG +++ G + + +N
Sbjct: 100 GPLSKIFSASDIGSSGSNAFTGKGAATQSNALNGEITVTIAATYPNGTMLVKGEKALTLN 159

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
                + ++G+VR  D+   N ++  ++A+A+I Y GKG      R     +    +SP 
Sbjct: 160 RGDEYIQISGLVRQADIGPDNRIASTRVADAKIIYTGKGEIARASRQGWLQRFFSMISPF 219


>gi|283478791|emb|CAY74707.1| Flagellar L-ring protein precursor [Erwinia pyrifoliae DSM 12163]
          Length = 245

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 77/175 (44%), Gaps = 8/175 (4%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG----FSLFGQQT 123
           +  LF+D R  N+GD LT+ ++ +  A   +     R+ S    L+        L G   
Sbjct: 75  YQPLFEDRRPRNIGDTLTITLQENVSASKSSSANAGRDGSAEFGLTATPRALVGLLGGDK 134

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
             + G+   D      GKG  +        I   V  +L NGNL + G +++ +N     
Sbjct: 135 ATLGGSGKND----FEGKGGATAKNTFTGTITVTVNQVLPNGNLNVVGEKQIEINQGTEF 190

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +G+V P+ + A NSV   ++A+ARI Y G G   E        +   N+SP+
Sbjct: 191 IRFSGVVNPRTISASNSVVSSQVADARIEYVGNGYINEAQTMGWLQRFFLNISPM 245


>gi|251789171|ref|YP_003003892.1| flagellar basal body L-ring protein [Dickeya zeae Ech1591]
 gi|247537792|gb|ACT06413.1| flagellar L-ring protein [Dickeya zeae Ech1591]
          Length = 239

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 78/181 (43%), Gaps = 20/181 (11%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH--RKLSGGFSLFGQQTPQ 125
           +  +F+D R  NVGD LT+        V       S+N+S +  R  SG F +    TP+
Sbjct: 69  YQPMFEDRRPRNVGDTLTI--------VLQENVSASKNSSANASRDASGSFGM--TATPR 118

Query: 126 M--------NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           +            N  G    +GKG  +        I   V  +L NGNL + G +++ V
Sbjct: 119 LLEGPLGNNRAAFNATGKDDFTGKGGANANNTFTGTITVTVDQVLTNGNLHVVGEKQIAV 178

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           N     +  +G+V P+ +   N+V   ++A+AR+ Y G G   E        +   N+SP
Sbjct: 179 NQGTEFIRFSGVVNPRTISGSNTVPSTQVADARMEYVGNGYINEAQTMGWLQRFFLNVSP 238

Query: 238 L 238
            
Sbjct: 239 F 239


>gi|227355998|ref|ZP_03840390.1| flagellar L-ring protein precursor [Proteus mirabilis ATCC 29906]
 gi|227163986|gb|EEI48888.1| flagellar L-ring protein precursor [Proteus mirabilis ATCC 29906]
          Length = 247

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 81/179 (45%), Gaps = 16/179 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ-- 125
           +  LF+D R  N+GD LT+ ++ +  A        S+N+S +   +G        TP+  
Sbjct: 77  YQPLFEDRRPRNIGDTLTITLQENVSA--------SKNSSANASRNGKAGFLASITPRFL 128

Query: 126 --MNGN----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             + GN    +  +G     GKG  +        I   V  +L NGNL + G +++ +N 
Sbjct: 129 EGLLGNSRTDMGMEGNSEFGGKGGANANNTFKGTITVTVDQLLANGNLHVVGEKQIAINQ 188

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP 
Sbjct: 189 GTEFIRFSGVVNPRTISGSNTVNSTQVADARIEYIGDGYINEAQSMGWLQRFFLNVSPF 247


>gi|163803172|ref|ZP_02197055.1| flagellar hook protein E [Vibrio sp. AND4]
 gi|159173072|gb|EDP57905.1| flagellar hook protein E [Vibrio sp. AND4]
          Length = 229

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 53/158 (33%), Positives = 80/158 (50%), Gaps = 8/158 (5%)

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+R  +   LF+D RA  VGD+LTV      Q   +  + +       +  +  F++  
Sbjct: 56  SLYRHQYTMTLFQDRRAYRVGDVLTV------QLFEETSSSKKAGTQFGKSSTVDFAVPT 109

Query: 121 QQTPQMNG-NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             T  +N   ++ DG  +  G  S S+  KL   I   V  +L NG L ISG + +R+N 
Sbjct: 110 IGTKTINELGVSVDGSRSFDGSSSSSQGNKLQGAITVTVHEVLPNGVLRISGEKWLRLNQ 169

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
               + +TGIVR  D+   N VS  +IA+ARI+Y G+G
Sbjct: 170 GDEFIRLTGIVRVDDISRSNQVSSQRIADARITYAGRG 207


>gi|157371204|ref|YP_001479193.1| flagellar basal body L-ring protein [Serratia proteamaculans 568]
 gi|157322968|gb|ABV42065.1| flagellar L-ring protein [Serratia proteamaculans 568]
          Length = 233

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 97/243 (39%), Gaps = 32/243 (13%)

Query: 5   SFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW 64
           + ++L      +  H  + + T   Q +P G+ +         G  F+        Y   
Sbjct: 14  AMVMLTLGGCAYIPHKPLVDGTTTAQPAPAGAPVPN-------GSIFQTVQPMNYGYQ-- 64

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
                 LF+D R  NVGD LT+ ++ +  A   +    SRN         G S FG  T 
Sbjct: 65  -----PLFEDRRPRNVGDTLTIALQENVSASKSSSANASRN---------GASKFGVATA 110

Query: 125 Q-----MNGNLNYD----GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
                 + GN   D    G     GKG  +     N  I   V  +L NGNL + G +++
Sbjct: 111 PRYLDGLLGNARADMEMSGDSTFGGKGGANANNTFNGTITVTVNQVLVNGNLHVVGEKQI 170

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
            +N     +  +G+V P+ +   NSV+  ++A+ARI Y G G   E        +   N+
Sbjct: 171 AINQGTEFIRFSGVVNPRTISGSNSVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNV 230

Query: 236 SPL 238
           SP 
Sbjct: 231 SPF 233


>gi|327398482|ref|YP_004339351.1| Flagellar L-ring protein [Hippea maritima DSM 10411]
 gi|327181111|gb|AEA33292.1| Flagellar L-ring protein [Hippea maritima DSM 10411]
          Length = 231

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 95/217 (43%), Gaps = 32/217 (14%)

Query: 14  LLFGCHSSISE--ITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAAL 71
           LL GC +S  E   T +P+      SL  N               T    SLW ++   +
Sbjct: 13  LLSGCTTSNVERKYTEMPEYVKEQPSLKPN--------------ITHNEGSLWNNTADNM 58

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN 131
           F D +A  VGDI+T+ ++   Q+V  + T  SR  S    LS    + G+   ++N    
Sbjct: 59  FSDIKARQVGDIVTIIVKEQAQSVNSSSTKTSRATSSQSGLSTLLGMQGKILQRLNA--- 115

Query: 132 YDGGGASS-----------GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
               GAS+           G G      +L   I A V  +L N  L I G ++V  N +
Sbjct: 116 --VAGASNMMDTSSSSSFNGSGENKVNNELTATITARVVKVLPNHKLFIRGEKQVYTNGD 173

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
             ++ +TGI+    + + N++  + I++A+I Y GKG
Sbjct: 174 ENTIILTGIIDEYQITSDNTIDSNYISDAKIFYNGKG 210


>gi|259908809|ref|YP_002649165.1| flagellar basal body L-ring protein [Erwinia pyrifoliae Ep1/96]
 gi|224964431|emb|CAX55940.1| Flagellar L-ring protein [Erwinia pyrifoliae Ep1/96]
 gi|310767293|gb|ADP12243.1| Flagellar L-ring protein precursor [Erwinia sp. Ejp617]
          Length = 233

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 77/175 (44%), Gaps = 8/175 (4%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG----FSLFGQQT 123
           +  LF+D R  N+GD LT+ ++ +  A   +     R+ S    L+        L G   
Sbjct: 63  YQPLFEDRRPRNIGDTLTITLQENVSASKSSSANAGRDGSAEFGLTATPRALVGLLGGDK 122

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
             + G+   D      GKG  +        I   V  +L NGNL + G +++ +N     
Sbjct: 123 ATLGGSGKND----FEGKGGATAKNTFTGTITVTVNQVLPNGNLNVVGEKQIEINQGTEF 178

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +G+V P+ + A NSV   ++A+ARI Y G G   E        +   N+SP+
Sbjct: 179 IRFSGVVNPRTISASNSVVSSQVADARIEYVGNGYINEAQTMGWLQRFFLNISPM 233


>gi|197285507|ref|YP_002151379.1| flagellar basal body L-ring protein [Proteus mirabilis HI4320]
 gi|194682994|emb|CAR43439.1| flagellar L-ring protein precursor [Proteus mirabilis HI4320]
          Length = 247

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 81/179 (45%), Gaps = 16/179 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ-- 125
           +  LF+D R  N+GD LT+ ++ +  A        S+N+S +   +G        TP+  
Sbjct: 77  YQPLFEDRRPRNIGDTLTITLQENVSA--------SKNSSANASRNGKAGFLASITPRFL 128

Query: 126 --MNGN----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             + GN    +  +G     GKG  +        I   V  +L NGNL + G +++ +N 
Sbjct: 129 EGLLGNSRTDMGMEGNSEFGGKGGANANNTFKGTITVTVDQLLANGNLHVVGEKQIAINQ 188

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP 
Sbjct: 189 GTEFIRFSGVVNPRTISGSNTVNSTQVADARIEYIGDGYINEAQSMGWLQRFFLNVSPF 247


>gi|58582199|ref|YP_201215.1| flagellar basal body L-ring protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624091|ref|YP_451463.1| flagellar basal body L-ring protein [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|75435189|sp|Q5GZP1|FLGH_XANOR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|110816548|sp|Q2P2N8|FLGH_XANOM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|58426793|gb|AAW75830.1| flagellar L-ring protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368031|dbj|BAE69189.1| flagellar L-ring protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 230

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 79/157 (50%), Gaps = 12/157 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK----LSGGFSLFGQQTPQ- 125
           L+ D RA +VGD+LT+ +     A     T  S+ ++        L    ++ G    Q 
Sbjct: 62  LYGDRRARDVGDLLTITLIESTTASSSANTSTSKKDATTMASPTLLGAPLTVAGLDVLQN 121

Query: 126 -MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
            + G+  +DG      KG+ +++ ++   +   V   L NGNL++ G + +R+N     +
Sbjct: 122 TLKGDRAFDG------KGNTAQSNRMQGSVTVTVIQRLPNGNLVVQGQKNLRLNQGDELV 175

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            V GIVR  D+   N++   K+AEARI+YGG+G   +
Sbjct: 176 QVQGIVRDADIAPDNTIPSSKVAEARIAYGGRGAIAQ 212


>gi|218708807|ref|YP_002416428.1| flagellar basal body L-ring protein [Vibrio splendidus LGP32]
 gi|254789287|sp|B7VKM5|FLGH_VIBSL RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|218321826|emb|CAV17797.1| Flagellar L-ring protein precursor [Vibrio splendidus LGP32]
          Length = 258

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 89/170 (52%), Gaps = 12/170 (7%)

Query: 62  SLWRDSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN--SLHRKLSGGFSL 118
           SL+  +H  +++ DS+   +GDI+TV +  + +A        S++N  S+     GG +L
Sbjct: 84  SLFNANHIGSMYDDSKPRGIGDIITVALDENTRATKKANADMSKSNDASMEPLAVGGENL 143

Query: 119 -FGQQTPQMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
             G+       N +YD    ++  G  S +++  ++  I   V  +L NGNL++ G + +
Sbjct: 144 ELGKY------NFSYDLSNTNTFAGDASANQSNSISGYITVEVIEVLANGNLVVRGEKWM 197

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            +N     + ++G +RP D+D  N+++ ++++ ARI Y G G   ++  P
Sbjct: 198 TLNTGDEYIRLSGTIRPDDIDFENTIASNRVSNARIQYSGTGVQKDMQEP 247


>gi|215486288|ref|YP_002328719.1| flagellar basal body L-ring protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|31076692|sp|Q8CW55|FLGH_ECOL6 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789280|sp|B7UP93|FLGH_ECO27 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|215264360|emb|CAS08717.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli O127:H6 str. E2348/69]
 gi|307553081|gb|ADN45856.1| flagellar L-ring protein FlgH [Escherichia coli ABU 83972]
          Length = 232

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 82/175 (46%), Gaps = 8/175 (4%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+     K + GF    +    + 
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDG----KTNFGFDTVPRYLQGVF 117

Query: 128 GNLNYD----GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
           GN   D    GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     
Sbjct: 118 GNARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEF 177

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 178 IRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|227886563|ref|ZP_04004368.1| flagellar basal body L-ring protein [Escherichia coli 83972]
 gi|300974383|ref|ZP_07172595.1| flagellar L-ring protein FlgH [Escherichia coli MS 45-1]
 gi|227836767|gb|EEJ47233.1| flagellar basal body L-ring protein [Escherichia coli 83972]
 gi|300410626|gb|EFJ94164.1| flagellar L-ring protein FlgH [Escherichia coli MS 45-1]
          Length = 235

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 82/175 (46%), Gaps = 8/175 (4%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+     K + GF    +    + 
Sbjct: 65  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDG----KTNFGFDTVPRYLQGVF 120

Query: 128 GNLNYD----GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
           GN   D    GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     
Sbjct: 121 GNARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEF 180

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 181 IRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 235


>gi|317153842|ref|YP_004121890.1| flagellar L-ring protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316944093|gb|ADU63144.1| flagellar L-ring protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 236

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 112/251 (44%), Gaps = 28/251 (11%)

Query: 1   MYRYSFIVLC---YSSLLF--GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSD 55
           M RY  I +     +SL+   GC +   E+  +P ++P     +E N     G  F   D
Sbjct: 1   MRRYFLIAVAAVMLASLVLTAGCANKYEEMP-MPVLTP--PVYEEQNPAANPGSLF---D 54

Query: 56  STKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS-- 113
           S +  +         L+ D+RA  VGDI+ V +  +  +   ++T   R+NS    +S  
Sbjct: 55  SNRSEF---------LYDDNRASRVGDIVLVQVAEESNSRIKSETKAKRDNSNTLSVSAM 105

Query: 114 ------GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
                 G   L G    ++  +L+          G   +  +   ++A  +   L    L
Sbjct: 106 PETGLIGNLPLAGTLGAKVGTSLDTSTVSDLKSNGETKQESEFEAIVATRIVRKLPGNLL 165

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G++ +RVN+E + L V G++R +D+ + N++    +AEA+I   G+G   +  RP  
Sbjct: 166 QVEGARRIRVNNETQFLVVRGLIRQRDISSSNTIPSTSLAEAQIEIFGQGVLADKQRPGW 225

Query: 228 GHQLIENLSPL 238
             ++I+N+ P 
Sbjct: 226 LSRIIDNIYPF 236


>gi|166712059|ref|ZP_02243266.1| flagellar basal body L-ring protein [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 212

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 79/157 (50%), Gaps = 12/157 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK----LSGGFSLFGQQTPQ- 125
           L+ D RA +VGD+LT+ +     A     T  S+ ++        L    ++ G    Q 
Sbjct: 44  LYGDRRARDVGDLLTITLIESTTASSSANTSTSKKDATTMASPTLLGAPLTVAGLDVLQN 103

Query: 126 -MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
            + G+  +DG      KG+ +++ ++   +   V   L NGNL++ G + +R+N     +
Sbjct: 104 TLKGDRAFDG------KGNTAQSNRMQGSVTVTVIQRLPNGNLVVQGQKNLRLNQGDELV 157

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            V GIVR  D+   N++   K+AEARI+YGG+G   +
Sbjct: 158 QVQGIVRAADIAPDNTIPSSKVAEARIAYGGRGAIAQ 194


>gi|307313516|ref|ZP_07593137.1| flagellar L-ring protein [Escherichia coli W]
 gi|306906684|gb|EFN37195.1| flagellar L-ring protein [Escherichia coli W]
 gi|315059545|gb|ADT73872.1| flagellar protein of basal-body outer-membrane L ring [Escherichia
           coli W]
 gi|323379896|gb|ADX52164.1| flagellar L-ring protein [Escherichia coli KO11]
          Length = 247

 Score = 65.1 bits (157), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 79/152 (51%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++FG    +++G 
Sbjct: 83  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPTIFGHTKDKLSGS 139

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 140 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 193

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+ARISY  +G
Sbjct: 194 LSGLVRADDIQNDNSVSSQRIADARISYAVRG 225


>gi|26247219|ref|NP_753259.1| flagellar basal body L-ring protein [Escherichia coli CFT073]
 gi|26107620|gb|AAN79819.1|AE016759_93 Flagellar L-ring protein precursor [Escherichia coli CFT073]
          Length = 237

 Score = 65.1 bits (157), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 82/175 (46%), Gaps = 8/175 (4%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+     K + GF    +    + 
Sbjct: 67  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDG----KTNFGFDTVPRYLQGVF 122

Query: 128 GNLNYD----GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
           GN   D    GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N     
Sbjct: 123 GNARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEF 182

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 183 IRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 237


>gi|149201612|ref|ZP_01878586.1| Flagellar L-ring protein [Roseovarius sp. TM1035]
 gi|149144660|gb|EDM32689.1| Flagellar L-ring protein [Roseovarius sp. TM1035]
          Length = 221

 Score = 65.1 bits (157), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 81/172 (47%), Gaps = 5/172 (2%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           S+     D RA  VGDILTV+      A      G S+ +S    L    S FG      
Sbjct: 55  SNGLFVADRRARAVGDILTVEFSERFAASKSQAAGSSKTDSFELDLPDVLS-FGFD---- 109

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           +G L      + +G+G+ +++  L   ++  V  +L  GNL I G +++ +N+    + +
Sbjct: 110 DGRLTSGTTRSYAGRGNATQSNSLTGRVSVSVVRVLPGGNLEIIGQKQLTLNNGQEYIRL 169

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            G+VRP D+ A N V  D+IA A I Y G G   +  +     +  E +SPL
Sbjct: 170 RGVVRPTDISADNVVRSDRIAHAEIKYVGAGDVADTAKQGWLRRAFETVSPL 221


>gi|92114095|ref|YP_574023.1| flagellar L-ring protein [Chromohalobacter salexigens DSM 3043]
 gi|91797185|gb|ABE59324.1| flagellar L-ring protein [Chromohalobacter salexigens DSM 3043]
          Length = 224

 Score = 65.1 bits (157), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 78/179 (43%), Gaps = 13/179 (7%)

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
           R  +  LF+D R   +GDI+T+ I  D  A  D+    +R  S+   L        +  P
Sbjct: 54  RYGYQPLFQDRRPRQIGDIITITINEDVSASKDSSASANREGSMGLDL--------ETIP 105

Query: 125 QM-----NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
            +     +  L+  G     G G  S +      + A V  IL NGNL I G + + +N 
Sbjct: 106 DLMSFLEDNGLDVSGENDFEGSGGASASNTFTGTLTATVVDILPNGNLSIRGEKRIAINQ 165

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               +  +G+V P+ V   N+V   ++A+ARI Y G G   E        +L  N++P 
Sbjct: 166 GTEYIRFSGVVDPRSVTTQNTVPSGQVADARIEYVGDGYINEAQHMGWLQRLWLNIAPF 224


>gi|288574699|ref|ZP_06393056.1| flagellar L-ring protein [Dethiosulfovibrio peptidovorans DSM
           11002]
 gi|288570440|gb|EFC91997.1| flagellar L-ring protein [Dethiosulfovibrio peptidovorans DSM
           11002]
          Length = 191

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 87/186 (46%), Gaps = 20/186 (10%)

Query: 56  STKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG 115
           S     SLW+D       D R   VGDI+ V++        D +T             GG
Sbjct: 19  SCASGQSLWQDG-TNYIGDDRPSRVGDIVMVEV--------DERTDTEDEAKTETTKEGG 69

Query: 116 FSLFGQQTPQMNGNLNY------DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
            ++      +  G L++           S+G GS  R+ +    +  +VT +L NGNL+I
Sbjct: 70  ANV-----SEGTGILDFIKGLSLTSSTTSTGDGSSERSYRTRAKVTCVVTEVLPNGNLVI 124

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
            G+++++ + E   +   G +RPQDVD  N++S +++A   +   GKG  T L +P I  
Sbjct: 125 EGTRDLQTHGETLKMRFRGAIRPQDVDGDNTISSERVANVDLIVDGKGTLTRLQKPGILT 184

Query: 230 QLIENL 235
           Q+++ +
Sbjct: 185 QILQAI 190


>gi|308186396|ref|YP_003930527.1| Flagellar L-ring protein precursor [Pantoea vagans C9-1]
 gi|308056906|gb|ADO09078.1| Flagellar L-ring protein precursor [Pantoea vagans C9-1]
          Length = 195

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 78/173 (45%), Gaps = 2/173 (1%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG--GFSLFGQQTPQ 125
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+ S    +SG             
Sbjct: 23  YQPLFEDRRPRNIGDTLTITLQENVSASKSSSASASRDGSNSFGVSGVPTGLAGLVGAGG 82

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              NL+ +G    +GKG  S        I   V  +L NGNL + G +++ +N     + 
Sbjct: 83  EKANLSAEGKNDFAGKGGASANNTFTGTITVTVDQVLSNGNLHVVGEKQIAINQGTEFIR 142

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            +G+V P+ + A N+V    +A+ARI Y G G   E        +   N+SP+
Sbjct: 143 FSGVVNPRTISASNAVLSTAVADARIEYVGNGYINEAQTMGWFQRFFLNISPM 195


>gi|330961202|gb|EGH61462.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 261

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 83/176 (47%), Gaps = 13/176 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG-- 128
           L+ D +A  VGDI+T+ +     A     +  S+N++    L+   SLFG      N   
Sbjct: 88  LYGDRKAFRVGDIITITLSERMAASKAATSAMSKNSTNSIGLT---SLFGSGLTTNNPIG 144

Query: 129 ------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                 N  Y+G   ++G G  +++  L   +   V  +L NG L + G + + +N    
Sbjct: 145 GNDLSLNAGYNGARTTNGDGKAAQSNSLTGSVTVTVADVLPNGILSVRGEKWMTLNTGDE 204

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 205 LVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 258


>gi|332527718|ref|ZP_08403759.1| flagellar l-ring protein [Rubrivivax benzoatilyticus JA2]
 gi|332112116|gb|EGJ12092.1| flagellar l-ring protein [Rubrivivax benzoatilyticus JA2]
          Length = 231

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 82/155 (52%), Gaps = 9/155 (5%)

Query: 69  AALFK-DSRALNVGDILTVDIRIDDQAVFDNQ---TGRSRNNSLHRKLSGGFSLFGQQTP 124
           A +F  + R  ++GD L V+I   D+ +  NQ   T  SR N +  K  G  S   +   
Sbjct: 58  ATMFSGEKRPRSIGDTLKVEI---DERLAANQKVTTNTSRENKIATKGPGTDSQNVRGAL 114

Query: 125 QMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           +   +L+   GG+ S  GKGS   + + +  IAA V  +L NG+L+++G + +  N+ + 
Sbjct: 115 RSLLDLDAQAGGSDSFVGKGSTENSSRFSGRIAASVVNVLPNGHLVVAGERSIAYNEGVT 174

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +L  +G+V P D+ A N V+   I +AR+   G+G
Sbjct: 175 TLRFSGVVNPDDIKAGNVVASADIVDARLEAVGRG 209


>gi|296103608|ref|YP_003613754.1| Flagellar L-ring protein, FlgH [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295058067|gb|ADF62805.1| Flagellar L-ring protein, FlgH [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 228

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 80/178 (44%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  +F+D R  NVGD LT+ ++ +  A   +    +RN S       G  L    T ++N
Sbjct: 58  YQPMFEDRRPRNVGDTLTILLQENVSASKSSSASANRNGS------AGMGLIAVPT-KLN 110

Query: 128 G-------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
           G       +   +G    +GKG  +        I   V  +L NGNL + G +++ +N  
Sbjct: 111 GWLGDGKADFEAEGKNDFAGKGGAAARNTFTGTITVTVKELLPNGNLGVVGEKQIAINQG 170

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++A+ARI Y G G   E        +L  NLSP 
Sbjct: 171 TEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRLFLNLSPF 228


>gi|153834476|ref|ZP_01987143.1| flagellar L-ring protein FlgH [Vibrio harveyi HY01]
 gi|269961602|ref|ZP_06175964.1| flagellar L-ring protein precursor [Vibrio harveyi 1DA3]
 gi|148869172|gb|EDL68204.1| flagellar L-ring protein FlgH [Vibrio harveyi HY01]
 gi|269833643|gb|EEZ87740.1| flagellar L-ring protein precursor [Vibrio harveyi 1DA3]
          Length = 259

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 85/169 (50%), Gaps = 9/169 (5%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+   H   L+ DS+   +GDI+TV +    +A        S+ N    +     S+ G
Sbjct: 84  SLFSTEHITDLYDDSKPRGIGDIITVTLDETTRATKSANADLSKTNDAKME---PLSVGG 140

Query: 121 QQTPQMNG--NLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           Q+  Q+ G  N +YD    ++  G  S  ++  ++  I   V  +L NGNL+I G + + 
Sbjct: 141 QEL-QIGGKYNFSYDLNNTNTFAGDSSAKQSNSISGYITVEVIEVLANGNLVIRGEKWMT 199

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           +N     + ++G +RP D++  N+++ ++++ ARI Y G G   ++  P
Sbjct: 200 LNTGDEYIRLSGTIRPDDINFDNTIASNRVSNARIQYSGTGSPQDMQEP 248


>gi|188576759|ref|YP_001913688.1| flagellar basal body L-ring protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576951|ref|YP_001913880.1| flagellar basal body L-ring protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521211|gb|ACD59156.1| flagellar L-ring protein FlgH [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521403|gb|ACD59348.1| flagellar L-ring protein FlgH [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 207

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 78/153 (50%), Gaps = 12/153 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK----LSGGFSLFGQQTPQ- 125
           L+ D RA +VGD+LT+ +     A     T  S+ ++        L    ++ G    Q 
Sbjct: 39  LYGDRRARDVGDLLTITLIESTTASSSANTSTSKKDATTMASPTLLGAPLTVAGLDVLQN 98

Query: 126 -MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
            + G+  +DG      KG+ +++ ++   +   V   L NGNL++ G + +R+N     +
Sbjct: 99  TLKGDRAFDG------KGNTAQSNRMQGSVTVTVIQRLPNGNLVVQGQKNLRLNQGDELV 152

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            V GIVR  D+   N++   K+AEARI+YGG+G
Sbjct: 153 QVQGIVRDADIAPDNTIPSSKVAEARIAYGGRG 185


>gi|238796907|ref|ZP_04640411.1| Flagellar L-ring protein [Yersinia mollaretii ATCC 43969]
 gi|238719167|gb|EEQ10979.1| Flagellar L-ring protein [Yersinia mollaretii ATCC 43969]
          Length = 189

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 87/176 (49%), Gaps = 12/176 (6%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSL---HRKLSGGFS-LFG--Q 121
           +  +F+D R  NVGD LT+ ++ +  A   +    +R  S       + G  S LFG  +
Sbjct: 19  YQPMFEDRRPRNVGDTLTIVLQENVSASKSSSANANRGGSTGLSFDAVPGAMSGLFGGDK 78

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
               ++G+ ++ G G ++ K + S        I   V  +L+NGNL + G +++ +N   
Sbjct: 79  ANAAISGSSDFTGKGGAAAKNTFSGT------ITVTVQQLLQNGNLKVVGEKQIAINQGT 132

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
             +  +G+V P+ + + NSV   ++++ARI Y G G   E  +     +L  NLSP
Sbjct: 133 EFIRFSGVVNPRTISSSNSVISTQVSDARIEYVGNGYINEAQQMGWLQRLFLNLSP 188


>gi|146307866|ref|YP_001188331.1| flagellar basal body L-ring protein [Pseudomonas mendocina ymp]
 gi|145576067|gb|ABP85599.1| flagellar L-ring protein [Pseudomonas mendocina ymp]
          Length = 240

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 82/174 (47%), Gaps = 25/174 (14%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF---SLFGQQT---- 123
           L+ D +A  VGDI+T+ +    QA       ++ N+++ +  SG     +LFG       
Sbjct: 59  LYDDRKAFRVGDIITITLNERTQA------SKNANSNIQKDSSGAIGAPNLFGMAVTPDN 112

Query: 124 ------------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
                       P ++   N++    +SG G   ++  L+  I   V  +L NG L + G
Sbjct: 113 PLRSLGALGMNNPNLSLEANWNAQREASGSGQAGQSNSLSGSITVTVAEVLPNGILAVRG 172

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            + + +N     + ++G+VR  D+   N+V+  ++A+ARI+Y G G   +  +P
Sbjct: 173 EKWMTLNTGDELVRISGLVRADDISTDNTVASTRVADARITYSGTGAFADASQP 226


>gi|302185579|ref|ZP_07262252.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           syringae 642]
          Length = 237

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 82/178 (46%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D +A  +GDI+T+ +  R+       +   +   NS+     G  SLFG      N 
Sbjct: 64  LYGDRKAFRIGDIITITLSERMAASKAATSAMSKDSTNSI-----GLTSLFGSGLTTNNP 118

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N  Y+G  ++ G G  +++  L   +   V  +L NG L + G + + +N  
Sbjct: 119 IGGNDLSLNAGYNGARSTKGDGKAAQSNSLTGSVTVTVADVLPNGILAVRGEKWMTLNTG 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 179 DELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 234


>gi|119947174|ref|YP_944854.1| flagellar basal body L-ring protein [Psychromonas ingrahamii 37]
 gi|119865778|gb|ABM05255.1| flagellar L-ring protein [Psychromonas ingrahamii 37]
          Length = 232

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 83/160 (51%), Gaps = 12/160 (7%)

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG---GFS 117
           SL++ + + +LF D RA +VGDIL V   ++++       G     S   ++S    G S
Sbjct: 59  SLFKPTQSFSLFTDIRAYDVGDILMV--YLNEETSSKKAAGTEFGKSSSAEISAPTFGSS 116

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           +    +  + G  ++      SG  S S+  KL+  I   V  +L NG L I G + + +
Sbjct: 117 VLDNYSASVAGERDF------SGSASSSQGNKLSGSITVTVYEVLPNGVLHIRGEKWITL 170

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           N     + +TG VR +D+++ N++   +IA+ARI+Y GKG
Sbjct: 171 NQGDEFIRLTGNVRVEDINSDNAIGSQRIADARITYSGKG 210


>gi|330972417|gb|EGH72483.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 237

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 82/176 (46%), Gaps = 13/176 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG-- 128
           L+ D +A  +GDI+T+ +     A     +  S+N++    L+   SLFG      N   
Sbjct: 64  LYGDRKAFRIGDIITITLSERMAASKAATSAMSKNSTNSIGLT---SLFGSGLTTNNPIG 120

Query: 129 ------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                 N  Y G   ++G G  +++  L   +   V  +L NG L + G + + +N    
Sbjct: 121 GNDLSLNAGYTGARTTNGDGKAAQSNSLTGSVTVTVADVLPNGILAVRGEKWMTLNTGDE 180

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 181 LVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 234


>gi|163802600|ref|ZP_02196492.1| flagellar L-ring protein precursor [Vibrio sp. AND4]
 gi|159173683|gb|EDP58502.1| flagellar L-ring protein precursor [Vibrio sp. AND4]
          Length = 259

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 85/169 (50%), Gaps = 9/169 (5%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+   H   L+ DS+   VGDI+TV +    +A        S+ N    +     S+ G
Sbjct: 84  SLFSADHITDLYDDSKPRGVGDIITVTLDETTRATKSANADLSKTNDAKME---PLSVGG 140

Query: 121 QQTPQMNG--NLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           Q+  Q+ G  N +YD    ++  G  S  ++  ++  I   V  +L NGNL+I G + + 
Sbjct: 141 QEL-QIGGKYNFSYDLNNTNTFAGDSSAKQSNSISGYITVEVIEVLANGNLVIRGEKWMT 199

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           +N     + ++G +RP D++  N+++ ++++ ARI Y G G   ++  P
Sbjct: 200 LNTGDEYIRLSGTIRPDDINFDNTIASNRVSNARIQYSGTGLPQDMQEP 248


>gi|238764395|ref|ZP_04625345.1| Flagellar L-ring protein [Yersinia kristensenii ATCC 33638]
 gi|238697421|gb|EEP90188.1| Flagellar L-ring protein [Yersinia kristensenii ATCC 33638]
          Length = 238

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 76/170 (44%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  LF+D R  N+GD LT+ ++ +  A   +    SRN S    ++              
Sbjct: 68  YQPLFEDRRPRNIGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRYLEGPLGNAR 127

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            +L+  G     GKG  +     +  I   V  +L NGNL + G +++ +N     +  +
Sbjct: 128 ADLDISGDSTFGGKGGANANNTFSGTITVTVNQVLANGNLHVVGEKQIAINQGTEFIRFS 187

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 188 GVVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 237


>gi|260767766|ref|ZP_05876701.1| flagellar L-ring protein FlgH [Vibrio furnissii CIP 102972]
 gi|260617275|gb|EEX42459.1| flagellar L-ring protein FlgH [Vibrio furnissii CIP 102972]
 gi|315179402|gb|ADT86316.1| flagellar L-ring protein FlgH [Vibrio furnissii NCTC 11218]
          Length = 259

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 79/161 (49%), Gaps = 11/161 (6%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG---FSLFGQQTPQM 126
           +L+ DS+   +GDI+TV +    +A       +S +  L +K        S+ GQ+    
Sbjct: 94  SLYDDSKPRGIGDIITVTLNESTKAA------KSADADLKKKNDASMDPLSVGGQELNLG 147

Query: 127 NGNLNY--DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
             N +Y        SG    +++  L+  I   V  IL NGNL+I G + + +N     +
Sbjct: 148 EYNFSYALKNDNKFSGSAQANQSNSLSGSITVEVIDILSNGNLVIRGEKWLSLNTGDEYI 207

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            ++G +RP D+D  N+++ ++I+ ARI Y G G   ++  P
Sbjct: 208 RLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEP 248


>gi|304397207|ref|ZP_07379086.1| flagellar L-ring protein [Pantoea sp. aB]
 gi|304355356|gb|EFM19724.1| flagellar L-ring protein [Pantoea sp. aB]
          Length = 236

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 2/173 (1%)

Query: 68  HAALFKDSRALNVGDILTVDIR--IDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
           +  LF+D R  N+GD LT+ ++  +           R  +NSL                 
Sbjct: 64  YQPLFEDRRPRNIGDTLTITLQENVSASKSSSASASRDGSNSLGITGVPTGLAGLVGAGG 123

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              NL+ +G    +GKG  S        I   V  +L NGNL + G +++ +N     + 
Sbjct: 124 EKANLSAEGKNDFAGKGGASANNTFTGTITVTVDQVLSNGNLHVVGEKQIAINQGTEFIR 183

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            +G+V P+ + A N+V    +A+ARI Y G G   E        +   N+SP+
Sbjct: 184 FSGVVNPRTISASNAVLSTAVADARIEYVGNGYINEAQTMGWFQRFFLNISPM 236


>gi|320173531|gb|EFW48727.1| Flagellar L-ring protein FlgH [Shigella dysenteriae CDC 74-1112]
 gi|320186974|gb|EFW61687.1| Flagellar L-ring protein FlgH [Shigella flexneri CDC 796-83]
          Length = 232

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 83/178 (46%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++ +ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVVDARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|226944495|ref|YP_002799568.1| flagellar L-ring protein [Azotobacter vinelandii DJ]
 gi|226719422|gb|ACO78593.1| Flagellar L-ring protein [Azotobacter vinelandii DJ]
          Length = 232

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 77/176 (43%), Gaps = 13/176 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT---P 124
           +  LF+D R   +GDILT+        V + Q   S+N++ +   S G SL    T   P
Sbjct: 65  YQPLFEDRRPRMIGDILTI--------VLNEQVSASKNSASNANRSSGMSLGFSTTSDKP 116

Query: 125 QMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           +  G    +  G +  SG G           I   V  ++ NGNL + G +++ +N    
Sbjct: 117 EKVGEFGAEASGDNDFSGSGGSRANNSFTGTITVTVQQVMPNGNLRVVGEKQIAINQGTE 176

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            +  +G+V P+ +   N+VS   ++ ARI Y G G   E        +   N+SP 
Sbjct: 177 YIRFSGLVNPRTITVQNTVSSTLVSMARIEYVGDGYINEAQHMGWLQRFFLNVSPF 232


>gi|77457730|ref|YP_347235.1| flagellar basal body L-ring protein [Pseudomonas fluorescens Pf0-1]
 gi|110816538|sp|Q3KG60|FLGH_PSEPF RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|77381733|gb|ABA73246.1| flagellar L-ring protein [Pseudomonas fluorescens Pf0-1]
          Length = 231

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 83/176 (47%), Gaps = 13/176 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN--- 127
           L+ D +A  VGDI+T+ +    QA  +  +  ++N+     L+   SLFG      N   
Sbjct: 58  LYSDRKAFRVGDIITITLNERTQASKNANSQVAKNSKTGIGLT---SLFGGSATTNNPLG 114

Query: 128 GN-----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           GN     + Y G  A+ G    ++   L   I   V  +L NG + + G + + +N    
Sbjct: 115 GNDLSLDVGYSGDRATKGDSKAAQGNTLTGSITVTVADVLPNGIIAVRGEKWMTLNTGDE 174

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            + + G+VR  D+   N+VS  ++A+ARI+Y G G   +  +P    +    LSPL
Sbjct: 175 LVRIAGLVRADDIATDNTVSSTRVADARITYSGTGSFADASQPGWFDRFF--LSPL 228


>gi|82544455|ref|YP_408402.1| flagellar basal body L-ring protein [Shigella boydii Sb227]
 gi|110816541|sp|Q31ZD4|FLGH_SHIBS RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|81245866|gb|ABB66574.1| basal-body outer-membrane L (lipopolysaccharide layer) ring protein
           [Shigella boydii Sb227]
 gi|332094025|gb|EGI99077.1| flagellar L-ring family protein [Shigella boydii 3594-74]
          Length = 232

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 82/178 (46%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +   N+V   ++ +ARI Y G G   E            NLSP+
Sbjct: 175 TEFIRFSGVVNPRTISGSNTVPSTQVVDARIEYVGNGYINEAQNMGWLQHFFLNLSPM 232


>gi|66046703|ref|YP_236544.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           syringae B728a]
 gi|75501290|sp|Q4ZQR6|FLGH_PSEU2 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|63257410|gb|AAY38506.1| Flagellar L-ring protein [Pseudomonas syringae pv. syringae B728a]
          Length = 237

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 81/178 (45%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D +A  +GDI+T+ +  R+       +   +   NS+     G  SLFG      N 
Sbjct: 64  LYGDRKAFRIGDIITITLSERMAASKAATSAMSKDSTNSI-----GLTSLFGSGLTTNNP 118

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N  Y+G   + G G  +++  L   +   V  +L NG L + G + + +N  
Sbjct: 119 IGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILAVRGEKWMTLNTG 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 179 DELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 234


>gi|15616949|ref|NP_240162.1| flagellar basal body L-ring protein [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681702|ref|YP_002468088.1| flagellar L-ring protein precursor [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682257|ref|YP_002468641.1| flagellar L-ring protein precursor [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471398|ref|ZP_05635397.1| flagellar basal body L-ring protein [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|11386810|sp|P57425|FLGH_BUCAI RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789278|sp|B8D9C9|FLGH_BUCA5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789279|sp|B8D7N1|FLGH_BUCAT RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|25373418|pir||H84969 flagellar L-ring protein precursor [imported] - Buchnera sp.
           (strain APS)
 gi|10039014|dbj|BAB13048.1| flagellar L-ring protein precursor [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219621990|gb|ACL30146.1| flagellar L-ring protein precursor [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624545|gb|ACL30700.1| flagellar L-ring protein precursor [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311086080|gb|ADP66162.1| flagellar basal body L-ring protein [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086652|gb|ADP66733.1| flagellar basal body L-ring protein [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087238|gb|ADP67318.1| flagellar basal body L-ring protein [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
          Length = 238

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 90/175 (51%), Gaps = 4/175 (2%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH--RKLSGGF--SLFGQQT 123
           +  LF+D R  N+GD +TV ++ +  A   + +  SR+ S +   K++ G   ++ G   
Sbjct: 64  YQPLFEDHRPHNIGDTITVVLQENISASNSSISNMSRDGSANFGLKIAPGQLNNILGVNF 123

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                +L+  G    SGKGS S   K   LI   V  +L NGNL + G ++V +N     
Sbjct: 124 QDNTTSLDSFGRNNFSGKGSNSANNKFTGLITVTVKRVLPNGNLKVIGEKQVSINKGTEF 183

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +  +G++ P +++ +N +S  +IA+ARI Y   G   ++ +     +L+  +SP+
Sbjct: 184 IRFSGVINPTNINKNNFISSTQIADARIEYLSHGGLDDVQKMGWLQKLLLKISPI 238


>gi|238785494|ref|ZP_04629477.1| Flagellar L-ring protein [Yersinia bercovieri ATCC 43970]
 gi|238713596|gb|EEQ05625.1| Flagellar L-ring protein [Yersinia bercovieri ATCC 43970]
          Length = 237

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 94/228 (41%), Gaps = 18/228 (7%)

Query: 14  LLFGC----HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA 69
           LL GC    H S+ + T   Q +P  + L         G  F+ +      Y        
Sbjct: 23  LLNGCAYIPHKSLVDGTTSAQPAPASAPLPN-------GSIFQAAQPMNYGYQ------- 68

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
            LF+D R  NVGD LT+ ++ +  A   +    SRN S    ++               +
Sbjct: 69  PLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRYLEGLLGNARAD 128

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           ++  G     GKG  +     +  I   V  +L NGNL + G +++ +N     +  +G+
Sbjct: 129 MDISGDNTFGGKGGANANNTFSGTITVTVDRVLANGNLHVVGEKQIAINQGTEFIRFSGV 188

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 189 VNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNISP 236


>gi|120554036|ref|YP_958387.1| flagellar L-ring protein [Marinobacter aquaeolei VT8]
 gi|120323885|gb|ABM18200.1| flagellar L-ring protein [Marinobacter aquaeolei VT8]
          Length = 230

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 82/153 (53%), Gaps = 17/153 (11%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG--GFSLFGQQTPQMNG 128
            + D+ ALNVGD+LTV ++   +A  +  T   ++N +        G S FG  T  +N 
Sbjct: 67  FYGDTVALNVGDVLTVTLQESTRASKNADTRIIKDNEIKLPEPNILGKSNFGIGT-SLNN 125

Query: 129 NLNY----DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
             ++    D   ++S  GSI+ +          VT +L NG L I G + + + +    +
Sbjct: 126 ERDFKTRADADQSNSLAGSITVS----------VTEVLPNGVLRIRGEKWLSLTNGEEYI 175

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            +TG+VRP+D+   NSV+ ++IA+ARI+YGG G
Sbjct: 176 RLTGLVRPRDIQPDNSVASNRIADARIAYGGTG 208


>gi|238799110|ref|ZP_04642566.1| Flagellar L-ring protein [Yersinia mollaretii ATCC 43969]
 gi|238717057|gb|EEQ08917.1| Flagellar L-ring protein [Yersinia mollaretii ATCC 43969]
          Length = 237

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 94/228 (41%), Gaps = 18/228 (7%)

Query: 14  LLFGC----HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA 69
           LL GC    H S+ + T   Q +P  + L         G  F+ +      Y        
Sbjct: 23  LLNGCAYIPHKSLVDGTTSAQPAPASAPLPN-------GSIFQAAQPMNYGYQ------- 68

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
            LF+D R  NVGD LT+ ++ +  A   +    SRN S    ++               +
Sbjct: 69  PLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRYLEGLLGNARAD 128

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           ++  G     GKG  +     +  I   V  +L NGNL + G +++ +N     +  +G+
Sbjct: 129 MDISGDNTFGGKGGANANNTFSGTITVTVDRVLANGNLHVVGEKQIAINQGTEFIRFSGV 188

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 189 VNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNISP 236


>gi|83646786|ref|YP_435221.1| flagellar basal body L-ring protein [Hahella chejuensis KCTC 2396]
 gi|83634829|gb|ABC30796.1| Flagellar basal body L-ring protein [Hahella chejuensis KCTC 2396]
          Length = 192

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 81/151 (53%), Gaps = 9/151 (5%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           S   L  D +A  VGD LTV I      V  ++ G S ++ +++ L    S FGQ     
Sbjct: 30  SFRPLTSDKKAYRVGDNLTVLI------VEVSKAGASSDSKVNQSLEASGS-FGQTNRTE 82

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
            G+L   G G +SG  S  R  +L   ++  V    + G L+ISG Q++ VN E +++ +
Sbjct: 83  VGSLEL-GLGRNSG-ASTQREGELRARVSVDVIDKDDVGRLLISGEQKITVNGEKQTIKL 140

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           TG VR +D+ A N++   +I++A+I Y GKG
Sbjct: 141 TGWVREEDITAQNTILSTRISDAQIEYNGKG 171


>gi|33596142|ref|NP_883785.1| flagellar basal body L-ring protein [Bordetella parapertussis
           12822]
 gi|81427445|sp|Q7WA92|FLGH_BORPA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|33573145|emb|CAE36793.1| flagellar L-ring protein precursor [Bordetella parapertussis]
          Length = 230

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 78/159 (49%), Gaps = 15/159 (9%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ-MNGN 129
           LF+D R  NVGDI+T+        V + +T  ++  + +    G  +L     P+ M+G 
Sbjct: 64  LFEDRRPRNVGDIVTI--------VLEEKTNAAKGVATNTSRDGSATLGVAAAPRFMDGV 115

Query: 130 LN------YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
           +N        GG  ++G G  S        I   V  +L NGNL I+G +++ +N     
Sbjct: 116 INDKLDTDISGGNTANGTGKSSANNTFTGTITTTVIGVLPNGNLQIAGEKQIAINRGSEY 175

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
           +  +G+V P+ +   N+VS  ++A+ARI Y  KG   E+
Sbjct: 176 VRFSGVVDPRSITGSNTVSSTRVADARIEYRSKGVMDEV 214


>gi|94495408|ref|ZP_01301988.1| flagellar L-ring protein precursor [Sphingomonas sp. SKA58]
 gi|94424796|gb|EAT09817.1| flagellar L-ring protein precursor [Sphingomonas sp. SKA58]
          Length = 226

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 81/180 (45%), Gaps = 21/180 (11%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  L   +RA  VGDI+T+        V   +T  S++NS     SG F L    TP   
Sbjct: 59  YTPLTSGARATTVGDIITI--------VLVERTQASKSNSADTSRSGSFGL----TPPST 106

Query: 128 GNLN---------YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           G L+           G    +GKG+ +++  L+  I   +  +  NG +++ G + + +N
Sbjct: 107 GVLSKLFSPSDVAMGGNNGFTGKGAATQSNALSGEITVTIAQVYPNGTMLVKGEKALTLN 166

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
                + ++G+VR  D+   N ++  ++A+A+I Y GKG      R     +    +SP 
Sbjct: 167 RGDEFIQISGLVRQADISPDNRIASTRVADAKIIYKGKGEIANASRQGWLQRFFSAISPF 226


>gi|254785375|ref|YP_003072804.1| flagellar L-ring protein FlgH [Teredinibacter turnerae T7901]
 gi|237685159|gb|ACR12423.1| flagellar L-ring protein FlgH [Teredinibacter turnerae T7901]
          Length = 234

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 85/172 (49%), Gaps = 6/172 (3%)

Query: 52  KNSDSTKKSYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHR 110
           K +    ++ SL+ +S A +LF D +A  VGDI+ V ++    +   +     +NN +  
Sbjct: 43  KPAPDMPQNGSLFAESTAMSLFNDRKATRVGDIINVVLQERTTSSKSSNMDLKKNNDVSV 102

Query: 111 KLSGGFSLFGQQTPQMNGNLNYDGGGASS----GKGSISRAEKLNLLIAAIVTAILENGN 166
             S G  +     P + GNL      +S+    G+    ++ +L   I+  V  +  NG 
Sbjct: 103 GGSAGDPVVFGTVPGL-GNLGLTADLSSAKEFKGEAGADQSNQLTGNISVTVVDVYPNGT 161

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
           L++ G + + +N     + ++G+VRP DV+  N+V   K+A ARI+Y G G 
Sbjct: 162 LLVRGEKWITLNQGNEYIRLSGLVRPDDVEPDNTVVSTKLANARITYSGTGE 213


>gi|187926951|ref|YP_001893296.1| flagellar L-ring protein [Ralstonia pickettii 12J]
 gi|241665280|ref|YP_002983639.1| flagellar L-ring protein [Ralstonia pickettii 12D]
 gi|187728705|gb|ACD29869.1| flagellar L-ring protein [Ralstonia pickettii 12J]
 gi|240867307|gb|ACS64967.1| flagellar L-ring protein [Ralstonia pickettii 12D]
          Length = 247

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 71/158 (44%), Gaps = 16/158 (10%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL-------SGGFSLFGQQT 123
           +F+D RA  VGD +T+ I  +  A        +R  S+   +       +G  SL G   
Sbjct: 82  MFEDRRAHMVGDTITIVITENTAASKQTSGSVNRTGSMSASVPTFAGMNAGVLSLLGVSA 141

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
              N    +D  GA+  +            I   V  +L NGNL++SG +++ V     S
Sbjct: 142 SDAN---KFDSKGANGAQ------NNFTATITVTVVEVLSNGNLVVSGEKQMAVGQGTES 192

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +  +G+V P  V+  N+V   ++A+AR+ Y G G   E
Sbjct: 193 IKFSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAE 230


>gi|192359552|ref|YP_001982397.1| flagellar L-ring protein FlgH [Cellvibrio japonicus Ueda107]
 gi|190685717|gb|ACE83395.1| flagellar L-ring protein FlgH [Cellvibrio japonicus Ueda107]
          Length = 229

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 96/216 (44%), Gaps = 22/216 (10%)

Query: 6   FIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
            +++   SLL GC  +   I   P  +P   ++  N  +P            +   SL++
Sbjct: 10  LLMVSAVSLLIGCGGNRKPIADDPAYAP---TIASNMSVP-----------QRTEGSLYQ 55

Query: 66  DSH-AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT- 123
           D +  +LF D +A  VGD++TV   + ++ V    +G +         + G  L    T 
Sbjct: 56  DVYGVSLFNDRKAHFVGDVITV--TLSERTVSRKSSGVTTGKKSGVNFNAGPLLGANPTI 113

Query: 124 --PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
              ++   L  D      G     ++  L   I   V  IL NGNLI+ G + + +N   
Sbjct: 114 KDRELTTTLTQDR--TFDGSADADQSNSLQGNITVTVAEILPNGNLIVRGEKWITLNRGD 171

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
             + ++GIVRP+D+   N++   ++A A+ISY G G
Sbjct: 172 EFIRISGIVRPEDIAPDNTIVSTRLANAKISYSGTG 207


>gi|33601544|ref|NP_889104.1| flagellar basal body L-ring protein [Bordetella bronchiseptica
           RB50]
 gi|81431030|sp|Q7WJD2|FLGH_BORBR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|33575980|emb|CAE33059.1| flagellar L-ring protein precursor [Bordetella bronchiseptica RB50]
          Length = 230

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 78/159 (49%), Gaps = 15/159 (9%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ----- 125
           LF+D R  NVGDI+T+        V + +T  ++  + +    G  +L     P+     
Sbjct: 64  LFEDRRPRNVGDIVTI--------VLEEKTNAAKGVATNTSRDGSATLGVAAAPRFMDGI 115

Query: 126 MNGNLNYD--GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
           +N  L+ D  GG  ++G G  S        I   V  +L NGNL I+G +++ +N     
Sbjct: 116 INDKLDTDISGGNTANGTGKSSANNTFTGTITTTVIGVLPNGNLQIAGEKQIAINRGSEY 175

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
           +  +G+V P+ +   N+VS  ++A+ARI Y  KG   E+
Sbjct: 176 VRFSGVVDPRSITGSNTVSSTRVADARIEYRSKGVMDEV 214


>gi|33592482|ref|NP_880126.1| flagellar basal body L-ring protein [Bordetella pertussis Tohama I]
 gi|81425268|sp|Q7VYG3|FLGH_BORPE RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|33572128|emb|CAE41670.1| flagellar L-ring protein precursor [Bordetella pertussis Tohama I]
 gi|332381899|gb|AEE66746.1| flagellar basal body L-ring protein [Bordetella pertussis CS]
          Length = 229

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 78/159 (49%), Gaps = 15/159 (9%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ----- 125
           LF+D R  NVGDI+T+        V + +T  ++  + +    G  +L     P+     
Sbjct: 63  LFEDRRPRNVGDIVTI--------VLEEKTNAAKGVATNTSRDGSATLGVAAAPRFMDGI 114

Query: 126 MNGNLNYD--GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
           +N  L+ D  GG  ++G G  S        I   V  +L NGNL I+G +++ +N     
Sbjct: 115 INDKLDTDISGGNTANGTGKSSANNTFTGTITTTVIGVLPNGNLQIAGEKQIAINRGSEY 174

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
           +  +G+V P+ +   N+VS  ++A+ARI Y  KG   E+
Sbjct: 175 VRFSGVVDPRSITGSNTVSSTRVADARIEYRSKGVMDEV 213


>gi|330953728|gb|EGH53988.1| flagellar basal body L-ring protein [Pseudomonas syringae Cit 7]
          Length = 237

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 81/178 (45%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D +A  +GDI+T+ +  R+       +   +   NS+     G  SLFG      N 
Sbjct: 64  LYGDRKAFRIGDIITITLSERMAASKAATSAMTKDSTNSI-----GLTSLFGSGLTTNNP 118

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N  Y+G   + G G  +++  L   +   V  +L NG L + G + + +N  
Sbjct: 119 IGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILAVRGEKWMTLNTG 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 179 DELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 234


>gi|238755321|ref|ZP_04616664.1| Flagellar L-ring protein [Yersinia ruckeri ATCC 29473]
 gi|238706457|gb|EEP98831.1| Flagellar L-ring protein [Yersinia ruckeri ATCC 29473]
          Length = 219

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 77/170 (45%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  LF+D R  NVGD LT+ ++ +  A   +    SRN S    ++              
Sbjct: 49  YQPLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRYLEGLLGNAR 108

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            +++  G  +  GKG  +     +  I   V  +L NGNL + G +++ +N     +  +
Sbjct: 109 ADMDISGDNSFGGKGGANANNTFSGTITVTVNQVLANGNLHVVGEKQIAINQGTEFIRFS 168

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
           G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 169 GVVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQNMGWLQRFFLNVSP 218


>gi|156973590|ref|YP_001444497.1| flagellar basal body L-ring protein [Vibrio harveyi ATCC BAA-1116]
 gi|156525184|gb|ABU70270.1| hypothetical protein VIBHAR_01293 [Vibrio harveyi ATCC BAA-1116]
          Length = 260

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 86/169 (50%), Gaps = 9/169 (5%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+   H   L+ DS+   +GDI+TV +    +A    +   S+ N    +     S+ G
Sbjct: 85  SLFSTEHITDLYDDSKPRGIGDIITVTLDETTRATKSAKADLSKTNDAKME---PLSVGG 141

Query: 121 QQTPQMNG--NLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           Q+  ++ G  N +YD    ++  G  S  ++  ++  I   V  +L NGNL+I G + + 
Sbjct: 142 QEL-KIGGKYNFSYDLNNTNTFAGDSSAKQSNSISGYITVEVIEVLANGNLVIRGEKWMT 200

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           +N     + ++G +RP D++  N+++ ++++ ARI Y G G   ++  P
Sbjct: 201 LNTGDEYIRLSGTIRPDDINFDNTIASNRVSNARIQYSGTGSPQDMQEP 249


>gi|71736849|ref|YP_275558.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257484943|ref|ZP_05638984.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|110816535|sp|Q48GC5|FLGH_PSE14 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|71557402|gb|AAZ36613.1| flagellar L-ring protein FlgH [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320325097|gb|EFW81166.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329356|gb|EFW85349.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330880530|gb|EGH14679.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330986472|gb|EGH84575.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011046|gb|EGH91102.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 237

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 81/178 (45%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D +A  +GDI+T+ +  R+       +   +   NS+     G  SLFG      N 
Sbjct: 64  LYGDRKAFRIGDIITITLSERMAASKAATSAMTKDSTNSI-----GLTSLFGSGLTTNNP 118

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N  Y+G   + G G  +++  L   +   V  +L NG L + G + + +N  
Sbjct: 119 IGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILAVRGEKWMTLNTG 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 179 DELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 234


>gi|49205095|dbj|BAC75959.2| flagellar L-ring protein FlgH [Pseudomonas syringae pv. tabaci]
          Length = 222

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 81/178 (45%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D +A  +GDI+T+ +  R+       +   +   NS+     G  SLFG      N 
Sbjct: 49  LYGDRKAFRIGDIITITLSERMAASKAATSAMTKDSTNSI-----GLTSLFGSGLTTNNP 103

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N  Y+G   + G G  +++  L   +   V  +L NG L + G + + +N  
Sbjct: 104 IGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILAVRGEKWMTLNTG 163

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 164 DELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 219


>gi|332161325|ref|YP_004297902.1| flagellar basal body L-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318605245|emb|CBY26743.1| flagellar L-ring protein FlgH [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665555|gb|ADZ42199.1| flagellar basal body L-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 238

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 98/239 (41%), Gaps = 18/239 (7%)

Query: 3   RYSFIVLCYSSLLFGC----HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           R+    L  + LL GC    H S+ + +   Q +P  + L         G  F+ +    
Sbjct: 13  RWVGAPLMATLLLNGCAYIPHKSLVDGSTSAQPAPASAPLPN-------GSIFQAAQPMN 65

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
             Y         LF+D R  NVGD LT+ ++ +  A   +    SRN S    ++     
Sbjct: 66  YGYQ-------PLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRY 118

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                     +++  G     GKG  +     +  I   V  +L NGNL + G +++ +N
Sbjct: 119 LEGLLGNARADMDISGDNTFGGKGGANANNTFSGTITVTVDQVLANGNLHVVGEKQIAIN 178

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 179 QGTEFIRFSGVVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 237


>gi|123442781|ref|YP_001006758.1| flagellar basal body L-ring protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089742|emb|CAL12595.1| flagellar L-ring protein precursor [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 227

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 98/239 (41%), Gaps = 18/239 (7%)

Query: 3   RYSFIVLCYSSLLFGC----HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTK 58
           R+    L  + LL GC    H S+ + +   Q +P  + L         G  F+ +    
Sbjct: 2   RWVGAPLMATLLLNGCAYIPHKSLVDGSTSAQPAPASAPLPN-------GSIFQAAQPMN 54

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
             Y         LF+D R  NVGD LT+ ++ +  A   +    SRN S    ++     
Sbjct: 55  YGYQ-------PLFEDRRPRNVGDTLTITLQENVSASKSSSANASRNGSSKFGVATAPRY 107

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                     +++  G     GKG  +     +  I   V  +L NGNL + G +++ +N
Sbjct: 108 LEGLLGNARADMDISGDNTFGGKGGANANNTFSGTITVTVDQVLANGNLHVVGEKQIAIN 167

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 168 QGTEFIRFSGVVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 226


>gi|50120642|ref|YP_049809.1| flagellar basal body L-ring protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611168|emb|CAG74614.1| flagellar L-ring protein [Pectobacterium atrosepticum SCRI1043]
          Length = 239

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 80/180 (44%), Gaps = 18/180 (10%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT---- 123
           +  +F+D R  N+GD LT+ ++ +  A   +    +RN         G S FG  T    
Sbjct: 69  YQPMFEDRRPRNIGDTLTIVLQENVSASKSSSANAARN---------GSSTFGVATTPRY 119

Query: 124 ---PQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
              P  N     D  G +  SGKG  +     +  I   V  +L NGNL + G +++ +N
Sbjct: 120 LEGPLGNNRAALDATGTNDFSGKGGANANNTFSGTITVTVGQVLANGNLNVVGEKQIAIN 179

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
                +  +G+V P+ +  +NSV   ++A+ARI Y G G   E        +   N+SP 
Sbjct: 180 QGTEFIRFSGVVNPRTISGNNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNVSPF 239


>gi|238758107|ref|ZP_04619287.1| Flagellar L-ring protein [Yersinia aldovae ATCC 35236]
 gi|238703645|gb|EEP96182.1| Flagellar L-ring protein [Yersinia aldovae ATCC 35236]
          Length = 237

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 96/235 (40%), Gaps = 32/235 (13%)

Query: 14  LLFGC----HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA 69
           LL GC    H  + E T   Q +P  + L         G  F+ +      Y        
Sbjct: 23  LLNGCAYIPHKPLVEGTTSAQPAPASAPLPN-------GSIFQAAQPMNYGYQ------- 68

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS-------LHRKLSGGFSLFGQQ 122
            LF+D R  N+GD LT+ ++ +  A   +    SRN S         R L G   L G  
Sbjct: 69  PLFEDRRPRNIGDTLTITLQENVSASKSSSANASRNGSSKFGVATTPRYLEG---LLGN- 124

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
                 +++  G     GKG  +     +  I   V  +L NGNL + G +++ +N    
Sbjct: 125 ---ARADMDISGDNTFGGKGGANANNTFSGTITVTVDQVLANGNLHVVGEKQIAINQGTE 181

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
            +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 182 FIRFSGVVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNISP 236


>gi|332140549|ref|YP_004426287.1| flagellar basal body L-ring protein [Alteromonas macleodii str.
           'Deep ecotype']
 gi|226701911|sp|B4RV30|FLGH_ALTMD RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|327550571|gb|AEA97289.1| flagellar basal body L-ring protein [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 226

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 82/164 (50%), Gaps = 15/164 (9%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLH--RKLSGGF 116
           SL+R   A  L+ D  A  VGDI+TV +  + QA    D  T +  N +L+    L+G  
Sbjct: 48  SLFRSQLANNLYSDVTARRVGDIITVTLSENTQASKSADTSTAKDTNVNLNPITGLAGQA 107

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQ 173
              G ++ Q+  + + D  G ++       A + N LI AI   V  +L N NL+I G +
Sbjct: 108 INIGGESIQLGVSSSRDFSGDAA-------ANQSNSLIGAISVTVVDVLPNSNLVIRGEK 160

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + +N     + +TGI+RP D+   N +   K+A ARI Y G G
Sbjct: 161 WLTLNQGDEYIRLTGIIRPADISPENEIVSTKVANARIQYSGTG 204


>gi|309779450|ref|ZP_07674211.1| flagellar L-ring protein FlgH [Ralstonia sp. 5_7_47FAA]
 gi|308921691|gb|EFP67327.1| flagellar L-ring protein FlgH [Ralstonia sp. 5_7_47FAA]
          Length = 232

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 70/156 (44%), Gaps = 12/156 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           +F+D RA  VGD  T+ I I +      QT  S N +    L+     F    P   G L
Sbjct: 67  MFEDRRAHMVGD--TITIVITENTAASKQTSGSVNRT--GSLTASVPTFAGMNP---GVL 119

Query: 131 NYDGGGASSG-----KGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           +  G  AS       KG+          I   V  +L NGNL++SG ++  V     S+ 
Sbjct: 120 SLLGVSASDANKFDSKGANGAQNNFTATITVTVVEVLSNGNLVVSGEKQTAVGQGTESVK 179

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            +G+V P  V+  N+V   ++A+AR+ Y G G   E
Sbjct: 180 FSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAE 215


>gi|115311514|sp|Q6D6H3|FLGH_ERWCT RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 237

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 80/180 (44%), Gaps = 18/180 (10%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT---- 123
           +  +F+D R  N+GD LT+ ++ +  A   +    +RN         G S FG  T    
Sbjct: 67  YQPMFEDRRPRNIGDTLTIVLQENVSASKSSSANAARN---------GSSTFGVATTPRY 117

Query: 124 ---PQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
              P  N     D  G +  SGKG  +     +  I   V  +L NGNL + G +++ +N
Sbjct: 118 LEGPLGNNRAALDATGTNDFSGKGGANANNTFSGTITVTVGQVLANGNLNVVGEKQIAIN 177

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
                +  +G+V P+ +  +NSV   ++A+ARI Y G G   E        +   N+SP 
Sbjct: 178 QGTEFIRFSGVVNPRTISGNNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNVSPF 237


>gi|17548569|ref|NP_521909.1| flagellar L-ring protein precursor [Ralstonia solanacearum GMI1000]
 gi|17430817|emb|CAD17499.1| probable flagellar l-ring protein precursor (basal body l-ring
           protein) [Ralstonia solanacearum GMI1000]
          Length = 244

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 71/156 (45%), Gaps = 12/156 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           +F+D RA  VGD  T+ I I +      QT  S + S  +  S     F    P   G L
Sbjct: 79  MFEDRRAHMVGD--TITIVITENTAASKQTSGSVDRSGSKTTS--VPTFAGMNP---GVL 131

Query: 131 NYDGGGASSG-----KGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           +  G  AS       KG+          I   V  +L NGNL++SG +++ V     S+ 
Sbjct: 132 SLLGVSASDANKFDSKGANGATNNFTATITVTVVEVLSNGNLVVSGEKQMAVGQGTESIK 191

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            +G+V P  V+  N+V   ++A+AR+ Y G G   E
Sbjct: 192 FSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAE 227


>gi|238794001|ref|ZP_04637619.1| Flagellar L-ring protein [Yersinia intermedia ATCC 29909]
 gi|238726633|gb|EEQ18169.1| Flagellar L-ring protein [Yersinia intermedia ATCC 29909]
          Length = 237

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 99/237 (41%), Gaps = 36/237 (15%)

Query: 14  LLFGC----HSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHA 69
           LL GC    H S+ + T   Q +P  + L         G  F+ +      Y        
Sbjct: 23  LLNGCAYIPHKSLVDGTTSAQPAPASAPLPN-------GSIFQAAQPMNYGYQ------- 68

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT-PQ--- 125
            LF+D R  NVGD LT+ ++ +  A   +    SRN         G S FG  T P+   
Sbjct: 69  PLFEDRRPRNVGDTLTITLQENVSASKSSSANASRN---------GASKFGVATSPRYLE 119

Query: 126 -MNGNLNYD----GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            + GN   D    G     GKG  +     +  I   V  +L NGNL + G +++ +N  
Sbjct: 120 GLLGNARADMDISGDNTFGGKGGANANNTFSGTITVTVDRVLANGNLHVVGEKQIAINQG 179

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
              +  +G+V P+ +   N+V+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 180 TEFIRFSGVVNPRTISGSNTVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNISP 236


>gi|330875987|gb|EGH10136.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 237

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 80/178 (44%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D +A  VGDI+T+ +  R+       +   +   NS+     G  SLFG      N 
Sbjct: 64  LYGDRKAFRVGDIITITLSERMAASKAATSAMTKDSTNSI-----GLTSLFGSGLTTNNP 118

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N  Y G   + G G  +++  L   +   V  +L NG L + G + + +N  
Sbjct: 119 IGGNDLSLNAGYTGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILSVRGEKWMTLNTG 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 179 DELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 234


>gi|289670512|ref|ZP_06491587.1| flagellar basal body L-ring protein [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 160

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 75/146 (51%), Gaps = 16/146 (10%)

Query: 80  VGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS---LFGQQTPQMNGNLNY---- 132
           VGD+LTV++      V       + N S+ +K +   S   L G   P   G LN     
Sbjct: 1   VGDLLTVNL------VESTTASSTANTSISKKDATTMSAPTLLG--APLTVGGLNVLENS 52

Query: 133 -DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVR 191
            +G  + +GKG+ +++ ++   +   V   L NGNL+I G + +R+      + V GIVR
Sbjct: 53  TNGDRSFAGKGNTAQSNRMQGSVTVTVMQRLPNGNLVIQGQKNLRLTQGDELVQVQGIVR 112

Query: 192 PQDVDAHNSVSYDKIAEARISYGGKG 217
             D+   N+V   ++A+ARI+YGG+G
Sbjct: 113 AADIAPDNTVPSSRVADARIAYGGRG 138


>gi|28869145|ref|NP_791764.1| flagellar L-ring protein FlgH [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213967578|ref|ZP_03395726.1| flagellar L-ring protein FlgH [Pseudomonas syringae pv. tomato T1]
 gi|301385717|ref|ZP_07234135.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           tomato Max13]
 gi|302060070|ref|ZP_07251611.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           tomato K40]
 gi|302134829|ref|ZP_07260819.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|31076678|sp|Q884Z5|FLGH_PSESM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|28852385|gb|AAO55459.1| flagellar L-ring protein FlgH [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213927879|gb|EEB61426.1| flagellar L-ring protein FlgH [Pseudomonas syringae pv. tomato T1]
          Length = 237

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 82/178 (46%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN- 127
           L+ D +A  VGDI+T+ +  R+       +   +   NS+     G  SLFG      N 
Sbjct: 64  LYGDRKAFRVGDIITITLSERMAASKAATSAMSKDSTNSI-----GLTSLFGSGLTTNNP 118

Query: 128 --GN-----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
             GN       Y+G   + G G  +++  L   +   V  +L NG L + G + + +N  
Sbjct: 119 IGGNDLSLSAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILSVRGEKWMTLNTG 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 179 DELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 234


>gi|330967094|gb|EGH67354.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 263

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 80/178 (44%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D +A  VGDI+T+ +  R+       +   +   NS+     G  SLFG      N 
Sbjct: 90  LYGDRKAFRVGDIITITLSERMAASKAATSAMTKDSTNSI-----GLTSLFGSGLTTNNP 144

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N  Y G   + G G  +++  L   +   V  +L NG L + G + + +N  
Sbjct: 145 IGGNDLSLNAGYTGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILSVRGEKWMTLNTG 204

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 205 DELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 260


>gi|289627767|ref|ZP_06460721.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651642|ref|ZP_06482985.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298487852|ref|ZP_07005892.1| Flagellar L-ring protein flgH [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157577|gb|EFH98657.1| Flagellar L-ring protein flgH [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330866426|gb|EGH01135.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 237

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 80/178 (44%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D +A  +GDI+T+ +  R+       +   +   NS+     G  SLFG      N 
Sbjct: 64  LYGDRKAFRIGDIITITLSERMAASKAATSAMTKDSTNSI-----GLTSLFGSGLTTNNP 118

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N  Y G   + G G  +++  L   +   V  +L NG L + G + + +N  
Sbjct: 119 IGGNDLSLNAGYTGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILAVRGEKWMTLNTG 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 179 DELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 234


>gi|88911318|sp|Q8XSW9|FLGH_RALSO RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 229

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 71/156 (45%), Gaps = 12/156 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           +F+D RA  VGD  T+ I I +      QT  S + S  +  S     F    P   G L
Sbjct: 64  MFEDRRAHMVGD--TITIVITENTAASKQTSGSVDRSGSKTTS--VPTFAGMNP---GVL 116

Query: 131 NYDGGGASSG-----KGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           +  G  AS       KG+          I   V  +L NGNL++SG +++ V     S+ 
Sbjct: 117 SLLGVSASDANKFDSKGANGATNNFTATITVTVVEVLSNGNLVVSGEKQMAVGQGTESIK 176

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            +G+V P  V+  N+V   ++A+AR+ Y G G   E
Sbjct: 177 FSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAE 212


>gi|299068735|emb|CBJ39974.1| flagellar protein of basal-body outer-membrane L ring [Ralstonia
           solanacearum CMR15]
          Length = 244

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 71/156 (45%), Gaps = 12/156 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           +F+D RA  VGD  T+ I I +      QT  S + S    ++     F    P   G L
Sbjct: 79  MFEDRRAHMVGD--TITIVITENTAASKQTSGSVDRS--GSMTASVPTFAGMNP---GVL 131

Query: 131 NYDGGGASSG-----KGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           +  G  AS       KG+          I   V  +L NGNL++SG +++ V     S+ 
Sbjct: 132 SLLGVSASDANKFDSKGANGATNNFTATITVTVVEVLSNGNLVVSGEKQMAVGQGTESIK 191

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            +G+V P  V+  N+V   ++A+AR+ Y G G   E
Sbjct: 192 FSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAE 227


>gi|146281774|ref|YP_001171927.1| flagellar basal body L-ring protein [Pseudomonas stutzeri A1501]
 gi|166214825|sp|A4VJD4|FLGH_PSEU5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|145569979|gb|ABP79085.1| flagellar L-ring protein precursor FlgH [Pseudomonas stutzeri
           A1501]
          Length = 231

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 81/163 (49%), Gaps = 11/163 (6%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN--- 127
           L+ D +A  VGDI+T+ +    QA  +  +  S+++S +  L    SLFG      N   
Sbjct: 58  LYDDRKAYRVGDIITITLAERTQASKNASSSISKDSSANIGLG---SLFGGAVSMANPLT 114

Query: 128 GN-----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           GN       YD    +SG G   ++  L+  I   V+ +L NG L + G + + +N    
Sbjct: 115 GNSMSLGAEYDASRDTSGSGQAGQSNSLSGSITVTVSEVLPNGILAVRGEKWMTLNTGDE 174

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P
Sbjct: 175 LVRIAGLVRQDDIATDNTVSSTRIADARITYSGTGAFADASQP 217


>gi|317047694|ref|YP_004115342.1| flagellar L-ring protein [Pantoea sp. At-9b]
 gi|316949311|gb|ADU68786.1| flagellar L-ring protein [Pantoea sp. At-9b]
          Length = 236

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 82/180 (45%), Gaps = 16/180 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+ S      G F L    T  +N
Sbjct: 64  YQPLFEDRRPRNIGDTLTITLQENVSASKSSSANASRDGS------GSFGLTTVPT-GLN 116

Query: 128 G-------NLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
           G        +  DG G +  +GKG  +        I   V  +L NGNL + G +++ +N
Sbjct: 117 GLVGASGEKVGLDGEGKNDFTGKGGATANNTFTGTITVTVNQVLSNGNLRVVGEKQIEIN 176

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
                +  +G+V P+ + A N+V    +A+ARI Y G G   E        +   N+SP+
Sbjct: 177 QGTEFIRFSGVVNPRTISASNAVLSTAVADARIEYVGNGYINEAQTMGWFQRFFLNVSPM 236


>gi|300696916|ref|YP_003747577.1| flagellar protein of basal-body outer-membrane L ring [Ralstonia
           solanacearum CFBP2957]
 gi|299073640|emb|CBJ53160.1| flagellar protein of basal-body outer-membrane L ring [Ralstonia
           solanacearum CFBP2957]
          Length = 244

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 71/160 (44%), Gaps = 20/160 (12%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS---------GGFSLFGQ 121
           +F+D RA  VGD  T+ I I +      QT  S + S  +  S         G  SL G 
Sbjct: 79  MFEDRRAHMVGD--TITIVITENTAASKQTSGSVDRSGSKTTSVPTFAGMNPGVLSLLGV 136

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                N    +D  GA+  +            I   V  +L NGNL++SG +++ V    
Sbjct: 137 SASDAN---KFDSKGANGAQ------NNFTATITVTVVEVLSNGNLVVSGEKQMAVGQGT 187

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            S+  +G+V P  V+  N+V   ++A+AR+ Y G G   E
Sbjct: 188 ESIKFSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAE 227


>gi|253688969|ref|YP_003018159.1| flagellar L-ring protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251755547|gb|ACT13623.1| flagellar L-ring protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 239

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 80/180 (44%), Gaps = 18/180 (10%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT---- 123
           +  +F+D R  N+GD LT+ ++ +  A   +    +RN         G S FG  T    
Sbjct: 69  YQPMFEDRRPRNIGDTLTIVLQENVSASKSSSANAARN---------GSSTFGVTTTPRY 119

Query: 124 ---PQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
              P  N     D  G +  +GKG  +     +  I   V  +L NGNL + G +++ +N
Sbjct: 120 LEGPLGNNRAALDATGTNDFTGKGGANANNTFSGTITVTVGQVLANGNLQVVGEKQIAIN 179

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
                +  +G+V P+ +  +NSV   ++A+ARI Y G G   E        +   N+SP 
Sbjct: 180 QGTEFIRFSGVVNPRTISGNNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNVSPF 239


>gi|331017021|gb|EGH97077.1| flagellar basal body L-ring protein [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 237

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 82/178 (46%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN- 127
           L+ D +A  VGDI+T+ +  R+       +   +   NS+     G  SLFG      N 
Sbjct: 64  LYGDRKAFRVGDIITITLSERMAASKAATSAMSKDSTNSI-----GLTSLFGSGLTTNNP 118

Query: 128 --GN-----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
             GN       Y+G   + G G  +++  L   +   V  +L NG L + G + + +N  
Sbjct: 119 IGGNDLSLSAGYNGARTTKGDGKAAQSNSLTGSVTVTVADVLPNGILSVRGEKWMTLNTG 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 179 DELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 234


>gi|83747651|ref|ZP_00944687.1| FlgH [Ralstonia solanacearum UW551]
 gi|207739734|ref|YP_002258127.1| flagellar l-ring protein precursor [Ralstonia solanacearum IPO1609]
 gi|83725703|gb|EAP72845.1| FlgH [Ralstonia solanacearum UW551]
 gi|206593116|emb|CAQ60022.1| flagellar l-ring protein precursor (basal body l-ring protein)
           [Ralstonia solanacearum IPO1609]
          Length = 244

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 71/160 (44%), Gaps = 20/160 (12%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS---------GGFSLFGQ 121
           +F+D RA  VGD  T+ I I +      QT  S + S  +  S         G  SL G 
Sbjct: 79  MFEDRRAHMVGD--TITIVITENTAASKQTSGSVDRSGSKTTSVPTFAGMNPGVLSLLGV 136

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                N    +D  GA+  +            I   V  +L NGNL++SG +++ V    
Sbjct: 137 SASDAN---KFDSKGANGAQ------NNFTATITVTVVEVLSNGNLVVSGEKQMAVGQGT 187

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            S+  +G+V P  V+  N+V   ++A+AR+ Y G G   E
Sbjct: 188 ESIKFSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAE 227


>gi|330889079|gb|EGH21740.1| flagellar basal body L-ring protein [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 237

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 80/178 (44%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D +A  +GDI+T+ +  R+       +   +   NS+     G  SLFG      N 
Sbjct: 64  LYGDRKAFRIGDIITITLSERMAASKAATSAMTKDSTNSI-----GLTSLFGSGLTTNNP 118

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N  Y+G   + G G  +++  L   +   V   L NG L + G + + +N  
Sbjct: 119 IGGNDLSLNAGYNGARTTKGDGKAAQSNSLTGSVTVTVADFLPNGILAVRGEKWMTLNTG 178

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  +IA+ARI+Y G G   +  +P    +    LSPL
Sbjct: 179 DELVRIAGLVRADDIATDNTVSSTRIADARITYSGTGAFADTSQPGWFDRFF--LSPL 234


>gi|300114796|ref|YP_003761371.1| flagellar l-ring protein [Nitrosococcus watsonii C-113]
 gi|299540733|gb|ADJ29050.1| flagellar L-ring protein [Nitrosococcus watsonii C-113]
          Length = 234

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 78/165 (47%), Gaps = 10/165 (6%)

Query: 70  ALFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRK--LSGGFSLFGQQTPQ 125
           +LF D RA  VGD+LT+ +  R   +   D    R+ + SL     L  G          
Sbjct: 55  SLFTDFRAQRVGDVLTIVLEERTTGEKGSDTAIDRNTSYSLTNPTLLGSGVQFNTPNWVP 114

Query: 126 MNGNLN------YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           +  N N          GA SG G  S+  +L+  I   V  +L NGNL++ G + + +N 
Sbjct: 115 LASNQNNSLEMAVKSKGAFSGSGDSSQNNRLSGHITVTVAEVLPNGNLVVRGEKVITINH 174

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
               + ++GIV  + ++  N+VS   +A+ARI+Y G G T E  R
Sbjct: 175 GNEYIKISGIVNRRYINPDNTVSSLNLADARIAYVGDGATQEANR 219


>gi|70729007|ref|YP_258741.1| flagellar basal body L-ring protein [Pseudomonas fluorescens Pf-5]
 gi|110816536|sp|Q4KG92|FLGH_PSEF5 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|68343306|gb|AAY90912.1| flagellar L-ring protein FlgH [Pseudomonas fluorescens Pf-5]
          Length = 231

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 86/178 (48%), Gaps = 17/178 (9%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG----QQTP 124
           L+ D +A  VGDI+T+ +  R +     ++   ++ +NS+     G  SLFG       P
Sbjct: 58  LYSDRKAFRVGDIITITLNERTNASKGANSALTKTSSNSI-----GLTSLFGAVPNTNNP 112

Query: 125 QMNGNLN----YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
             +G+L     Y G  A+ G    +++  L   I   V  +L NG + + G + + +N  
Sbjct: 113 LGDGDLTLNAGYSGNRATKGDSKAAQSNSLTGSITVTVADVLPNGIIAVRGEKWMTLNTG 172

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              + + G+VR  D+   N+VS  ++A+ARI+Y G G   +  +P    +    LSPL
Sbjct: 173 DELVRIAGLVRADDIATDNTVSSTRVADARITYSGTGSFADANQPGWFDRFF--LSPL 228


>gi|330808198|ref|YP_004352660.1| flagellar L-ring protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376306|gb|AEA67656.1| flagellar L-ring protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 231

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 78/165 (47%), Gaps = 15/165 (9%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           L+ D +A  VGDI+T+ +    QA    ++Q  ++ N S+     G  SLFG      N 
Sbjct: 58  LYSDRKAFRVGDIITITLNERTQASKNANSQMDKTSNTSV-----GLTSLFGSSLTTNNP 112

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   N  Y+   A+ G     ++  L   I   V  +L NG +++ G + + +N  
Sbjct: 113 IGGNDLSLNAGYNSDRATKGDSKSGQSNSLTGSITVTVADVLPNGIIVVRGEKWLTLNTG 172

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
              + + G+VR  D+   N+VS  ++A+ARI+Y G G   +  +P
Sbjct: 173 DELVRIAGMVRADDIATDNTVSSTRVADARITYSGTGAFADASQP 217


>gi|27363702|ref|NP_759230.1| flagellar basal body L-ring protein [Vibrio vulnificus CMCP6]
 gi|31076699|sp|Q8DFJ1|FLGH_VIBVU RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|27359818|gb|AAO08757.1| Flagellar L-ring protein flgH [Vibrio vulnificus CMCP6]
          Length = 259

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 85/173 (49%), Gaps = 17/173 (9%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
           SL+  +H + L+ DS+   VGDI+TV          D +T  S++ +     S   S+  
Sbjct: 84  SLFSVNHLSNLYDDSKPRGVGDIITV--------TLDEKTNASKSANADLSKSNDSSMDP 135

Query: 119 --FGQQTPQMNGNLNYDGGGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
              G Q  +++G  N+     +S    G  S  ++  ++  I   V  +L NGNL+I G 
Sbjct: 136 LEVGGQELKIDGKYNFSYNLTNSNNFTGDASAKQSNSISGYITVEVIEVLANGNLVIRGE 195

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           + + +N     + ++G +RP D+   N+++ ++++ ARI Y G G   ++  P
Sbjct: 196 KWLTLNTGDEYIRLSGTIRPDDISFDNTIASNRVSNARIQYSGTGTQQDMQEP 248


>gi|37679150|ref|NP_933759.1| flagellar basal body L-ring protein [Vibrio vulnificus YJ016]
 gi|320157106|ref|YP_004189485.1| flagellar L-ring protein FlgH [Vibrio vulnificus MO6-24/O]
 gi|61213555|sp|Q7MMV1|FLGH_VIBVY RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|37197892|dbj|BAC93730.1| flagellar basal body L-ring protein FlgH [Vibrio vulnificus YJ016]
 gi|319932418|gb|ADV87282.1| flagellar L-ring protein FlgH [Vibrio vulnificus MO6-24/O]
          Length = 259

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 85/173 (49%), Gaps = 17/173 (9%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL-- 118
           SL+  +H + L+ DS+   VGDI+TV          D +T  S++ +     S   S+  
Sbjct: 84  SLFSVNHLSNLYDDSKPRGVGDIITV--------TLDEKTNASKSANADLSKSNDSSMDP 135

Query: 119 --FGQQTPQMNGNLNYDGGGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
              G Q  +++G  N+     +S    G  S  ++  ++  I   V  +L NGNL+I G 
Sbjct: 136 LEVGGQELKIDGKYNFSYNLTNSNNFTGDASAKQSNSISGYITVEVIEVLANGNLVIRGE 195

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           + + +N     + ++G +RP D+   N+++ ++++ ARI Y G G   ++  P
Sbjct: 196 KWLTLNTGDEYIRLSGTIRPDDISFDNTIASNRVSNARIQYSGTGTQQDMQEP 248


>gi|283856290|ref|YP_162343.2| flagellar L-ring protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|292495079|sp|Q9Z5T8|FLGH_ZYMMO RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|283775286|gb|AAV89232.2| flagellar L-ring protein [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 228

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 77/155 (49%), Gaps = 20/155 (12%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           +   +RA +VGD++T+ +      V      +S N +  R  SGG S+     P   G L
Sbjct: 65  IISGARASHVGDMVTITL------VESFAASKSANTTTSR--SGGASII----PPTTGPL 112

Query: 131 NY----DGGGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           ++    D   +SS    G G+  ++  L+  I A V  +  +G ++I G + + +N    
Sbjct: 113 SFFKATDATASSSHNFKGTGTTGQSNSLSGEITATVARVFPDGTMLIRGEKIMTINRGDE 172

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + ++G+VRP D+D  N V   +I +ARISY G G
Sbjct: 173 HIRISGLVRPWDIDGTNHVLSTRIGDARISYTGTG 207


>gi|260853469|ref|YP_003227360.1| putative lateral flagellar protein of basal-body outer-membrane L
           ring [Escherichia coli O26:H11 str. 11368]
 gi|257752118|dbj|BAI23620.1| predicted lateral flagellar protein of basal-body outer-membrane L
           ring [Escherichia coli O26:H11 str. 11368]
          Length = 246

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 78/152 (51%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++F     +++G 
Sbjct: 82  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPTIFSHTKDKLSGS 138

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 139 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 192

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+A ISY G+G
Sbjct: 193 LSGLVRADDIQNDNSVSSQRIADACISYAGRG 224


>gi|89902480|ref|YP_524951.1| flagellar L-ring protein [Rhodoferax ferrireducens T118]
 gi|89347217|gb|ABD71420.1| flagellar L-ring protein [Rhodoferax ferrireducens T118]
          Length = 243

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 79/161 (49%), Gaps = 12/161 (7%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL--FGQQTP 124
           S+   F+D RA  +GD++T  IRI +  V  +Q  +S  N   R  SG  S+  F   +P
Sbjct: 72  SYRPSFEDPRARMIGDVVT--IRIVEN-VAASQVSKSTAN---RTTSGAASISAFPLVSP 125

Query: 125 QMNGNLNYDGGGAS----SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
               NL    G +S    SGKG    A      I A V  +L NG+L+++G +++ VN  
Sbjct: 126 ADLLNLKAGVGTSSANDFSGKGGTESANTFTGTITATVVRVLPNGHLVVTGDKQIGVNQN 185

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +  L  +G + P  +   N ++  ++A ARI   G+G   E
Sbjct: 186 VDVLRFSGTIDPHLIQPGNLINSSQVANARIESKGRGAQAE 226


>gi|4378855|gb|AAD19723.1| flagellar L-ring protein precursor [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 219

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 78/158 (49%), Gaps = 20/158 (12%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  +   +RA +VGD++T+ +      V      +S N +  R  SGG S+     P   
Sbjct: 58  YMPIISGARASHVGDMVTITL------VESFAASKSANTTTSR--SGGASII----PPTT 105

Query: 128 GNLNY----DGGGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           G L++    D   +SS    G G+  ++  L+  I A V  +  +G ++I G + + +N 
Sbjct: 106 GPLSFFKATDATASSSHNFKGTGTTGQSNSLSGEITATVARVFPDGTMLIRGEKIMTINR 165

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
               + ++G+VRP D+D  N V   +I +ARISY G G
Sbjct: 166 GDEHIRISGLVRPWDIDGTNHVLSTRIGDARISYTGTG 203


>gi|238782795|ref|ZP_04626824.1| Flagellar L-ring protein [Yersinia bercovieri ATCC 43970]
 gi|238716218|gb|EEQ08201.1| Flagellar L-ring protein [Yersinia bercovieri ATCC 43970]
          Length = 260

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 79/171 (46%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  +F+D R  NVGD LT+ ++ +  A   +    +R  S    +    ++         
Sbjct: 90  YQPMFEDRRPRNVGDTLTIVLQENVSASKSSSASANRGGSTGISVDAVPNMLSGLLGGDR 149

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            N    G    SGKG  +     +  I   V  +LENGNL + G +++ +N     +  +
Sbjct: 150 ANTAISGSSDFSGKGGAAARNTFSGTITVTVQQLLENGNLRVVGEKQIAINQGTEFIRFS 209

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           G+V P+ + + N+V   ++++ARI Y G G   E  +     +L  N+SP+
Sbjct: 210 GVVNPRTISSSNTVISTQVSDARIEYVGNGYINEAQQMGWLQRLFLNISPI 260


>gi|322432973|ref|YP_004210222.1| flagellar L-ring protein [Acidobacterium sp. MP5ACTX9]
 gi|321165200|gb|ADW70904.1| flagellar L-ring protein [Acidobacterium sp. MP5ACTX9]
          Length = 231

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 76/170 (44%), Gaps = 10/170 (5%)

Query: 62  SLWRDSHAA--LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR---NNSLHRKLSGGF 116
           SLW  +++   L  D RA NV D + V + +   A        SR     S    L GG 
Sbjct: 54  SLWAAANSLGDLSSDYRARNVNDTIVVQVSVQTTAAQSGNVNSSRAFNTASAITGLPGGV 113

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           S     T   N     +      G G+ +        +   + A+L NGN++I   +++ 
Sbjct: 114 S-----TNATNPLFAANSATTLKGSGATASNTTFATSLTGQIIAVLANGNMVIEAERQIS 168

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPP 226
           +N++   L + GIVRP D+ ++N++    ++   I   GKG  ++ +RPP
Sbjct: 169 MNNQHEDLVIRGIVRPGDISSNNTIPSSSLSNLEIEMKGKGIISDSVRPP 218


>gi|241761148|ref|ZP_04759237.1| flagellar L-ring protein [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260752889|ref|YP_003225782.1| flagellar L-ring protein [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|241374767|gb|EER64228.1| flagellar L-ring protein [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258552252|gb|ACV75198.1| flagellar L-ring protein [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 228

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 77/155 (49%), Gaps = 20/155 (12%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           +   +RA +VGD++T+ +      V      +S N +  R  SGG S+     P   G L
Sbjct: 65  IISGARASHVGDMVTITL------VESFAASKSANTTTSR--SGGASII----PPTTGPL 112

Query: 131 NY----DGGGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           ++    D   +SS    G G+  ++  L+  I A V  +  +G ++I G + + +N    
Sbjct: 113 SFFKATDATASSSHNFKGTGTTGQSNSLSGEITATVARVFPDGTMLIRGEKIMTINRGDE 172

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + ++G+VRP D+D  N V   +I +ARISY G G
Sbjct: 173 HIRISGLVRPWDIDGTNHVLSTRIGDARISYTGTG 207


>gi|207728349|ref|YP_002256743.1| flagellar l-ring protein precursor [Ralstonia solanacearum MolK2]
 gi|206591595|emb|CAQ57207.1| flagellar l-ring protein precursor (basal body l-ring protein)
           [Ralstonia solanacearum MolK2]
          Length = 229

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 71/160 (44%), Gaps = 20/160 (12%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS---------GGFSLFGQ 121
           +F+D RA  VGD  T+ I I +      QT  S + S  +  S         G  SL G 
Sbjct: 64  MFEDRRAHMVGD--TITIVITENTAASKQTSGSVDRSGSKTTSVPTFAGMNPGVLSLLGV 121

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
                N    +D  GA+  +            I   V  +L NGNL++SG +++ V    
Sbjct: 122 SASDAN---KFDSKGANGAQ------NNFTATITVTVVEVLSNGNLVVSGEKQMAVGQGT 172

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            S+  +G+V P  V+  N+V   ++A+AR+ Y G G   E
Sbjct: 173 ESIKFSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAE 212


>gi|34497162|ref|NP_901377.1| flagellar basal body L-ring protein [Chromobacterium violaceum ATCC
           12472]
 gi|81656058|sp|Q7NXC0|FLGH1_CHRVO RecName: Full=Flagellar L-ring protein 1; AltName: Full=Basal body
           L-ring protein 1; Flags: Precursor
 gi|34103019|gb|AAQ59382.1| flagellar L-ring protein flgH [Chromobacterium violaceum ATCC
           12472]
          Length = 217

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 70/148 (47%), Gaps = 6/148 (4%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
           +L  D+RA   GD+LTV +    QA    Q G S       K+  G SL G  T   N  
Sbjct: 54  SLTSDNRAFRPGDVLTVVLEETTQA--SKQAGTSFGKKSGAKI--GPSLIGNTT--FNAQ 107

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           +  D     +G  S ++   L   +  +V  +L NG L + G +++ +N     L V G 
Sbjct: 108 VGIDANRDFNGSSSSTQQNALAGSLTVVVHRVLPNGLLQVKGEKQLTLNQGEEMLRVAGY 167

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKG 217
           VR +D+D  N VS  +IA ARI Y G G
Sbjct: 168 VRVEDIDTDNRVSSLRIANARIGYSGSG 195


>gi|59712478|ref|YP_205254.1| flagellar basal body L-ring protein [Vibrio fischeri ES114]
 gi|197334935|ref|YP_002156697.1| flagellar L-ring protein FlgH [Vibrio fischeri MJ11]
 gi|75353594|sp|Q5E3N0|FLGH_VIBF1 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701937|sp|B5FGS5|FLGH_VIBFM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|59480579|gb|AAW86366.1| flagellar basal body L ring protein FlgH [Vibrio fischeri ES114]
 gi|197316425|gb|ACH65872.1| flagellar L-ring protein FlgH [Vibrio fischeri MJ11]
          Length = 263

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 85/171 (49%), Gaps = 13/171 (7%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGFSL 118
           SL+   HA  ++ D++   +GDI+TV +  + +A    D +  +S ++S+     GG  L
Sbjct: 88  SLFNVDHAQDMYDDTKPRGLGDIVTVMLAENTKAAKSADAELSKSNDSSMDPLQVGGQEL 147

Query: 119 FGQQTPQMNGNLNYD----GGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                 QM G  N+          +G  S +++  L+  I   V  +L NGNL+I G + 
Sbjct: 148 ------QMGGQYNFSYELSNDNNFTGNTSANQSNSLSGSITVEVIEVLSNGNLLIRGEKW 201

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           + +N     + ++G +RP D++  N++   +I+ ARI Y G G   ++  P
Sbjct: 202 LTLNTGDEYIRLSGTIRPDDINFDNTIDSTRISNARIQYSGTGDQQDMQEP 252


>gi|153825366|ref|ZP_01978033.1| flagellar L-ring protein FlgH [Vibrio cholerae MZO-2]
 gi|229528801|ref|ZP_04418191.1| flagellar L-ring protein FlgH [Vibrio cholerae 12129(1)]
 gi|149741050|gb|EDM55119.1| flagellar L-ring protein FlgH [Vibrio cholerae MZO-2]
 gi|229332575|gb|EEN98061.1| flagellar L-ring protein FlgH [Vibrio cholerae 12129(1)]
          Length = 261

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 83/164 (50%), Gaps = 11/164 (6%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG---FSLFGQQT 123
           S ++++ DS+   VGDI+TV +    +A       +S +  L++K        ++ G+  
Sbjct: 93  SSSSMYDDSKPRGVGDIITVTLNESTKAA------KSADADLNKKNDASMDPLAVGGKDL 146

Query: 124 PQMNGNLNY--DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
              + N +Y        SG  + +++  ++  I   V  +L NGNL+I G + + +N   
Sbjct: 147 TIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVEVIEVLANGNLVIRGEKWLTLNTGD 206

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
             + ++G +RP D+D  N+++ ++I+ ARI Y G G   ++  P
Sbjct: 207 EYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEP 250


>gi|297580840|ref|ZP_06942765.1| flagellar L-ring protein FlgH [Vibrio cholerae RC385]
 gi|297534666|gb|EFH73502.1| flagellar L-ring protein FlgH [Vibrio cholerae RC385]
          Length = 261

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 83/164 (50%), Gaps = 11/164 (6%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG---FSLFGQQT 123
           S ++++ DS+   VGDI+TV +    +A       +S +  L++K        ++ G+  
Sbjct: 93  SSSSMYDDSKPRGVGDIITVTLNESTKAA------KSADADLNKKNDASMDPLAVGGKDL 146

Query: 124 PQMNGNLNY--DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
              + N +Y        SG  + +++  ++  I   V  +L NGNL+I G + + +N   
Sbjct: 147 TIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVEVIEVLANGNLVIRGEKWLTLNTGD 206

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
             + ++G +RP D+D  N+++ ++I+ ARI Y G G   ++  P
Sbjct: 207 EYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEP 250


>gi|323498417|ref|ZP_08103413.1| flagellar basal body L-ring protein [Vibrio sinaloensis DSM 21326]
 gi|323316490|gb|EGA69505.1| flagellar basal body L-ring protein [Vibrio sinaloensis DSM 21326]
          Length = 260

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 80/160 (50%), Gaps = 10/160 (6%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF-GQQTPQMNGN 129
           L+ DS+   +GDI+TV +  + +A        S+ N    +      LF G Q  ++ G+
Sbjct: 95  LYDDSKPRGIGDIITVTLDENTKAAKSANADMSKTNDSSME-----PLFVGGQELKVGGD 149

Query: 130 LNY----DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
            N+    +     +G  S +++  L+  I   V  +L NGNL+I G + + +N     + 
Sbjct: 150 YNFSYDLNNTNTFAGDASANQSNSLSGSITVEVIEVLGNGNLVIRGEKWLTLNTGDEYIR 209

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           ++G +RP D+   N+++ ++++ ARI Y G G   ++  P
Sbjct: 210 LSGTIRPDDISFDNTIASNRVSNARIRYSGTGNQQDMQEP 249


>gi|255747107|ref|ZP_05421052.1| flagellar L-ring protein FlgH [Vibrio cholera CIRS 101]
 gi|262161349|ref|ZP_06030459.1| flagellar L-ring protein FlgH [Vibrio cholerae INDRE 91/1]
 gi|262167780|ref|ZP_06035482.1| flagellar L-ring protein FlgH [Vibrio cholerae RC27]
 gi|262191686|ref|ZP_06049862.1| flagellar L-ring protein FlgH [Vibrio cholerae CT 5369-93]
 gi|31077183|sp|Q9KQ13|FLGH_VIBCH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|255735509|gb|EET90909.1| flagellar L-ring protein FlgH [Vibrio cholera CIRS 101]
 gi|262023845|gb|EEY42544.1| flagellar L-ring protein FlgH [Vibrio cholerae RC27]
 gi|262028660|gb|EEY47314.1| flagellar L-ring protein FlgH [Vibrio cholerae INDRE 91/1]
 gi|262032425|gb|EEY50987.1| flagellar L-ring protein FlgH [Vibrio cholerae CT 5369-93]
 gi|327484713|gb|AEA79120.1| Flagellar L-ring protein FlgH [Vibrio cholerae LMA3894-4]
          Length = 258

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 83/164 (50%), Gaps = 11/164 (6%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG---FSLFGQQT 123
           S ++++ DS+   VGDI+TV +    +A       +S +  L++K        ++ G+  
Sbjct: 90  SSSSMYDDSKPRGVGDIITVTLNESTKAA------KSADADLNKKNDASMDPLAVGGKDL 143

Query: 124 PQMNGNLNY--DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
              + N +Y        SG  + +++  ++  I   V  +L NGNL+I G + + +N   
Sbjct: 144 TIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVEVIEVLANGNLVIRGEKWLTLNTGD 203

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
             + ++G +RP D+D  N+++ ++I+ ARI Y G G   ++  P
Sbjct: 204 EYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEP 247


>gi|15642193|ref|NP_231825.1| flagellar basal body L-ring protein [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121586244|ref|ZP_01676034.1| flagellar L-ring protein FlgH [Vibrio cholerae 2740-80]
 gi|121726527|ref|ZP_01679776.1| flagellar L-ring protein FlgH [Vibrio cholerae V52]
 gi|147674828|ref|YP_001217711.1| flagellar basal body L-ring protein [Vibrio cholerae O395]
 gi|153213603|ref|ZP_01948876.1| flagellar L-ring protein FlgH [Vibrio cholerae 1587]
 gi|153817116|ref|ZP_01969783.1| flagellar L-ring protein FlgH [Vibrio cholerae NCTC 8457]
 gi|153820847|ref|ZP_01973514.1| flagellar L-ring protein FlgH [Vibrio cholerae B33]
 gi|153829344|ref|ZP_01982011.1| flagellar L-ring protein FlgH [Vibrio cholerae 623-39]
 gi|183179568|ref|ZP_02957779.1| flagellar L-ring protein FlgH [Vibrio cholerae MZO-3]
 gi|227082318|ref|YP_002810869.1| flagellar L-ring protein FlgH [Vibrio cholerae M66-2]
 gi|229507729|ref|ZP_04397234.1| flagellar L-ring protein FlgH [Vibrio cholerae BX 330286]
 gi|229512076|ref|ZP_04401555.1| flagellar L-ring protein FlgH [Vibrio cholerae B33]
 gi|229513838|ref|ZP_04403300.1| flagellar L-ring protein FlgH [Vibrio cholerae TMA 21]
 gi|229519212|ref|ZP_04408655.1| flagellar L-ring protein FlgH [Vibrio cholerae RC9]
 gi|229522143|ref|ZP_04411560.1| flagellar L-ring protein FlgH [Vibrio cholerae TM 11079-80]
 gi|229524189|ref|ZP_04413594.1| flagellar L-ring protein FlgH [Vibrio cholerae bv. albensis VL426]
 gi|229607233|ref|YP_002877881.1| flagellar basal body L-ring protein [Vibrio cholerae MJ-1236]
 gi|254225804|ref|ZP_04919409.1| flagellar L-ring protein FlgH [Vibrio cholerae V51]
 gi|254849323|ref|ZP_05238673.1| flagellar basal body L-ring protein [Vibrio cholerae MO10]
 gi|298500428|ref|ZP_07010233.1| flagellar L-ring protein FlgH [Vibrio cholerae MAK 757]
 gi|226701936|sp|A5F678|FLGH_VIBC3 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|254789286|sp|C3LPJ8|FLGH_VIBCM RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|9656750|gb|AAF95339.1| flagellar L-ring protein FlgH [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121549510|gb|EAX59536.1| flagellar L-ring protein FlgH [Vibrio cholerae 2740-80]
 gi|121630980|gb|EAX63359.1| flagellar L-ring protein FlgH [Vibrio cholerae V52]
 gi|124115802|gb|EAY34622.1| flagellar L-ring protein FlgH [Vibrio cholerae 1587]
 gi|125621710|gb|EAZ50039.1| flagellar L-ring protein FlgH [Vibrio cholerae V51]
 gi|126512384|gb|EAZ74978.1| flagellar L-ring protein FlgH [Vibrio cholerae NCTC 8457]
 gi|126521639|gb|EAZ78862.1| flagellar L-ring protein FlgH [Vibrio cholerae B33]
 gi|146316711|gb|ABQ21250.1| flagellar L-ring protein FlgH [Vibrio cholerae O395]
 gi|148875185|gb|EDL73320.1| flagellar L-ring protein FlgH [Vibrio cholerae 623-39]
 gi|183012979|gb|EDT88279.1| flagellar L-ring protein FlgH [Vibrio cholerae MZO-3]
 gi|227010206|gb|ACP06418.1| flagellar L-ring protein FlgH [Vibrio cholerae M66-2]
 gi|227014090|gb|ACP10300.1| flagellar L-ring protein FlgH [Vibrio cholerae O395]
 gi|229337770|gb|EEO02787.1| flagellar L-ring protein FlgH [Vibrio cholerae bv. albensis VL426]
 gi|229341068|gb|EEO06073.1| flagellar L-ring protein FlgH [Vibrio cholerae TM 11079-80]
 gi|229343901|gb|EEO08876.1| flagellar L-ring protein FlgH [Vibrio cholerae RC9]
 gi|229349019|gb|EEO13976.1| flagellar L-ring protein FlgH [Vibrio cholerae TMA 21]
 gi|229352041|gb|EEO16982.1| flagellar L-ring protein FlgH [Vibrio cholerae B33]
 gi|229355234|gb|EEO20155.1| flagellar L-ring protein FlgH [Vibrio cholerae BX 330286]
 gi|229369888|gb|ACQ60311.1| flagellar L-ring protein FlgH [Vibrio cholerae MJ-1236]
 gi|254845028|gb|EET23442.1| flagellar basal body L-ring protein [Vibrio cholerae MO10]
 gi|297541121|gb|EFH77175.1| flagellar L-ring protein FlgH [Vibrio cholerae MAK 757]
          Length = 261

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 83/164 (50%), Gaps = 11/164 (6%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG---FSLFGQQT 123
           S ++++ DS+   VGDI+TV +    +A       +S +  L++K        ++ G+  
Sbjct: 93  SSSSMYDDSKPRGVGDIITVTLNESTKAA------KSADADLNKKNDASMDPLAVGGKDL 146

Query: 124 PQMNGNLNY--DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
              + N +Y        SG  + +++  ++  I   V  +L NGNL+I G + + +N   
Sbjct: 147 TIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVEVIEVLANGNLVIRGEKWLTLNTGD 206

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
             + ++G +RP D+D  N+++ ++I+ ARI Y G G   ++  P
Sbjct: 207 EYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEP 250


>gi|32490793|ref|NP_871047.1| flagellar basal body L-ring protein [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|31076694|sp|Q8D3F7|FLGH_WIGBR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|25165999|dbj|BAC24190.1| flgH [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 228

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 97/191 (50%), Gaps = 5/191 (2%)

Query: 50  DFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH 109
           +F N    ++  SL+   +  LF+D R  N+GDILTV ++ +  A   + +  SR ++ +
Sbjct: 41  NFINGSIFQQDNSLYY-GYQPLFEDRRPKNIGDILTVLLQENVSASKSSSSNASRKSNAN 99

Query: 110 RKLSGGFSLFGQ--QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
            +++    +  +     Q++ ++N + G   +GKG  S A   +  I   V  IL NGNL
Sbjct: 100 LEMNALPKIINKIIGNDQLSTDINSNNG--FNGKGGSSAANTFSGTITVTVIDILTNGNL 157

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPI 227
            + G +++ +N    S+   GIV P+ +D +N V  + I++++I Y G G   E+ +   
Sbjct: 158 KVIGEKKISINQGTESIRFYGIVNPKTIDHNNQVMSNLISDSKIEYIGDGYINEVQKMNW 217

Query: 228 GHQLIENLSPL 238
             +L  N  P 
Sbjct: 218 LQRLFLNYFPF 228


>gi|227328341|ref|ZP_03832365.1| flagellar basal body L-ring protein [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 237

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 81/180 (45%), Gaps = 18/180 (10%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT---- 123
           +  +F+D R  N+GD LT+ ++ +  A   +    +RN         G S FG  T    
Sbjct: 67  YQPMFEDRRPRNIGDTLTIVLQENVSASKSSSANAARN---------GASTFGVTTVPRY 117

Query: 124 ---PQMN--GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
              P  N   +LN  G    +G+G  +     +  I   V  +L NGNL + G +++ +N
Sbjct: 118 LEGPLGNNRASLNATGTNDFTGQGGANANNTFSGTITVTVGQVLANGNLQVVGEKQIAIN 177

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
                +  +G+V P+ +  +NSV   ++A+ARI Y G G   E        +   N+SP 
Sbjct: 178 QGTEFIRFSGVVNPRTISGNNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNVSPF 237


>gi|167034940|ref|YP_001670171.1| flagellar basal body L-ring protein [Pseudomonas putida GB-1]
 gi|189044481|sp|B0KR09|FLGH_PSEPG RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|166861428|gb|ABY99835.1| flagellar L-ring protein [Pseudomonas putida GB-1]
          Length = 231

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 79/164 (48%), Gaps = 13/164 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN--- 127
           L+ D +A  VGDI+T+ +     A  +  +   +N+     L+   SLFG  TP  N   
Sbjct: 58  LYSDRKAFRVGDIITITLNEKTSASKNAGSQIQKNSKADIGLT---SLFGS-TPNTNNPF 113

Query: 128 --GNLN----YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
             G+L+    Y+G  A+ G    ++   L   I   V  +L NG + + G + + +N   
Sbjct: 114 GGGDLSLEAGYNGERATKGDSKATQGNTLTGSITVTVAEVLPNGIIAVRGEKWLTLNTGE 173

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
             + + G+VR  D+   N+V   ++A+ARI+Y G G   +  +P
Sbjct: 174 ELVRIAGMVRADDIATDNTVPSTRVADARITYSGTGSFADASQP 217


>gi|332187866|ref|ZP_08389599.1| flagellar L-ring family protein [Sphingomonas sp. S17]
 gi|332012027|gb|EGI54099.1| flagellar L-ring family protein [Sphingomonas sp. S17]
          Length = 231

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 83/176 (47%), Gaps = 9/176 (5%)

Query: 66  DSHAALFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGF-SLFGQQ 122
           D +AAL++  RA  VGD LT+ +  R       +++ G   +  ++   +G   SL    
Sbjct: 62  DGYAALYEGWRARRVGDPLTIVLVERTAASKSANSKLGSKGDLGINPPTTGPLGSLLKST 121

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
              M G+ N++G GA+    S+S        I+  V  +  NG +++ G + V +N    
Sbjct: 122 DIGMGGSRNFNGSGAADQSNSLSGE------ISVTVAQVFPNGTMLVQGQKRVTLNRGDE 175

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            + + G+VR  DV   N V   ++A+A+I+Y GKG      R     +  + +SP 
Sbjct: 176 FIQIKGLVRMADVGIDNRVPSTRVADAQIAYTGKGDVARASRQGWLSRFFQAVSPF 231


>gi|323158100|gb|EFZ44199.1| flagellar L-ring family protein [Escherichia coli EPECa14]
          Length = 221

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 78/152 (51%), Gaps = 13/152 (8%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L  D RA  VGDILTV +    Q+    +T   ++N++     G  ++F     +++G 
Sbjct: 57  SLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVD---IGAPTIFSHTKDKLSGS 113

Query: 129 ---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              N ++DG   S  + S+ R E     I   V A+  NG L I G + + +N     + 
Sbjct: 114 IDANRDFDGSATSQQQNSL-RGE-----ITVSVHAVQPNGILEIRGEKWLTLNQGDEYIR 167

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VR  D+   NSVS  +IA+A ISY G+G
Sbjct: 168 LSGLVRADDIQNDNSVSSQRIADACISYAGRG 199


>gi|261821156|ref|YP_003259262.1| flagellar basal body L-ring protein [Pectobacterium wasabiae
           WPP163]
 gi|261605169|gb|ACX87655.1| flagellar L-ring protein [Pectobacterium wasabiae WPP163]
          Length = 237

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 81/180 (45%), Gaps = 18/180 (10%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG-QQTPQM 126
           +  +F+D R  N+GD LT+ ++ +  A   +    +RN         G S FG   TP+ 
Sbjct: 67  YQPMFEDRRPRNIGDTLTIVLQENVSASKSSSANAARN---------GASTFGVTATPRY 117

Query: 127 --------NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                     +LN  G    +G+G  +     +  I   V  +L NGNL + G +++ +N
Sbjct: 118 LEGPLGNNRASLNATGTNDFTGQGGANANNTFSGTITVTVGQVLANGNLNVVGEKQIAIN 177

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
                +  +G+V P+ +  +NSV   ++A+ARI Y G G   E        +   N+SP 
Sbjct: 178 QGTEFIRFSGVVNPRTISGNNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNVSPF 237


>gi|333008283|gb|EGK27757.1| flagellar L-ring family protein [Shigella flexneri K-272]
 gi|333019773|gb|EGK39045.1| flagellar L-ring family protein [Shigella flexneri K-227]
          Length = 232

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 83/178 (46%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   ++   GG   +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 N----ARADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V  + +   N+V   ++A+ARI Y G G   E        +   NLSP+
Sbjct: 175 TEFIRFSGVVNSRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM 232


>gi|227112524|ref|ZP_03826180.1| flagellar basal body L-ring protein [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 237

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 79/178 (44%), Gaps = 14/178 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNS-------LHRKLSGGFSLFG 120
           +  +F+D R  NVGD LT+ ++ +  A   +    +RN S       + R L G      
Sbjct: 67  YQPMFEDRRPRNVGDTLTIVLQENVSASKSSSANAARNGSSTFGATVVPRYLDGPLG--- 123

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                   +LN  G    +G+G  +     +  I   V  +L NGNL + G +++ +N  
Sbjct: 124 ----NNRASLNATGTNDFTGQGGANANNTFSGTITVTVGQVLANGNLQVVGEKQIAINQG 179

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
              +  +G+V P+ +  +NSV   ++A+ARI Y G G   E        +   N+SP 
Sbjct: 180 TEFIRFSGVVNPRTISGNNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNVSPF 237


>gi|22126387|ref|NP_669810.1| flagellar basal body L-ring protein [Yersinia pestis KIM 10]
 gi|45441406|ref|NP_992945.1| flagellar basal body L-ring protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|153950284|ref|YP_001401287.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis IP
           31758]
 gi|165925895|ref|ZP_02221727.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|166210591|ref|ZP_02236626.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401004|ref|ZP_02306507.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|21959373|gb|AAM86061.1|AE013853_9 basal-body outer-membrane L (lipopolysaccharide layer) ring protein
           [Yersinia pestis KIM 10]
 gi|45436266|gb|AAS61822.1| basal-body outer-membrane L (lipopolysaccharide layer) ring protein
           [Yersinia pestis biovar Microtus str. 91001]
 gi|152961779|gb|ABS49240.1| flagellar L-ring protein FlgH [Yersinia pseudotuberculosis IP
           31758]
 gi|165922099|gb|EDR39276.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|166207771|gb|EDR52251.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167049393|gb|EDR60801.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           UG05-0454]
          Length = 243

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 81/179 (45%), Gaps = 18/179 (10%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT-PQM 126
           +  LF+D R  N+GD LT+ ++ +  A   +    SRN         G S FG  T P+ 
Sbjct: 73  YQPLFEDRRPRNIGDTLTITLQENVSASKSSSANASRN---------GTSSFGVTTAPRY 123

Query: 127 ------NG--NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                 NG  ++   G     GKG  +     +  I   V  +L NGNL + G +++ +N
Sbjct: 124 LDGLLGNGRADMEITGDNTFGGKGGANANNTFSGTITVTVDQVLANGNLHVVGEKQIAIN 183

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                +  +G+V P+ +   NSV+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 184 QGTEFIRFSGVVNPRTISGSNSVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 242


>gi|51596014|ref|YP_070205.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108807176|ref|YP_651092.1| flagellar basal body L-ring protein [Yersinia pestis Antiqua]
 gi|108812480|ref|YP_648247.1| flagellar basal body L-ring protein [Yersinia pestis Nepal516]
 gi|145598607|ref|YP_001162683.1| flagellar basal body L-ring protein [Yersinia pestis Pestoides F]
 gi|149366248|ref|ZP_01888283.1| flagellar L-ring protein precursor [Yersinia pestis CA88-4125]
 gi|165938678|ref|ZP_02227233.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166010850|ref|ZP_02231748.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|167419992|ref|ZP_02311745.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425807|ref|ZP_02317560.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|170024644|ref|YP_001721149.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis
           YPIII]
 gi|186895117|ref|YP_001872229.1| flagellar basal body L-ring protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218928925|ref|YP_002346800.1| flagellar basal body L-ring protein [Yersinia pestis CO92]
 gi|229896245|ref|ZP_04511415.1| flagellar L-ring protein precursor [Yersinia pestis Pestoides A]
 gi|229897180|ref|ZP_04512336.1| flagellar L-ring protein precursor [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229902862|ref|ZP_04517979.1| flagellar L-ring protein precursor [Yersinia pestis Nepal516]
 gi|270486642|ref|ZP_06203716.1| flagellar L-ring protein FlgH [Yersinia pestis KIM D27]
 gi|294504027|ref|YP_003568089.1| flagellar L-ring protein precursor [Yersinia pestis Z176003]
 gi|81518689|sp|Q8ZFB2|FLGH2_YERPE RecName: Full=Flagellar L-ring protein 2; AltName: Full=Basal body
           L-ring protein 2; Flags: Precursor
 gi|81639723|sp|Q66BT9|FLGH1_YERPS RecName: Full=Flagellar L-ring protein 1; AltName: Full=Basal body
           L-ring protein 1; Flags: Precursor
 gi|51589296|emb|CAH20917.1| flagellar L-ring protein precursor [Yersinia pseudotuberculosis IP
           32953]
 gi|108776128|gb|ABG18647.1| flagellar L-ring protein precursor [Yersinia pestis Nepal516]
 gi|108779089|gb|ABG13147.1| flagellar L-ring protein precursor [Yersinia pestis Antiqua]
 gi|115347536|emb|CAL20445.1| flagellar L-ring protein precursor [Yersinia pestis CO92]
 gi|145210303|gb|ABP39710.1| flagellar L-ring protein precursor [Yersinia pestis Pestoides F]
 gi|149292661|gb|EDM42735.1| flagellar L-ring protein precursor [Yersinia pestis CA88-4125]
 gi|165913292|gb|EDR31914.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165990194|gb|EDR42495.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166961687|gb|EDR57708.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167055206|gb|EDR65003.1| flagellar L-ring protein FlgH [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|169751178|gb|ACA68696.1| flagellar L-ring protein [Yersinia pseudotuberculosis YPIII]
 gi|186698143|gb|ACC88772.1| flagellar L-ring protein [Yersinia pseudotuberculosis PB1/+]
 gi|229680309|gb|EEO76408.1| flagellar L-ring protein precursor [Yersinia pestis Nepal516]
 gi|229693517|gb|EEO83566.1| flagellar L-ring protein precursor [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701168|gb|EEO89197.1| flagellar L-ring protein precursor [Yersinia pestis Pestoides A]
 gi|262361787|gb|ACY58508.1| flagellar L-ring protein precursor [Yersinia pestis D106004]
 gi|262366077|gb|ACY62634.1| flagellar L-ring protein precursor [Yersinia pestis D182038]
 gi|270335146|gb|EFA45923.1| flagellar L-ring protein FlgH [Yersinia pestis KIM D27]
 gi|294354486|gb|ADE64827.1| flagellar L-ring protein precursor [Yersinia pestis Z176003]
 gi|320015464|gb|ADV99035.1| flagellar L-ring protein precursor [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 229

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 81/179 (45%), Gaps = 18/179 (10%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT-PQM 126
           +  LF+D R  N+GD LT+ ++ +  A   +    SRN         G S FG  T P+ 
Sbjct: 59  YQPLFEDRRPRNIGDTLTITLQENVSASKSSSANASRN---------GTSSFGVTTAPRY 109

Query: 127 ------NG--NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                 NG  ++   G     GKG  +     +  I   V  +L NGNL + G +++ +N
Sbjct: 110 LDGLLGNGRADMEITGDNTFGGKGGANANNTFSGTITVTVDQVLANGNLHVVGEKQIAIN 169

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                +  +G+V P+ +   NSV+  ++A+ARI Y G G   E        +   N+SP
Sbjct: 170 QGTEFIRFSGVVNPRTISGSNSVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 228


>gi|261211319|ref|ZP_05925607.1| flagellar L-ring protein FlgH [Vibrio sp. RC341]
 gi|260839274|gb|EEX65900.1| flagellar L-ring protein FlgH [Vibrio sp. RC341]
          Length = 258

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 83/164 (50%), Gaps = 11/164 (6%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG---FSLFGQQT 123
           S ++++ DS+   VGDI+TV +    +A       +S +  L++K        ++ G+  
Sbjct: 90  SGSSMYDDSKPRGVGDIITVTLNESTKAA------KSADADLNKKNDASMDPLAVGGKDL 143

Query: 124 PQMNGNLNY--DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
              + N +Y        SG  + +++  ++  I   V  +L NGNL+I G + + +N   
Sbjct: 144 TIGDYNFSYALKNDNKFSGSAAANQSNSMSGSITVEVIEVLANGNLVIRGEKWLTLNTGD 203

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
             + ++G +RP D+D  N+++ ++I+ ARI Y G G   ++  P
Sbjct: 204 EYIRLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEP 247


>gi|300693341|ref|YP_003749314.1| flagellar protein of basal-body outer-membrane l ring [Ralstonia
           solanacearum PSI07]
 gi|299075378|emb|CBJ34673.1| flagellar protein of basal-body outer-membrane L ring [Ralstonia
           solanacearum PSI07]
          Length = 244

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 71/156 (45%), Gaps = 12/156 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           +F+D RA  VGD  T+ I I +      QT  + + S  +  S     F    P   G L
Sbjct: 79  MFEDRRAHMVGD--TITIVITENTAASKQTSGTVDRSGSKTTS--VPTFAGMNP---GVL 131

Query: 131 NYDGGGASSG-----KGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           +  G  AS       KG+          I   V  +L NGNL++SG +++ V     S+ 
Sbjct: 132 SLLGVSASDANKFDSKGANGAQNNFTATITVTVVEVLSNGNLVVSGEKQMAVGQGTESIK 191

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            +G+V P  V+  N+V   ++A+AR+ Y G G   E
Sbjct: 192 FSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAE 227


>gi|270262398|ref|ZP_06190669.1| flagellar L-ring protein [Serratia odorifera 4Rx13]
 gi|270043082|gb|EFA16175.1| flagellar L-ring protein [Serratia odorifera 4Rx13]
          Length = 233

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 82/180 (45%), Gaps = 18/180 (10%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT-PQM 126
           +  LF+D R  N+GD LT+ ++ +  A   +    SRN         G S FG  T P+ 
Sbjct: 63  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRN---------GASKFGVATSPRY 113

Query: 127 ------NGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                 N   + D  G S+  GKG  +     +  I   V  +L NGNL + G +++ +N
Sbjct: 114 LDGLLGNARADMDISGDSTFGGKGGANANNTFSGTITVTVNQVLVNGNLHVVGEKQIAIN 173

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
                +  +G+V P+ +   NSV+  ++A+ARI Y G G   E        +   N+SP 
Sbjct: 174 QGTEFIRFSGVVNPRTISGSNSVTSTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSPF 233


>gi|88858140|ref|ZP_01132782.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein
           [Pseudoalteromonas tunicata D2]
 gi|88819757|gb|EAR29570.1| flagellar biosynthesis; basal-body outer-membrane L
           (lipopolysaccharide layer) ring protein
           [Pseudoalteromonas tunicata D2]
          Length = 227

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 81/153 (52%), Gaps = 12/153 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQT--GRSRNNSLHR--KLSGGFSLFGQQTPQM 126
           L+ D +A+ VGDI+TV +    QA    +T  G++ + +L+    L G     G Q+ ++
Sbjct: 59  LYSDKKAVRVGDIITVMLNESTQASKSAKTESGKATDIALNPLVGLGGKNVNIGGQSIEL 118

Query: 127 --NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
               + +Y G   S+   S+S    +N++       +L NGNL+I G + + +N     +
Sbjct: 119 GLKSDSSYKGDAKSNQSNSLSGNISVNVM------RVLPNGNLMIRGEKWLTLNTGEEFI 172

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + G+VR  DV A N+V  ++IA ARI Y GKG
Sbjct: 173 RLEGVVRASDVAADNTVESNRIANARIQYSGKG 205


>gi|319764542|ref|YP_004128479.1| flagellar l-ring protein [Alicycliphilus denitrificans BC]
 gi|330826758|ref|YP_004390061.1| flagellar L-ring protein [Alicycliphilus denitrificans K601]
 gi|317119103|gb|ADV01592.1| flagellar L-ring protein [Alicycliphilus denitrificans BC]
 gi|329312130|gb|AEB86545.1| flagellar L-ring protein [Alicycliphilus denitrificans K601]
          Length = 227

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 77/160 (48%), Gaps = 12/160 (7%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTG---RSRNNSLHRKLSGGFSLFGQQT 123
           S+   F+D RA  VGDI+T+ I ++      N T    RS N S       G S F    
Sbjct: 58  SYRPAFEDRRARMVGDIVTIQI-VEQVTAKQNSTSSIDRSANTS------AGISAFPFIG 110

Query: 124 PQMNGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
               G L+     A+  SGKG    +      I A V  +L NG+L+++G +++ VN+ +
Sbjct: 111 AGKLGKLDLGAKSANQFSGKGGTESSNTFTGTITATVIEVLPNGHLVVAGEKQIGVNENV 170

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
             L  +G V P+ +   + V+  ++A AR+   G+G  +E
Sbjct: 171 DVLRFSGTVDPRSLQPGSVVASTQVANARLQSRGRGAQSE 210


>gi|311087757|gb|ADP67836.1| flagellar basal body L-ring protein [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 254

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 80/154 (51%), Gaps = 4/154 (2%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLH--RKLSGGF--SLFGQQT 123
           +  LF+D R  N+GD +TV ++ +  A   + +  SR+ S +   K++ G   ++ G   
Sbjct: 64  YQPLFEDHRPHNIGDTITVVLQENISASNSSISNMSRDGSANFGLKIAPGQLNNILGVNF 123

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
                +L+  G    SGKGS S   K   LI   V  +L NGNL + G ++V +N     
Sbjct: 124 QDNTTSLDSFGRNNFSGKGSNSANNKFTGLITVTVKRVLPNGNLKVIGEKQVSINKGTEF 183

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +  +G++ P +++ +N +S  +IA+ARI Y   G
Sbjct: 184 IRFSGVINPTNINKNNFISSTQIADARIEYLSHG 217


>gi|253998485|ref|YP_003050548.1| flagellar L-ring protein [Methylovorus sp. SIP3-4]
 gi|253985164|gb|ACT50021.1| flagellar L-ring protein [Methylovorus sp. SIP3-4]
          Length = 228

 Score = 61.6 bits (148), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 81/176 (46%), Gaps = 13/176 (7%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           ++  LF+D RA  +GD L ++I  +  A   N +  S+  S+   ++  F   G   P+ 
Sbjct: 62  AYRPLFEDRRARLIGDTLMINITENTSATKANGSSASKKGSVDSSVTASF---GSPVPRA 118

Query: 127 NGN----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
             N    L+Y    A++     + +      IA  V  +L NG L++ G ++V ++    
Sbjct: 119 AFNSASDLSYTDAAAANASNVFTGS------IAVTVLDVLPNGYLVVGGEKQVALDKGTE 172

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            + ++G+V P  + A N+V   ++A+ARI Y    R    L   I  +   +  PL
Sbjct: 173 FVRLSGVVNPDTITAANTVPSTRVADARIEYRTNSRVDAALVTSILSRFFLSFIPL 228


>gi|116049012|ref|YP_792186.1| flagellar basal body L-ring protein [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|313106038|ref|ZP_07792297.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           39016]
 gi|122258120|sp|Q02IQ0|FLGH_PSEAB RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|115584233|gb|ABJ10248.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|310878799|gb|EFQ37393.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           39016]
          Length = 231

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 81/164 (49%), Gaps = 13/164 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ----QTPQM 126
           L+ D +A  VGDI+T+ +    QA     +   +++     L+   SLFG       P  
Sbjct: 58  LYDDRKAFRVGDIITITLNEKTQASKKANSDIQKDSKTKMGLT---SLFGSGMTTNNPIG 114

Query: 127 NGNLNYDG--GGASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQEVRVNDEI 181
            G+L+     GG+   KG  S+A + N L  +I   V  +L NG L + G + + +N   
Sbjct: 115 GGDLSLSAEYGGSRDAKGD-SQAGQSNSLTGSITVTVAEVLPNGILSVRGEKWMTLNTGN 173

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
             + + G+VR  D+   N+VS  ++A+ARI+Y G G   +  +P
Sbjct: 174 ELVRIAGLVRADDIATDNTVSSTRVADARITYSGTGAFADASQP 217


>gi|238751765|ref|ZP_04613253.1| Flagellar L-ring protein [Yersinia rohdei ATCC 43380]
 gi|238710036|gb|EEQ02266.1| Flagellar L-ring protein [Yersinia rohdei ATCC 43380]
          Length = 238

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 81/179 (45%), Gaps = 18/179 (10%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT-PQM 126
           +  LF+D R  NVGD LT+ ++ +  A   +    SRN         G S FG  T P+ 
Sbjct: 68  YQPLFEDRRPRNVGDTLTITLQENVSASKSSSANASRN---------GASKFGVATSPRY 118

Query: 127 ------NGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                 N   + D  G S+  GKG  +     +  I   V  +L NGNL + G +++ +N
Sbjct: 119 LDGLLGNARADMDISGDSTFGGKGGANANNTFSGTITVTVDQVLANGNLHVVGEKQIAIN 178

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSP 237
                +  +G+V P+ +   NSV   ++A+ARI Y G G   E        +   N+SP
Sbjct: 179 QGTEFIRFSGVVNPRTISGSNSVISTQVADARIEYVGNGYINEAQTMGWLQRFFLNVSP 237


>gi|152997579|ref|YP_001342414.1| flagellar L-ring protein [Marinomonas sp. MWYL1]
 gi|150838503|gb|ABR72479.1| flagellar L-ring protein [Marinomonas sp. MWYL1]
          Length = 283

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 76/147 (51%), Gaps = 5/147 (3%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
            F D +A  VGDILT+++     +   N    S+++S   +     ++ GQ+  +M+  L
Sbjct: 120 FFGDQKASKVGDILTINLNETTTSTKANAATVSKSSSATIE---NPTVLGQEL-KMDTTL 175

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIV 190
              G   S G  S ++   L+  I+  V     NG L + G + +R+N     +  +GIV
Sbjct: 176 PQQGTDFS-GNASANQNNSLSGTISVTVYRAYPNGLLAVRGEKWLRLNQGDEYIRFSGIV 234

Query: 191 RPQDVDAHNSVSYDKIAEARISYGGKG 217
           R QD+  +N+V  +++A+ARI+Y G G
Sbjct: 235 RKQDISPNNTVESERVADARITYSGTG 261


>gi|91225876|ref|ZP_01260845.1| flagellar L-ring protein precursor H [Vibrio alginolyticus 12G01]
 gi|269965421|ref|ZP_06179540.1| flagellar L-ring protein precursor [Vibrio alginolyticus 40B]
 gi|91189526|gb|EAS75802.1| flagellar L-ring protein precursor H [Vibrio alginolyticus 12G01]
 gi|269829900|gb|EEZ84130.1| flagellar L-ring protein precursor [Vibrio alginolyticus 40B]
          Length = 259

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 82/171 (47%), Gaps = 13/171 (7%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK--LSGGFSL 118
           SL+   H   L+ DS+   +GDI+TV +     A        S+ N         GG  L
Sbjct: 84  SLFSAEHITDLYDDSKPRGIGDIITVTLDETTSATKSANADLSKTNEAQMDPLQVGGEEL 143

Query: 119 FGQQTPQMNG--NLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                 Q+ G  N +YD   ++S  G  S  ++  ++  I   V  +L NGNL+I G + 
Sbjct: 144 ------QIGGKYNFSYDLNNSNSFAGDSSAKQSNSISGYITVEVIEVLANGNLVIRGEKW 197

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           + +N     + ++G +RP D++  N+++ ++++ ARI Y G G   ++  P
Sbjct: 198 MTLNTGDEYIRLSGTIRPDDINFDNTIASNRVSNARIQYSGTGLQQDMQEP 248


>gi|15596280|ref|NP_249774.1| flagellar basal body L-ring protein [Pseudomonas aeruginosa PAO1]
 gi|107100528|ref|ZP_01364446.1| hypothetical protein PaerPA_01001553 [Pseudomonas aeruginosa PACS2]
 gi|218892953|ref|YP_002441822.1| flagellar basal body L-ring protein [Pseudomonas aeruginosa LESB58]
 gi|254234219|ref|ZP_04927542.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           C3719]
 gi|254239441|ref|ZP_04932763.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           2192]
 gi|296390553|ref|ZP_06880028.1| flagellar basal body L-ring protein [Pseudomonas aeruginosa PAb1]
 gi|14548041|sp|Q9I4P6|FLGH_PSEAE RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|226701927|sp|B7UXA6|FLGH_PSEA8 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|9946999|gb|AAG04472.1|AE004539_14 flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           PAO1]
 gi|126166150|gb|EAZ51661.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           C3719]
 gi|126192819|gb|EAZ56882.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           2192]
 gi|218773181|emb|CAW28993.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           LESB58]
          Length = 231

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 81/164 (49%), Gaps = 13/164 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ----QTPQM 126
           L+ D +A  VGDI+T+ +    QA     +   +++     L+   SLFG       P  
Sbjct: 58  LYDDRKAFRVGDIITITLNEKTQASKKANSDIQKDSKTKMGLT---SLFGSGMTTNNPIG 114

Query: 127 NGNLNYDG--GGASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQEVRVNDEI 181
            G+L+     GG+   KG  S+A + N L  +I   V  +L NG L + G + + +N   
Sbjct: 115 GGDLSLSAEYGGSRDAKGD-SQAGQSNSLTGSITVTVAEVLPNGILSVRGEKWMTLNTGN 173

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
             + + G+VR  D+   N+VS  ++A+ARI+Y G G   +  +P
Sbjct: 174 ELVRIAGLVRADDIATDNTVSSTRVADARITYSGTGAFADASQP 217


>gi|320107044|ref|YP_004182634.1| flagellar L-ring protein [Terriglobus saanensis SP1PR4]
 gi|319925565|gb|ADV82640.1| flagellar L-ring protein [Terriglobus saanensis SP1PR4]
          Length = 269

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 80/167 (47%), Gaps = 3/167 (1%)

Query: 62  SLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           ++W DS   + +F D RA+   D+++V +     +  D     SRN+S +  ++  FS  
Sbjct: 91  AIWIDSGRLSRMFTDVRAMRPNDLISVVVSESLASSTDGTVKGSRNSSANSAITALFSKL 150

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
              +   N  +N     A + +G  +    L+ ++   V  +L NG L+I  +++V  + 
Sbjct: 151 SAASAAQNL-INQSSASALTAQGQSANNSSLSTILGGQVVDVLPNGTLVIEAARQVEFSQ 209

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPP 226
           + +++ + G+VRP+D+   N V    I+   +   G+G  T+    P
Sbjct: 210 QTQTIVLRGLVRPEDISQQNQVLSTAISSMELQVRGRGIVTDYTHRP 256


>gi|49082006|gb|AAT50403.1| PA1083 [synthetic construct]
          Length = 232

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 81/164 (49%), Gaps = 13/164 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ----QTPQM 126
           L+ D +A  VGDI+T+ +    QA     +   +++     L+   SLFG       P  
Sbjct: 58  LYDDRKAFRVGDIITITLNEKTQASKKANSDIQKDSKTKMGLT---SLFGSGMTTNNPIG 114

Query: 127 NGNLNYDG--GGASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQEVRVNDEI 181
            G+L+     GG+   KG  S+A + N L  +I   V  +L NG L + G + + +N   
Sbjct: 115 GGDLSLSAEYGGSRDAKGD-SQAGQSNSLTGSITVTVAEVLPNGILSVRGEKWMTLNTGN 173

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
             + + G+VR  D+   N+VS  ++A+ARI+Y G G   +  +P
Sbjct: 174 ELVRIAGLVRADDIATDNTVSSTRVADARITYSGTGAFADASQP 217


>gi|170722888|ref|YP_001750576.1| flagellar basal body L-ring protein [Pseudomonas putida W619]
 gi|226701928|sp|B1JCC5|FLGH_PSEPW RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|169760891|gb|ACA74207.1| flagellar L-ring protein [Pseudomonas putida W619]
          Length = 231

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 80/164 (48%), Gaps = 13/164 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN--- 127
           L+ D +A  VGDI+T+ +     A  +  +   +++S +  L+   SLFG  TP  N   
Sbjct: 58  LYSDRKAFRVGDIITITLNERTSASKNAGSQIQKDSSANIGLT---SLFGA-TPSTNNPF 113

Query: 128 --GNLN----YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
             G+L+    Y G  A+ G    ++   L   I   V  +L NG + + G + + +N   
Sbjct: 114 GSGDLSLEAGYSGERATKGDSKATQGNTLTGSITVTVAEVLPNGIIAVRGEKWMTLNTGE 173

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
             + + G++R  D+   N+V   ++A+ARI+Y G G   +  +P
Sbjct: 174 ELVRIAGLIRADDIATDNTVPSTRVADARITYSGTGSFADASQP 217


>gi|71277863|ref|YP_268225.1| flagellar basal body L-ring protein [Colwellia psychrerythraea 34H]
 gi|110816527|sp|Q485P0|FLGH_COLP3 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|71143603|gb|AAZ24076.1| flagellar L-ring protein FlgH [Colwellia psychrerythraea 34H]
          Length = 236

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 84/151 (55%), Gaps = 8/151 (5%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG-N 129
           ++ DS+A  VGDI++V +    QA  + +T   + N  +     G    G     +NG +
Sbjct: 68  IYSDSKAHRVGDIISVILSEKTQAKKNAKTELKKANETNLDAVTGL---GGVPVSINGES 124

Query: 130 LNYDGGGASSGKGSISRAEKLNLL---IAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           L +     S+ KG  ++A++ N L   I+  V  +L NGNL+I G + + +N+    + +
Sbjct: 125 LQFGISQDSNFKGD-AKADQGNSLSGNISVHVLRVLPNGNLMIRGEKWLTLNNGDEYIRL 183

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           TG++R +D++++N++  +K+A ARI Y G G
Sbjct: 184 TGVIRSKDINSNNTILSNKVANARIQYAGTG 214


>gi|313200560|ref|YP_004039218.1| flagellar l-ring protein [Methylovorus sp. MP688]
 gi|312439876|gb|ADQ83982.1| flagellar L-ring protein [Methylovorus sp. MP688]
          Length = 230

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 81/176 (46%), Gaps = 13/176 (7%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           ++  LF+D RA  +GD L ++I  +  A   N +  S+  S+   ++  F   G   P+ 
Sbjct: 64  AYRPLFEDRRARLIGDTLMINITENTSATKANGSSASKKGSVDSSVTASF---GSPLPRA 120

Query: 127 NGN----LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
             N    L+Y    A++     + +      IA  V  +L NG L++ G ++V ++    
Sbjct: 121 AFNSASDLSYTDAAAANASNVFTGS------IAVTVLDVLPNGYLVVGGEKQVALDKGTE 174

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            + ++G+V P  + A N+V   ++A+ARI Y    R    L   I  +   +  PL
Sbjct: 175 FVRLSGVVNPDTITAANTVPSTRVADARIEYRTNSRVDAALVTSILSRFFLSFIPL 230


>gi|325982368|ref|YP_004294770.1| flagellar L-ring protein [Nitrosomonas sp. AL212]
 gi|325531887|gb|ADZ26608.1| flagellar L-ring protein [Nitrosomonas sp. AL212]
          Length = 238

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 102/231 (44%), Gaps = 34/231 (14%)

Query: 3   RYSFIVLCYSSLLFGCHSSISEITGIPQ-MSPMGSSL---DENNRMPFLGIDFKNSDSTK 58
           RY F +L ++  + GC ++ S +T  P  + P   SL     N  +    +   NS +  
Sbjct: 13  RYLFALLFFT-FVSGCTTTPSTVTHQPNSLRPAHQSLAVIQPNGSI----LQALNSTTNG 67

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
             Y+        LF+D RA +VGD + V +     A   + +   R+ S+   +    SL
Sbjct: 68  VRYT-------PLFEDRRARSVGDTIIVTLNERTNASKSSGSNVDRSGSIDFSVP---SL 117

Query: 119 FG--------QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
            G          T +   N ++DGGG SS K            I   V   L NGNL++S
Sbjct: 118 LGIPLGLLKKHATVEAKSNNSFDGGGESSSKNDFKGT------ITVTVIEALPNGNLVVS 171

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G +++ +N     + ++G+V P  V   N++S  +IA+ARI Y   G   E
Sbjct: 172 GEKQIGINQGQEFIRLSGVVNPIHVMG-NTISSTQIADARIEYRANGYIDE 221


>gi|330501140|ref|YP_004378009.1| flagellar basal body L-ring protein [Pseudomonas mendocina NK-01]
 gi|328915426|gb|AEB56257.1| flagellar basal body L-ring protein [Pseudomonas mendocina NK-01]
          Length = 223

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 80/163 (49%), Gaps = 20/163 (12%)

Query: 63  LWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           L+R  ++ +L  D RA+ VGDILTV   + D++    Q+ +S   S  +  +    +   
Sbjct: 51  LFRSGYSGSLIGDKRAVRVGDILTV---VLDEST---QSSKSAGTSFGKTANAAIGI--- 101

Query: 122 QTPQMNGNLNYDGGGASS-------GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
             P + G   YD   +S+       G    S+   L   IA  V  +L NG L+I G + 
Sbjct: 102 --PTVLGK-TYDRLESSASAERDFNGSARSSQQNTLRGSIAVTVHQVLPNGTLLIKGEKA 158

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +R+N     + + G+VR  D++  N VS   +A ARISY G+G
Sbjct: 159 LRLNQGDEYIRLVGLVRMDDINRANQVSSQNVANARISYAGRG 201


>gi|224436779|ref|ZP_03657777.1| flagellar basal body L-ring protein [Helicobacter cinaedi CCUG
           18818]
 gi|313143268|ref|ZP_07805461.1| flagellar L-ring protein [Helicobacter cinaedi CCUG 18818]
 gi|313128299|gb|EFR45916.1| flagellar L-ring protein [Helicobacter cinaedi CCUG 18818]
          Length = 244

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 87/190 (45%), Gaps = 10/190 (5%)

Query: 59  KSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF---DNQTGRSRNNSLHRKL--S 113
           K+ SL+      LF D RA+   D++T+ I  +  A F    N  G S  N     +  +
Sbjct: 55  KAGSLFGSGDRPLFSDRRAMKPDDLITIVINENANANFTTNKNYNGASGGNVTPPAIEYT 114

Query: 114 GGFSLFGQQTPQMNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLI 168
           G      Q   ++N    Y+   A++     G G+ +R E LN  + A +  +L+N    
Sbjct: 115 GNNEEQKQIVQELNDQAAYNLTKANNTSNFQGGGAQTRNEALNATLTARIIKVLDNNTYF 174

Query: 169 ISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIG 228
           I G +EV V+ E + L ++G+VR  D+   N V    IA A+I+Y   G  ++  R    
Sbjct: 175 IHGRREVLVDGEKQILELSGVVRSFDISKDNVVQSKHIANAKIAYTSAGPISDTNRKKPI 234

Query: 229 HQLIENLSPL 238
              IE+L P 
Sbjct: 235 SDGIESLYPF 244


>gi|292669968|ref|ZP_06603394.1| flagellar L-ring protein FlgH [Selenomonas noxia ATCC 43541]
 gi|292648380|gb|EFF66352.1| flagellar L-ring protein FlgH [Selenomonas noxia ATCC 43541]
          Length = 213

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 75/164 (45%), Gaps = 19/164 (11%)

Query: 62  SLWRDSHAA----LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK----LS 113
           SLW++ +      +F D RA +VGDI+T+ I  +        T  SRNNS  +     + 
Sbjct: 42  SLWKNPNGYPTKNVFADHRATSVGDIVTIIISEN------TTTTASRNNSNEKSGSVNIG 95

Query: 114 GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQ 173
            G  +F           +  G    + KGS S   +    +   VT I   GN I+ G+Q
Sbjct: 96  AGIGIF-----DFLKAASASGSDKFTAKGSASSTNRAIGNVTVTVTEITPGGNFILEGTQ 150

Query: 174 EVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            +  N     +   G+ RP+D+ + N++   ++A+A + + GKG
Sbjct: 151 SIWQNRNEHKITFRGMCRPEDISSSNTILSTRVADATVRFDGKG 194


>gi|262166279|ref|ZP_06034016.1| flagellar L-ring protein FlgH [Vibrio mimicus VM223]
 gi|262025995|gb|EEY44663.1| flagellar L-ring protein FlgH [Vibrio mimicus VM223]
          Length = 258

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 80/159 (50%), Gaps = 7/159 (4%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTG-RSRNNSLHRKLSGGFSLFGQQTPQMNG 128
           +++ DS+   VGDI+TV +    +A        + +N+S    L+ G    G+     + 
Sbjct: 93  SMYDDSKPRGVGDIITVTLNESTKAAKSADADLKKKNDSKMDPLAVG----GKDLTVGDY 148

Query: 129 NLNY--DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           N +Y        +G  + +++  ++  I   V  +L NGNL+I G + + +N     + +
Sbjct: 149 NFSYALKNDNKFTGSAAANQSNSMSGSITVEVIEVLANGNLVIRGEKWLTLNTGDEYIRL 208

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           +G +RP D+D  N+++ ++I+ ARI Y G G   ++  P
Sbjct: 209 SGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEP 247


>gi|254230137|ref|ZP_04923532.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
 gi|262394936|ref|YP_003286790.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
 gi|151937330|gb|EDN56193.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
 gi|262338530|gb|ACY52325.1| flagellar L-ring protein FlgH [Vibrio sp. Ex25]
          Length = 259

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 81/171 (47%), Gaps = 13/171 (7%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK--LSGGFSL 118
           SL+   H   L+ DS+   +GDI+TV +     A        S+ N         GG  L
Sbjct: 84  SLFSAEHITDLYDDSKPRGIGDIITVTLDETTSATKSANADLSKTNEAQMDPLQVGGEEL 143

Query: 119 FGQQTPQMNG--NLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                 Q+ G  N +YD   ++S  G  S  ++  ++  I   V  +L NGNL+I G + 
Sbjct: 144 ------QIGGKYNFSYDLNNSNSFAGDSSAKQSNSISGYITVEVIEVLANGNLVIRGEKW 197

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           + +N     + ++G +RP D+   N+++ ++++ ARI Y G G   ++  P
Sbjct: 198 MTLNTGDEYIRLSGTIRPDDISFDNTIASNRVSNARIQYSGTGVQQDMQEP 248


>gi|32266398|ref|NP_860430.1| flagellar basal body L-ring protein [Helicobacter hepaticus ATCC
           51449]
 gi|81665953|sp|Q7VHR4|FLGH_HELHP RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|32262448|gb|AAP77496.1| flagellar basal body L-ring protein FlgH [Helicobacter hepaticus
           ATCC 51449]
          Length = 244

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 85/187 (45%), Gaps = 10/187 (5%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVF---DNQTGRSRNNSLHRKL--SGGF 116
           SL+      LF D RA+   D++T+ I  +  A F    N  G S  N     +  +G  
Sbjct: 58  SLFGSGDKPLFSDRRAMKPDDLITIVISENANANFTTNKNYNGASGGNVTPPSIEYTGNN 117

Query: 117 SLFGQQTPQMNGNLNYDGGGASS-----GKGSISRAEKLNLLIAAIVTAILENGNLIISG 171
               Q   ++N    Y+   A++     G G+ +R+E LN  I A +  +L+N    I G
Sbjct: 118 EEQKQIVSELNDQAAYNLTKANNTSNFQGGGAQTRSEALNATITARIVKVLDNNTYFIHG 177

Query: 172 SQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQL 231
            +EV V+ E + L ++G+VR  D+   N V    IA A+I+Y   G  ++          
Sbjct: 178 RREVLVDGEKQILELSGVVRSFDISKDNVVQSKHIANAKIAYTSLGPISDTNHKKPVSDG 237

Query: 232 IENLSPL 238
           IE+L P 
Sbjct: 238 IESLYPF 244


>gi|83647170|ref|YP_435605.1| flagellar basal body L-ring protein [Hahella chejuensis KCTC 2396]
 gi|110816531|sp|Q2SDU4|FLGH_HAHCH RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|83635213|gb|ABC31180.1| Flagellar basal body L-ring protein [Hahella chejuensis KCTC 2396]
          Length = 227

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 75/153 (49%), Gaps = 11/153 (7%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF---SLFGQQTPQM 126
           +LF D  A  VGD+LTV ++         Q+ +S   S+ +     F   ++ G      
Sbjct: 59  SLFGDRTAHQVGDVLTVVLQES------TQSSKSTGTSMKKDSENSFNEATILGTAISAH 112

Query: 127 NGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
           N +L  D       SG+    ++  L+  I+  ++ +L NG L I G + + + +    L
Sbjct: 113 NLSLLTDQNFERDFSGEADADQSNSLSGSISVTISDVLPNGVLRIRGEKWLTLTEGDEYL 172

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            V+G+VRPQD+   N++   KIA+AR +Y G G
Sbjct: 173 RVSGLVRPQDIGVDNTILSSKIADARFAYSGAG 205


>gi|304310888|ref|YP_003810486.1| Flagellar L-ring protein precursor [gamma proteobacterium HdN1]
 gi|301796621|emb|CBL44833.1| Flagellar L-ring protein precursor [gamma proteobacterium HdN1]
          Length = 237

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 84/160 (52%), Gaps = 17/160 (10%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG- 128
           +L++D RA  VGDILTV ++    +   + T  S+++S + +++    L    TP+ N  
Sbjct: 61  SLYEDQRARRVGDILTVMLQERTSSSKTSGTDMSKDDSNNMQVNSILGL----TPKTNLP 116

Query: 129 --------NLNYDGGGASSGKGSISRAEKLNLL---IAAIVTAILENGNLIISGSQEVRV 177
                   +LN D       KG+ +++++ N L   I   VT ++ NG L + G + + +
Sbjct: 117 LGLSKSDLSLNSDTDSKRKFKGA-AKSDQSNQLQGNITVTVTQVMPNGILYVRGEKWITL 175

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            +    + + G+VR  D++  N+V   KIA+ARI+YG  G
Sbjct: 176 AEGDEYIRIHGLVRTADINPDNTVQSSKIADARIAYGATG 215


>gi|167576665|ref|ZP_02369539.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           TXDOH]
          Length = 218

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 72/151 (47%), Gaps = 12/151 (7%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP---QM 126
           +L  D RA   GD LTV +    QA     T   +N  +  K      LFG   P     
Sbjct: 55  SLASDGRAYRPGDTLTVTLEETTQASKRADTKFGKNGDMAVKPG---VLFGSAVPFDSSF 111

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
               N+DGGG+SS + ++ R E     I  IV  +L  G L + G + + +N     + +
Sbjct: 112 GAKRNFDGGGSSSQQNTL-RGE-----ITVIVNQVLAGGLLQVKGEKVLSLNQGEEVMRL 165

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +G VR  D+D +N VS  +IA ARI Y GKG
Sbjct: 166 SGYVRQADIDTNNRVSSRRIANARIKYVGKG 196


>gi|258621052|ref|ZP_05716086.1| flagellar L-ring protein precursor [Vibrio mimicus VM573]
 gi|258625280|ref|ZP_05720188.1| flagellar L-ring protein precursor [Vibrio mimicus VM603]
 gi|258582453|gb|EEW07294.1| flagellar L-ring protein precursor [Vibrio mimicus VM603]
 gi|258586440|gb|EEW11155.1| flagellar L-ring protein precursor [Vibrio mimicus VM573]
          Length = 261

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 80/161 (49%), Gaps = 11/161 (6%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG---FSLFGQQTPQM 126
           +++ DS+   VGDI+TV +    +A       +S +  L +K        ++ G+     
Sbjct: 96  SMYDDSKPRGVGDIITVTLNESTKA------AKSADADLKKKNDASMDPLAVGGKDLTVG 149

Query: 127 NGNLNY--DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
           + N +Y        +G  + +++  ++  I   V  +L NGNL+I G + + +N     +
Sbjct: 150 DYNFSYALKNDNKFTGSAAANQSNSMSGSITVEVIEVLANGNLVIRGEKWLTLNTGDEYI 209

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            ++G +RP D+D  N+++ ++I+ ARI Y G G   ++  P
Sbjct: 210 RLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEP 250


>gi|27904805|ref|NP_777931.1| flagellar L-ring protein precursor [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
 gi|31076688|sp|Q89AH6|FLGH_BUCBP RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|27904203|gb|AAO27036.1| flagellar L-ring protein precursor [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
          Length = 244

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 67/171 (39%), Gaps = 46/171 (26%)

Query: 71  LFKDSRALNVGDILTV------------------------DIRIDDQAVFDNQTGRSRNN 106
           LF+D +  NVGDILT+                        DI I +   FD+  G     
Sbjct: 73  LFEDYKPRNVGDILTIILQENTSASNSVSNNSIHNGNSNFDIDIGNARAFDDPNGILNKI 132

Query: 107 SLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGN 166
            L+  +   F                       GKGS S       LI  IV  IL NGN
Sbjct: 133 ELNSSIKNNFL----------------------GKGSSSANNTFVGLITVIVDRILPNGN 170

Query: 167 LIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           L +SGS+ + +ND I  +   GIV P  +  +NSV   K+A   I+Y   G
Sbjct: 171 LEVSGSKNITINDGIEKICFYGIVNPHTISKNNSVLSTKVANTNITYISSG 221


>gi|26991073|ref|NP_746498.1| flagellar basal body L-ring protein [Pseudomonas putida KT2440]
 gi|31076681|sp|Q88ER9|FLGH_PSEPK RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|24986107|gb|AAN69962.1|AE016634_11 flagellar L-ring protein precursor FlgH [Pseudomonas putida KT2440]
 gi|313497765|gb|ADR59131.1| FlgH [Pseudomonas putida BIRD-1]
          Length = 231

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 80/169 (47%), Gaps = 23/169 (13%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-NSLHRKLS----GGFSLFGQQTPQ 125
           L+ D +A  VGDI+T+ +        + +T  S+N  S   K S    G  SLFG  TP 
Sbjct: 58  LYSDRKAFRVGDIITITL--------NERTSASKNAGSQIAKTSKTDIGLTSLFGS-TPN 108

Query: 126 MN-----GNLN----YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            N     G+L+    Y G  A+ G    ++   L   I   V  +L NG + + G + + 
Sbjct: 109 TNNPFGGGDLSLEAGYSGDRATKGDSKATQGNTLTGSITVTVAEVLPNGIIAVRGEKWLT 168

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           +N     + + G+VR  D+   N+V   ++A+ARI+Y G G   +  +P
Sbjct: 169 LNTGEELVRIAGMVRADDIATDNTVPSTRVADARITYSGTGSFADASQP 217


>gi|289812383|ref|ZP_06543012.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
          Length = 144

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 65/141 (46%), Gaps = 4/141 (2%)

Query: 102 RSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYD----GGGASSGKGSISRAEKLNLLIAAI 157
           R  N S   K S GF    +    + GN   D    GG + +GKG  + +   +  +   
Sbjct: 4   RRSNASRDGKTSFGFDTVPRYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVT 63

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL + G +++ +N     +  +G+V P+ +   NSV   ++A+ARI Y G G
Sbjct: 64  VDQVLANGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNG 123

Query: 218 RTTELLRPPIGHQLIENLSPL 238
              E        +   NLSP+
Sbjct: 124 YINEAQNMGWLQRFFLNLSPM 144


>gi|149188069|ref|ZP_01866364.1| flagellar L-ring protein precursor H [Vibrio shilonii AK1]
 gi|148838057|gb|EDL54999.1| flagellar L-ring protein precursor H [Vibrio shilonii AK1]
          Length = 257

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 81/159 (50%), Gaps = 11/159 (6%)

Query: 72  FKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGFSLFGQQ---TPQM 126
           + DS+   +GDI+TV++    +A    D    ++ ++S+     GG  +       + ++
Sbjct: 94  YDDSKPRGIGDIITVELNEATKAAKSADADLSKANDSSMDPLFVGGRPVTVNDYDFSYEL 153

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             + N+ G  +++   S+S +      I   V  +L NGNL+I G + + +N     + +
Sbjct: 154 KNDNNFKGNASANQSNSLSGS------ITVEVIEVLANGNLVIRGEKWLTLNTGDEYIRL 207

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           +G +RP D++  N+++ ++I+ ARI Y G G   ++  P
Sbjct: 208 SGTIRPDDIEFDNTIASNRISNARIQYSGTGTQQDMQEP 246


>gi|237653580|ref|YP_002889894.1| flagellar L-ring protein [Thauera sp. MZ1T]
 gi|237624827|gb|ACR01517.1| flagellar L-ring protein [Thauera sp. MZ1T]
          Length = 225

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 72/151 (47%), Gaps = 10/151 (6%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK--LSGGFSLFGQ-QTPQMN 127
           LF+D RA  +GD +T+++      V  N   +S N +  R   +S G     +     +N
Sbjct: 60  LFEDRRARRIGDTITINL------VERNTAEKSANANATRNGNMSAGIGPINRLPLSGLN 113

Query: 128 G-NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
           G  L  D     +GKG+ +     N  I   V  +  NGNL++SG + V +N     +  
Sbjct: 114 GLELEADAESDFNGKGAAAANNVFNGTITVTVIDVYPNGNLLVSGEKMVAINQGNEFIRF 173

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +G++ P  V   N+V   ++A+ARI Y G G
Sbjct: 174 SGVINPNTVTTANTVQSTQVADARIEYRGSG 204


>gi|262170828|ref|ZP_06038506.1| flagellar L-ring protein FlgH [Vibrio mimicus MB-451]
 gi|261891904|gb|EEY37890.1| flagellar L-ring protein FlgH [Vibrio mimicus MB-451]
          Length = 258

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 80/161 (49%), Gaps = 11/161 (6%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGG---FSLFGQQTPQM 126
           +++ DS+   VGDI+TV +    +A       +S +  L +K        ++ G+     
Sbjct: 93  SMYDDSKPRGVGDIITVTLNESTKAA------KSADADLKKKNDASMDPLAVGGKDLTVG 146

Query: 127 NGNLNY--DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
           + N +Y        +G  + +++  ++  I   V  +L NGNL+I G + + +N     +
Sbjct: 147 DYNFSYALKNDNKFTGSAAANQSNSMSGSITVEVIEVLANGNLVIRGEKWLTLNTGDEYI 206

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            ++G +RP D+D  N+++ ++I+ ARI Y G G   ++  P
Sbjct: 207 RLSGTIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEP 247


>gi|209695759|ref|YP_002263689.1| flagellar basal body L-ring protein [Aliivibrio salmonicida
           LFI1238]
 gi|226701910|sp|B6EJG2|FLGH_ALISL RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|208009712|emb|CAQ80016.1| flagellar L-ring protein 1 precursor (basal body L-ring protein 1)
           [Aliivibrio salmonicida LFI1238]
          Length = 261

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 83/167 (49%), Gaps = 5/167 (2%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGFSL 118
           SL+   HA  ++ D++   +GDI+TV +  + +A    D +  +  ++S+     GG  L
Sbjct: 86  SLFNVDHAQDMYDDTKPRGLGDIVTVMLAENTKAAKSADAELSKKNDSSMDPLQVGGQEL 145

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
             Q   Q N +         +G  S +++  L+  I   V  +L NGNL+I G + + +N
Sbjct: 146 --QVGGQYNFSYELSNDNKFTGNTSANQSNSLSGSITVEVIEVLSNGNLLIRGEKWLTLN 203

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
                + ++G +RP D+   N+++  +I+ ARI Y G G   ++  P
Sbjct: 204 TGDEYIRLSGTIRPDDIAFDNTIASTRISNARIQYSGTGDQQDMQEP 250


>gi|157363241|ref|YP_001470008.1| flagellar L-ring protein [Thermotoga lettingae TMO]
 gi|157313845|gb|ABV32944.1| flagellar L-ring protein [Thermotoga lettingae TMO]
          Length = 199

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 80/159 (50%), Gaps = 10/159 (6%)

Query: 62  SLWRDSHAALFK----DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           SLW +S +A FK    D +A  VGDI+T+ ++   Q         S N++    L   F+
Sbjct: 22  SLWNNSSSAQFKNIIADRKASKVGDIVTIVVKETPQI-----NSSSSNDAFENALVNLFT 76

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
              +   Q + +        S  + S   +  + L I+A+V  I +NGNL++ G+++++V
Sbjct: 77  GAVKNITQFDLSQFIPINNNSQQQRSAQLSSTVVLTISAVVVDI-QNGNLVVEGNKKLKV 135

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGK 216
            +++  + + G VRP D+  +N+V    IA  +I   G+
Sbjct: 136 GEQLSEIIIRGTVRPDDISHNNTVDSSNIANCQIWVNGE 174


>gi|307131606|ref|YP_003883622.1| flagellar L-ring protein flgH [Dickeya dadantii 3937]
 gi|306529135|gb|ADM99065.1| Flagellar L-ring protein flgH [Dickeya dadantii 3937]
          Length = 240

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 79/179 (44%), Gaps = 16/179 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM- 126
           +  +F+D R  NVGD LT+ ++ +  A       +S + +  R  SG F +    TP++ 
Sbjct: 70  YQPMFEDRRPRNVGDTLTIVLQENVSAS------KSSSANASRDASGSFGM--TTTPRLL 121

Query: 127 -------NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                      N  G    +GKG  +        I   V  +L NGNL + G +++ VN 
Sbjct: 122 EGPLGNNRAAFNATGKDDFTGKGGANANNTFTGTITVTVDQVLTNGNLHVVGEKQIAVNQ 181

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               +  +G+V P+ +   N+V   ++A+AR+ Y G G   E        +   N+SP 
Sbjct: 182 GTEFIRFSGVVNPRTISGSNTVPSTQVADARMEYVGNGYINETQTMGWLQRFFLNVSPF 240


>gi|121534938|ref|ZP_01666757.1| flagellar L-ring protein [Thermosinus carboxydivorans Nor1]
 gi|121306537|gb|EAX47460.1| flagellar L-ring protein [Thermosinus carboxydivorans Nor1]
          Length = 196

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 93/179 (51%), Gaps = 11/179 (6%)

Query: 60  SYSLWRDS--HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN-SLHRKLSGGF 116
           + SLW D+   A+++ D +A  VGDI+T+ I    ++   ++TG++ N  S    L  G 
Sbjct: 25  AASLWTDTGPAASMYADRKAHAVGDIITIIIS---ESSSASRTGKAENTKSGKTDLQAGT 81

Query: 117 SLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            +F        G  +     +   +G+I+ +  ++  +   V  +  NGN+++SG+Q ++
Sbjct: 82  GIFRWLADASAGYSD-----SFKTQGTIANSNNVSAKLTVQVVEVKPNGNMVVSGTQSIK 136

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
            N E + + +TG+VRP DV A N+V    +A+A+I   G+G      R  +  Q++  L
Sbjct: 137 QNGEEQRITITGVVRPDDVRADNTVLSTYVADAQIRIDGQGPLARKQRQGVLSQILNIL 195


>gi|330809232|ref|YP_004353694.1| flagellar L-ring protein 1 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327377340|gb|AEA68690.1| putative flagellar L-ring protein 1 [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 192

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 83/173 (47%), Gaps = 9/173 (5%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
           D + +L  D R  ++GD LTV +     A     TG   N  +  +           T Q
Sbjct: 29  DGYRSLTGDRRGYHLGDTLTVLVVESTSAQSAAGTGAESNTDISARTG-----LDSNTHQ 83

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
            N  L     G ++G G  +R+ ++   ++  +   L  G L +SG Q V VNDE + + 
Sbjct: 84  ANLGLR----GDTNGNGQTNRSGQIRTNVSVRIIEQLPEGLLRVSGEQRVTVNDEKQQVR 139

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +TG+VRP D+  +N+V   ++A+A+I   G G  T+  +  I  ++++ L  L
Sbjct: 140 ITGLVRPDDIAYNNTVLSYRLADAQIDIVGDGVVTDAQKQNIVFRVLKWLRIL 192


>gi|157736471|ref|YP_001489154.1| flagellar basal body L-ring protein FlgH [Arcobacter butzleri
           RM4018]
 gi|157698325|gb|ABV66485.1| flagellar basal body L-ring protein FlgH [Arcobacter butzleri
           RM4018]
          Length = 234

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 110/246 (44%), Gaps = 30/246 (12%)

Query: 7   IVLCYSSLLF-GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           I +  +SLLF GC S   +I               +   P + I  K  ++ K   SL+ 
Sbjct: 5   IYISLTSLLFLGCASQEPDI---------------HFEKPEIQIPKKAPEAKKNKGSLYS 49

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT-- 123
               +LF D + L +GDI+ + I+ D  A  DN+     NN  +    G F+  G  T  
Sbjct: 50  MQGTSLFADKKDLQIGDIIQIIIKEDLTAKSDNKR-ELTNNRNNNLGGGLFTPMGTNTLG 108

Query: 124 -------PQMNGNLNYDGGGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
                   + N +L  D G  S+    GK      E  +  I+AI+    +NGN  I G 
Sbjct: 109 GVAESITNESNRSLGVDFGTQSTNSDKGKVKTQFNETFDTTISAIIEETYQNGNYYIRGE 168

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +E+ +  + + + ++G++RP D+ + NS++  +IA  ++ Y   G  +++L  P G   +
Sbjct: 169 KEMLIEGQKQKIVISGVIRPYDITSDNSINSSQIANLKLLYNKDGTESDILDTPWGLNFM 228

Query: 233 ENLSPL 238
             + P 
Sbjct: 229 RKIWPF 234


>gi|152984579|ref|YP_001349647.1| flagellar basal body L-ring protein [Pseudomonas aeruginosa PA7]
 gi|166214823|sp|A6V9B2|FLGH_PSEA7 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|150959737|gb|ABR81762.1| flagellar L-ring protein precursor FlgH [Pseudomonas aeruginosa
           PA7]
          Length = 231

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 80/164 (48%), Gaps = 13/164 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ----QTPQM 126
           L+ D +A  VGDI+T+ +    QA     +   +++     L+   SLFG       P  
Sbjct: 58  LYDDRKAFRVGDIITITLNEKTQASKKANSDIQKDSKTKMGLT---SLFGSGMTTNNPIG 114

Query: 127 NGNLNYDG--GGASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQEVRVNDEI 181
            G+L+     GG+   KG  S+A + N L  +I   V  +L NG L + G + + +N   
Sbjct: 115 GGDLSLSAEYGGSRDAKGD-SQAGQSNSLTGSITVTVAEVLPNGILSVRGEKWMTLNTGN 173

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
             + + G+VR  D+   N+V   ++A+ARI+Y G G   +  +P
Sbjct: 174 ELVRIAGLVRADDIATDNTVPSTRVADARITYSGTGAFADASQP 217


>gi|28897556|ref|NP_797161.1| flagellar basal body L-ring protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153839681|ref|ZP_01992348.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ3810]
 gi|260364614|ref|ZP_05777216.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus K5030]
 gi|260878281|ref|ZP_05890636.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AN-5034]
 gi|260898111|ref|ZP_05906607.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus Peru-466]
 gi|260901957|ref|ZP_05910352.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ4037]
 gi|14548053|sp|Q9X9J5|FLGH1_VIBPA RecName: Full=Flagellar L-ring protein 1; AltName: Full=Basal body
           L-ring protein 1; Flags: Precursor
 gi|5361011|gb|AAD42918.1|U12817_12 polar flagellar FlgH homolog [Vibrio parahaemolyticus]
 gi|28805768|dbj|BAC59045.1| flagellar L-ring protein precursor FlgH [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149746791|gb|EDM57779.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ3810]
 gi|308086115|gb|EFO35810.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus Peru-466]
 gi|308090111|gb|EFO39806.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AN-5034]
 gi|308106777|gb|EFO44317.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ4037]
 gi|308115099|gb|EFO52639.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus K5030]
 gi|328473450|gb|EGF44298.1| flagellar basal body L-ring protein [Vibrio parahaemolyticus 10329]
          Length = 259

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 83/169 (49%), Gaps = 9/169 (5%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+   H   L+ DS+   +GDI+TV +     A        S+ N           + G
Sbjct: 84  SLFSPEHITDLYDDSKPRGIGDIITVTLDETTSATKSANADLSKTNEAQMD---PLQVGG 140

Query: 121 QQTPQMNG--NLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           ++  ++ G  N +YD    ++  G  S  ++  ++  I   V  +L NGNL+I G + + 
Sbjct: 141 EEL-KVGGKYNFSYDLNNTNTFAGDSSAKQSNSISGYITVEVIEVLANGNLVIRGEKWMT 199

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           +N     + ++G +RP D++  N+++ ++++ ARI Y G G + ++  P
Sbjct: 200 LNTGDEYIRLSGTIRPDDINFDNTIASNRVSNARIQYSGTGLSQDMQEP 248


>gi|167614840|ref|ZP_02383475.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           Bt4]
 gi|257141425|ref|ZP_05589687.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           E264]
          Length = 218

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 72/151 (47%), Gaps = 12/151 (7%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP---QM 126
           +L  D RA   GD LTV +    QA     T   +N  +  K      LFG   P     
Sbjct: 55  SLASDGRAYRPGDTLTVTLEETTQASKRADTKFGKNGDMAVKPG---VLFGSTVPFDSSF 111

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
               N+DGGG+SS + ++ R E     I  IV  +L  G L + G + + +N     + +
Sbjct: 112 GAKRNFDGGGSSSQQNTL-RGE-----ITVIVNQVLAGGLLQVKGEKVLSLNQGEEVMRL 165

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +G VR  D+D +N VS  +IA ARI Y GKG
Sbjct: 166 SGYVRQADIDTNNRVSSRRIANARIKYVGKG 196


>gi|315635631|ref|ZP_07890894.1| flagellar basal body L-ring protein FlgH [Arcobacter butzleri JV22]
 gi|315479928|gb|EFU70598.1| flagellar basal body L-ring protein FlgH [Arcobacter butzleri JV22]
          Length = 234

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 110/246 (44%), Gaps = 30/246 (12%)

Query: 7   IVLCYSSLLF-GCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWR 65
           I +  +SLLF GC S   +I               +   P + I  K  ++ K   SL+ 
Sbjct: 5   IYISLTSLLFLGCASQEPDI---------------HFEKPEIQIPKKAPEAKKNKGSLYS 49

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQT-- 123
               +LF D + L +GDI+ + I+ D  A  DN+     NN  +    G F+  G  T  
Sbjct: 50  MQGTSLFADKKDLQIGDIIQIIIKEDLTAKSDNKR-ELTNNRNNNLGGGLFTPMGTNTLG 108

Query: 124 -------PQMNGNLNYDGGGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIISGS 172
                   + N +L  D G  S+    GK      E  +  I+AI+    +NGN  I G 
Sbjct: 109 GVAESITNESNRSLGVDFGTQSTNSDKGKVKTQFNETFDTTISAIIEETYQNGNYYIRGE 168

Query: 173 QEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLI 232
           +E+ +  + + + ++G++RP D+ + NS++  +IA  ++ Y   G  +++L  P G   +
Sbjct: 169 KEMLIEGQKQKIIISGVIRPYDITSDNSINSSQIANLKLLYNKDGTESDILDTPWGLNFM 228

Query: 233 ENLSPL 238
             + P 
Sbjct: 229 RKIWPF 234


>gi|186477527|ref|YP_001858997.1| flagellar L-ring protein [Burkholderia phymatum STM815]
 gi|184193986|gb|ACC71951.1| flagellar L-ring protein [Burkholderia phymatum STM815]
          Length = 228

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 97/212 (45%), Gaps = 33/212 (15%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
           +L GC S+   I   P + P+ S+       P       N ++    Y   +     L++
Sbjct: 21  VLAGCGSTKDSIVDTPMLPPLASA-------PI------NVNTQGSIYQAGQS--LLLYE 65

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN-- 131
             RA ++GD+LT+ +        ++ TG   +NS + + S    +  +   +  G     
Sbjct: 66  TPRAQHIGDVLTIRLS-------ESYTG---SNSANAQASRASDITAEAADKSTGTAARL 115

Query: 132 ---YDGGGASS---GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              ++ G AS+   G+GSI+    +   +A  V   +  GNL++SG + + +      L 
Sbjct: 116 ARLFNIGSASTTFKGQGSIADTSGMTGTLAVTVIGTMPTGNLVVSGEKLISMGGNRDRLR 175

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++GIV P+D++  N V+  K+A ARI   G+G
Sbjct: 176 LSGIVNPKDIETGNYVASSKVANARIEQAGQG 207


>gi|153840133|ref|ZP_01992800.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ3810]
 gi|149746241|gb|EDM57331.1| flagellar L-ring protein FlgH [Vibrio parahaemolyticus AQ3810]
          Length = 186

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 83/171 (48%), Gaps = 13/171 (7%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF- 119
           SL+   H   L+ DS+   +GDI+TV +     A       +S N  L +          
Sbjct: 11  SLFSPEHITDLYDDSKPRGIGDIITVTLDETTSAT------KSANADLSKTNEAQMDPLQ 64

Query: 120 -GQQTPQMNG--NLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
            G +  ++ G  N +YD    ++  G  S  ++  ++  I   V  +L NGNL+I G + 
Sbjct: 65  VGGEELKVGGKYNFSYDLNNTNTFAGDSSAKQSNSISGYITVEVIEVLANGNLVIRGEKW 124

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           + +N     + ++G +RP D++  N+++ ++++ ARI Y G G + ++  P
Sbjct: 125 MTLNTGDEYIRLSGTIRPDDINFDNTIASNRVSNARIQYSGTGLSQDMQEP 175


>gi|323697474|ref|ZP_08109386.1| flagellar L-ring protein [Desulfovibrio sp. ND132]
 gi|323457406|gb|EGB13271.1| flagellar L-ring protein [Desulfovibrio desulfuricans ND132]
          Length = 231

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/248 (22%), Positives = 101/248 (40%), Gaps = 27/248 (10%)

Query: 1   MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGID-FKNSDSTKK 59
           M RY  +V+    L  GC                     EN  MP L    ++  D    
Sbjct: 1   MRRYFLMVMAAILLASGCARKY-----------------ENEPMPVLTPPAYEEQDPASN 43

Query: 60  SYSLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS----- 113
             SL+  + +  L+ D+RA  VGDI+ V +         ++T   ++N +   +S     
Sbjct: 44  PGSLYDTNRSEFLYDDNRASRVGDIVLVQVAETATTKIKSETTADKSNDVDTSVSAMPTT 103

Query: 114 ---GGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
              G   L      +    +  +     SG G   +       +A  +   L    L + 
Sbjct: 104 GIVGNVPLAETLGAKAGVGILANQSSKFSGTGETKQESNFEATVATRIVRRLPGNILQVE 163

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQ 230
           G++ +RVN+E + L V G++R +D+ + N++    +AEA+I   G+G   +  +P    +
Sbjct: 164 GARRIRVNNETQFLVVRGLIRERDISSSNTIPSTSLAEAQIEIYGQGVLADKQKPGWLSR 223

Query: 231 LIENLSPL 238
           +++N+ P 
Sbjct: 224 ILDNVFPF 231


>gi|83716377|ref|YP_438392.1| flagellar basal body L-ring protein [Burkholderia thailandensis
           E264]
 gi|110816522|sp|Q2T8V7|FLGH2_BURTA RecName: Full=Flagellar L-ring protein 2; AltName: Full=Basal body
           L-ring protein 2; Flags: Precursor
 gi|83650202|gb|ABC34266.1| flagellar L-ring protein FlgH [Burkholderia thailandensis E264]
          Length = 217

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 72/151 (47%), Gaps = 12/151 (7%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP---QM 126
           +L  D RA   GD LTV +    QA     T   +N  +  K      LFG   P     
Sbjct: 54  SLASDGRAYRPGDTLTVTLEETTQASKRADTKFGKNGDMAVKPG---VLFGSTVPFDSSF 110

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
               N+DGGG+SS + ++ R E     I  IV  +L  G L + G + + +N     + +
Sbjct: 111 GAKRNFDGGGSSSQQNTL-RGE-----ITVIVNQVLAGGLLQVKGEKVLSLNQGEEVMRL 164

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +G VR  D+D +N VS  +IA ARI Y GKG
Sbjct: 165 SGYVRQADIDTNNRVSSRRIANARIKYVGKG 195


>gi|148546710|ref|YP_001266812.1| flagellar basal body L-ring protein [Pseudomonas putida F1]
 gi|166214824|sp|A5W0G8|FLGH_PSEP1 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|148510768|gb|ABQ77628.1| flagellar L-ring protein [Pseudomonas putida F1]
          Length = 231

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 80/169 (47%), Gaps = 23/169 (13%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-NSLHRKLS----GGFSLFGQQTPQ 125
           L+ D +A  VGDI+T+ +        + +T  S+N  S   K S    G  SLFG  TP 
Sbjct: 58  LYSDRKAFRVGDIITITL--------NERTSASKNAGSQIAKTSKTDIGLTSLFGT-TPN 108

Query: 126 MN-----GNLN----YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
            N     G+L+    Y G  A+ G    ++   L   I   V  +L NG + + G + + 
Sbjct: 109 TNNPFGGGDLSLEAGYSGDRATKGDSKATQGNTLTGSITVTVAEVLPNGIIAVRGEKWLT 168

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           +N     + + G++R  D+   N+V   ++A+ARI+Y G G   +  +P
Sbjct: 169 LNTGEELVRIAGMIRADDIATDNTVPSTRVADARITYSGTGSFADASQP 217


>gi|104782839|ref|YP_609337.1| flagellar basal body L-ring protein [Pseudomonas entomophila L48]
 gi|122402466|sp|Q1I732|FLGH_PSEE4 RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|95111826|emb|CAK16550.1| flagellar basal-body outer-membrane L ring protein [Pseudomonas
           entomophila L48]
          Length = 231

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 84/166 (50%), Gaps = 15/166 (9%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN-- 127
           +L+ D +A  VGDI+T+ +     A  +  +   +N+     L+   SLFG  +P  N  
Sbjct: 57  SLYTDRKAFRVGDIITITLNERTSASKNAGSQIQKNSKADIGLT---SLFGS-SPNTNNP 112

Query: 128 ---GNLNYDGG--GASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQEVRVND 179
              G+L+ + G  G  + KG  S+A + N L  +I   V  +L NG + + G + + +N 
Sbjct: 113 FGGGDLSLEAGYSGDRTTKGD-SKATQGNTLTGSITVTVAEVLPNGIIAVRGEKWMTLNT 171

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
               + + G+VR  D+   N+V   ++A+ARI+Y G G   +  +P
Sbjct: 172 GEELVRIAGLVRADDIATDNTVPSTRVADARITYSGTGSFADASQP 217


>gi|262404537|ref|ZP_06081092.1| flagellar L-ring protein FlgH [Vibrio sp. RC586]
 gi|262349569|gb|EEY98707.1| flagellar L-ring protein FlgH [Vibrio sp. RC586]
          Length = 258

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 78/157 (49%), Gaps = 7/157 (4%)

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTG-RSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           + DS+   +GDI+TV +    +A        + +N+S    L+ G    G+     + N 
Sbjct: 95  YDDSKPRGIGDIITVTLNESTKAAKSADADLKKKNDSKMDPLAVG----GKDLTVGDYNF 150

Query: 131 NY--DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           +Y        +G  + +++  ++  I   V  +L NGNL+I G + + +N     + ++G
Sbjct: 151 SYALKNDNKFTGSAAANQSNSMSGSITVEVIEVLANGNLVIRGEKWLTLNTGDEYIRLSG 210

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
            +RP D+D  N+++ ++I+ ARI Y G G   ++  P
Sbjct: 211 TIRPDDIDFDNTIASNRISNARIQYSGTGTNQDMQEP 247


>gi|171059409|ref|YP_001791758.1| flagellar L-ring protein [Leptothrix cholodnii SP-6]
 gi|170776854|gb|ACB34993.1| flagellar L-ring protein [Leptothrix cholodnii SP-6]
          Length = 233

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 73/153 (47%), Gaps = 6/153 (3%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           ++  LF+D RA  VGD LTV I     A   + +   ++ S+   L+        Q    
Sbjct: 64  AYRPLFEDHRARLVGDTLTVQIVEKVSASAKSTSTVEKSGSVDASLTA----LPYQGVAA 119

Query: 127 NGNLNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
            G L   G   +  +GKG    + + +  I   V  +L NG+L+I+G +++ VND    L
Sbjct: 120 LGKLGVGGSSTNKFAGKGGTENSNEFSGTITTTVIEVLPNGHLLIAGEKQIGVNDNADVL 179

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
             +G V P+ +   NSV+  +IA  R+   G+G
Sbjct: 180 RFSGQVDPRSIQPGNSVASAQIANVRVEQRGRG 212


>gi|126445308|ref|YP_001061249.1| flagellar basal body L-ring protein [Burkholderia pseudomallei 668]
 gi|134280650|ref|ZP_01767360.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 305]
 gi|167725933|ref|ZP_02409169.1| flagellar basal body L-ring protein [Burkholderia pseudomallei
           DM98]
 gi|254182891|ref|ZP_04889484.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1655]
 gi|254299683|ref|ZP_04967132.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 406e]
 gi|125657221|gb|ABN48709.1| flagellar basal body L-ring protein [Burkholderia pseudomallei]
 gi|126224799|gb|ABN88304.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 668]
 gi|134247672|gb|EBA47756.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 305]
 gi|157809608|gb|EDO86778.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 406e]
 gi|184213425|gb|EDU10468.1| flagellar L-ring protein FlgH [Burkholderia pseudomallei 1655]
          Length = 218

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 74/155 (47%), Gaps = 12/155 (7%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP---QM 126
           +L  D RA   GD LTV +    QA     T   +N  +  K      LFG   P     
Sbjct: 55  SLASDGRAYRPGDTLTVTLEETTQASKRADTKFGKNGDMAVKPG---VLFGSAIPFDSSF 111

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
               N+DGGG+SS + ++ R E     I  IV  +L  G L + G + + +N     + +
Sbjct: 112 GAKRNFDGGGSSSQQNTL-RGE-----ITVIVNQVLAGGLLQVKGEKVLSLNQGEEVMRL 165

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           +G VR  D+D +N VS  ++A ARI Y GKG  ++
Sbjct: 166 SGYVRQADIDTNNRVSSRRLANARIKYVGKGALSD 200


>gi|163783623|ref|ZP_02178612.1| flagellar L-ring protein FlgH [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881116|gb|EDP74631.1| flagellar L-ring protein FlgH [Hydrogenivirga sp. 128-5-R1-1]
          Length = 208

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 76/167 (45%), Gaps = 16/167 (9%)

Query: 64  WRDSHAALFKDSRALNVGDILTVDIRIDDQAV--FDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           W D    L+ ++RA   GD++ + +     AV    NQ G+S   +    +S   S FG 
Sbjct: 40  WTD----LYGENRATKPGDLIFIYVVESINAVESLSNQAGKS--TAFSNAIS---SFFG- 89

Query: 122 QTPQMN-GNLNYDGGGASSGKGS--ISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
             PQ    NL     G  + K S  + +   L   +A  V  +  N  ++I   + + VN
Sbjct: 90  -VPQNTLANLGSGAEGKFNTKASSKVQQTGTLTTKLAGRVVKVYPNRTMLIEAKKYIMVN 148

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
              R   + GI+RP+D+D+ N+V  DKIA   I   GKG   E  +P
Sbjct: 149 GMKREFILRGIIRPEDIDSTNTVPSDKIANMEIFLDGKGYMAEGGKP 195


>gi|296282276|ref|ZP_06860274.1| flagellar L-ring protein precursor FlgH [Citromicrobium
           bathyomarinum JL354]
          Length = 223

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 80/171 (46%), Gaps = 7/171 (4%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +A L+  +RA  VGD++T+ +      +    T ++ +    R  + G  L     P   
Sbjct: 60  YAPLYNGTRAARVGDLVTIVL------IERTSTTKATSGKTQRDGNAGLDL-PDFIPVDP 112

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
           G+LN     + +G G+ ++   L   +   +  +  NG  ++ G + +  +     + ++
Sbjct: 113 GDLNASAAASFTGAGNAAQTSSLRGDLTVTIAEVRPNGTALVRGEKVMNFSQGEEWVQLS 172

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           GI+R  D+DA N ++  ++A+A+I+Y GKG      +P    +    +SP 
Sbjct: 173 GIIRLSDIDADNRIASIRVADAQIAYSGKGAVQRAGKPGWLSRFFSIVSPF 223


>gi|300314024|ref|YP_003778116.1| flagellar basal body L-ring protein [Herbaspirillum seropedicae
           SmR1]
 gi|300076809|gb|ADJ66208.1| flagellar basal body L-ring protein [Herbaspirillum seropedicae
           SmR1]
          Length = 221

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 80/157 (50%), Gaps = 2/157 (1%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG-GFSLFG 120
           +++R S A LF++  A NVGDI+ +DI     +     T  SR++SL +K  G G  L G
Sbjct: 47  AIFRVSSAQLFEEPTAYNVGDIIKIDISESISSSNKAATNNSRDSSLTQKGPGSGAPLGG 106

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
             T   + N +  G     G G  S    ++  +   +  +L N NL+++G + + VN  
Sbjct: 107 LFTQLYDANYSASGNNTFKGSGDSSNTNTMSGTLMVSIVEVLPNRNLVVAGEKRIGVNGN 166

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           I +L  +G+VR +D+     V+   +A+AR+   G G
Sbjct: 167 INTLRFSGVVRTRDIRGG-IVASSNVADARLEQVGGG 202


>gi|326386933|ref|ZP_08208547.1| Flagellar L-ring protein precursor, putative [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208613|gb|EGD59416.1| Flagellar L-ring protein precursor, putative [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 251

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 77/158 (48%), Gaps = 20/158 (12%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +A L + +RA  VGD +T+ + +++     + TG+++        SG F+     TP   
Sbjct: 85  YAGLVEGTRAHTVGDAVTI-VLVENFNSSKSATGKTQK-------SGSFAF----TPPTK 132

Query: 128 G--------NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
           G         LN  G  A +G+G+ S+   L   IA  +  +  NG  ++ G + + ++ 
Sbjct: 133 GPLSLLSSNALNSSGAAAFNGQGNASQTSTLGGNIAVTIAEVRRNGTALVKGEKRLLLSQ 192

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
               +  +GI+R  DVD +N +   ++A+AR+ Y G G
Sbjct: 193 GDEWVQFSGIIRLADVDQYNQIQSSQVADARMIYTGNG 230


>gi|269103187|ref|ZP_06155884.1| flagellar L-ring protein FlgH [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163085|gb|EEZ41581.1| flagellar L-ring protein FlgH [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 259

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 83/160 (51%), Gaps = 8/160 (5%)

Query: 62  SLWRDSHAA-LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+  +H   L+ D+R  ++GDI+T+ +     A     +   ++  ++ K     +L G
Sbjct: 85  SLFNQTHVQDLYDDTRPHSIGDIVTILLEEKTAAKKSATSELDKSADMNMK---PIALGG 141

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQEVRV 177
           +     + +L+YD    ++  GS S A++ N +  +I   V  IL NGNL+I G + + +
Sbjct: 142 KPVTIHDYSLSYDFSNDNTFSGS-STADQSNSIKGSISVEVIDILANGNLVIRGEKWLTL 200

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           N     + V+G +RP D+   N++   +I+ ARI Y G G
Sbjct: 201 NSGDEFIRVSGHIRPDDISQDNTIPSTRISNARIQYSGTG 240


>gi|162219162|ref|YP_746586.2| flagellar basal body L-ring protein [Nitrosomonas eutropha C91]
          Length = 246

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 78/161 (48%), Gaps = 16/161 (9%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF-----SLFGQQ 122
           +  LF+D RA  +GD + V        + + +T  S+ +  + +  GG      S  G  
Sbjct: 78  YTPLFEDRRARGIGDTIIV--------MLNEKTNASKKSGSNAQRDGGIDLSVPSFLGLP 129

Query: 123 TPQMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
              +  +L+ +   ++   GKG  S        I   V  IL NGNL++SG +++ +N  
Sbjct: 130 FKSIFQDLDLEAKSSNKFDGKGESSSNNNFTGTITVTVIDILPNGNLLVSGEKQIGINQG 189

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
              + ++G++ P +V  +N+VS  ++A+ARI Y G G   E
Sbjct: 190 HEFIRLSGVINPINV-MNNTVSSVQVADARIEYRGTGYLDE 229


>gi|283780139|ref|YP_003370894.1| flagellar L-ring protein [Pirellula staleyi DSM 6068]
 gi|283438592|gb|ADB17034.1| flagellar L-ring protein [Pirellula staleyi DSM 6068]
          Length = 242

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 89/189 (47%), Gaps = 17/189 (8%)

Query: 60  SYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           S S W ++     K+ R   V DI+T+ + +  Q V +++    +N   +  LS    L 
Sbjct: 61  SPSSWYETPLPPPKEVR---VNDIITIRVDLGSQVVSESEFQSRKNAQYNLLLSEWIKLD 117

Query: 120 GQQT----------PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLII 169
           G ++          PQ+NG+LN      +   G +   E++   IAA V ++L NGNL++
Sbjct: 118 GLKSVKPTGMADGEPQINGSLNQ----LNRVTGELETTEQIKFEIAATVASVLPNGNLVV 173

Query: 170 SGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGH 229
              + V+ N E    +++G+VR +D+   N V    +A  +IS    G+  +  R    +
Sbjct: 174 EAHRSVQNNHEQWMHSLSGVVRREDIGPGNIVLSKDMANLQISKRENGQVRDTYRRGWVN 233

Query: 230 QLIENLSPL 238
           + ++  +P 
Sbjct: 234 RWLDTFNPF 242


>gi|254462235|ref|ZP_05075651.1| flagellar L-ring protein FlgH [Rhodobacterales bacterium HTCC2083]
 gi|206678824|gb|EDZ43311.1| flagellar L-ring protein FlgH [Rhodobacteraceae bacterium HTCC2083]
          Length = 216

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 77/157 (49%), Gaps = 10/157 (6%)

Query: 62  SLWRDSHAALFK-DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           S++  + + LF  + RA  VGDILT+ +    QA        ++++SL   +    +L  
Sbjct: 48  SIYHANASGLFAVEQRASKVGDILTIALNESFQATKSQTASAAKSDSLSLSVP---NLLN 104

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                     N++G GA+    S +       L+   V  ++ NGNL + G +++ +N+ 
Sbjct: 105 VPVASTGSAQNFEGNGAAEQSNSFTG------LVTVSVVRVMSNGNLEVLGQKKLTLNNG 158

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
              + V+G+VR  D+   N V+ +++A A I+Y G G
Sbjct: 159 DEYVRVSGLVRQSDISPTNVVNSNRLANAEITYIGAG 195


>gi|260772277|ref|ZP_05881193.1| flagellar L-ring protein FlgH [Vibrio metschnikovii CIP 69.14]
 gi|260611416|gb|EEX36619.1| flagellar L-ring protein FlgH [Vibrio metschnikovii CIP 69.14]
          Length = 260

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 74/158 (46%), Gaps = 5/158 (3%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
           +L+ D++   +GDI+TV +  + +A        ++NN          S+ GQ+    + N
Sbjct: 95  SLYSDAKPRGIGDIITVTLNENTKATKSADAKLTKNNDASMD---PLSVGGQELTIGDYN 151

Query: 130 LNY--DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
            +Y        SG    ++   L   I   V  +L NGNL++ G + + +N     + ++
Sbjct: 152 FSYALKNNNQFSGSAQANQNNNLQGSITVEVIDVLSNGNLVVRGEKWLMLNTGDEYIRLS 211

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
           G VRP D+   N+++ ++I+  RI Y   G   ++  P
Sbjct: 212 GTVRPDDIGYDNTIASNRISNTRIQYSSTGSNQDMQEP 249


>gi|74317649|ref|YP_315389.1| flagellar L-ring protein FlgH [Thiobacillus denitrificans ATCC
           25259]
 gi|110816545|sp|Q3SIE4|FLGH_THIDA RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|74057144|gb|AAZ97584.1| flagellar L-ring protein precursor FlgH [Thiobacillus denitrificans
           ATCC 25259]
          Length = 222

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 80/147 (54%), Gaps = 2/147 (1%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           ++  LF+D RA +VGD+LT+ I    +A  +  +  S+ +++   + GG +    +  Q 
Sbjct: 53  TYRPLFEDRRARHVGDVLTIVINERTRAGKEASSSASKTSAVDASV-GGVAKLPLKMFQG 111

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
            G +N +       + ++  +   +  +   V  +L NGNL+++G +++ ++     + +
Sbjct: 112 LG-INAEASAEYEDESALDSSNTFSGNVTVTVIEVLPNGNLVVAGEKQIGLDKGTEYIRL 170

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISY 213
           +G+V+P  + A N+VS  K+A+ARI Y
Sbjct: 171 SGVVQPDTIQAGNTVSSAKVADARIEY 197


>gi|114307378|gb|ABI58621.1| flagellar L-ring protein [Nitrosomonas eutropha C91]
          Length = 212

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 78/161 (48%), Gaps = 16/161 (9%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGF-----SLFGQQ 122
           +  LF+D RA  +GD + V        + + +T  S+ +  + +  GG      S  G  
Sbjct: 44  YTPLFEDRRARGIGDTIIV--------MLNEKTNASKKSGSNAQRDGGIDLSVPSFLGLP 95

Query: 123 TPQMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
              +  +L+ +   ++   GKG  S        I   V  IL NGNL++SG +++ +N  
Sbjct: 96  FKSIFQDLDLEAKSSNKFDGKGESSSNNNFTGTITVTVIDILPNGNLLVSGEKQIGINQG 155

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
              + ++G++ P +V  +N+VS  ++A+ARI Y G G   E
Sbjct: 156 HEFIRLSGVINPINV-MNNTVSSVQVADARIEYRGTGYLDE 195


>gi|332994159|gb|AEF04214.1| flagellar basal body L-ring protein [Alteromonas sp. SN2]
          Length = 214

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 79/161 (49%), Gaps = 9/161 (5%)

Query: 62  SLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           SL+R   A +L+ D  A  VGDI+T+ +  +  A     T  S++ ++      G  L G
Sbjct: 36  SLFRSYMANSLYSDMTARRVGDIITITLSENTNASKSAGTSTSKDTTVDLDTITG--LGG 93

Query: 121 QQTPQMNGNLNYDGGGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           Q  P   G  +   G +SS    G  + +++  L+  I+  V  +L N NL+I G + + 
Sbjct: 94  Q--PLNIGGQSVQLGVSSSNEFEGDAATNQSNSLSGNISVTVVEVLPNDNLVIRGEKWLT 151

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +N     + +TGI+R  D+   N V   KIA ARI Y G G
Sbjct: 152 LNHGDEYIRLTGIIRLSDISPENEVLSTKIANARIQYSGTG 192


>gi|242278486|ref|YP_002990615.1| flagellar basal body L-ring protein [Desulfovibrio salexigens DSM
           2638]
 gi|242121380|gb|ACS79076.1| flagellar L-ring protein [Desulfovibrio salexigens DSM 2638]
          Length = 232

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 79/176 (44%), Gaps = 8/176 (4%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN--- 127
           LF D+RA  +GDI+ V +    +    + +   + N     ++   +         N   
Sbjct: 57  LFDDNRARRIGDIVVVTVSETSKGKHTSDSKAEKKNDTSLAVTNFSAGLATAVDPFNMKG 116

Query: 128 --GNLNYDGGGAS---SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
             G+    G   S   S  G       L   +A  V  IL    + + G+++VR+NDE +
Sbjct: 117 GAGDTPLIGSATSNKFSSTGETKNESTLTASVACRVVRILPGNVMQVEGARQVRINDETQ 176

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            L V G++R +D+   N+V+ + +A+A I   G+G   +  RP    ++++N+ P 
Sbjct: 177 VLVVRGLLRHRDIGPSNTVASNYLADAHIEVYGRGILADKQRPGWLSRILDNVWPF 232


>gi|149173755|ref|ZP_01852384.1| probable flagellar L-ring protein precursor FlgH [Planctomyces
           maris DSM 8797]
 gi|148847285|gb|EDL61619.1| probable flagellar L-ring protein precursor FlgH [Planctomyces
           maris DSM 8797]
          Length = 306

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 76/169 (44%), Gaps = 12/169 (7%)

Query: 78  LNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL--------SGGFSLFGQQTPQMNGN 129
           + V DI+T+ +        D++  R+R  +L  +L        +G  +     +P+++  
Sbjct: 142 VKVHDIITIMVDEKSSVTVDSRFNRNRTETLKAELKEFMRIDSAGNLAPAALNSPKIDTQ 201

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           L     G     G ++  E +   IAAIV  I  NGNLI+   + +R N ++    +TG 
Sbjct: 202 LQ----GRLQSTGQLADREGIQYRIAAIVVDIRPNGNLILEARKSIRTNHDVWEYRLTGE 257

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           +R +DV+  N+   + IA   I    +G+  +  + P G  L +   P 
Sbjct: 258 IRSKDVNRDNTALSENIANLDIVKHQRGKVYQSTKRPWGVVLYDWFFPF 306


>gi|307731194|ref|YP_003908418.1| flagellar L-ring protein [Burkholderia sp. CCGE1003]
 gi|307585729|gb|ADN59127.1| flagellar L-ring protein [Burkholderia sp. CCGE1003]
          Length = 222

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 97/219 (44%), Gaps = 33/219 (15%)

Query: 7   IVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRD 66
           + LC +++L  C S    I   P   P+ S+       P       N ++    Y     
Sbjct: 8   VALCAAAVLSACASGERSIVETPMAPPLVSA-------PL------NVNTQGAIYQ--AG 52

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           +   L++  RA ++GD+LT  IR+ +          S NNS     S   S+      + 
Sbjct: 53  TLMVLYETPRAQHIGDVLT--IRLSES--------YSGNNSSTAAASRASSITADAADKS 102

Query: 127 NGNLN-----YDGGGASS---GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
            G        ++ G AS+   G+GS++    +   +A  V   +  GNLI+SG + + ++
Sbjct: 103 TGAAARLARLFNIGSASTDFKGQGSLTDVSGMTGTLAVTVIGTMPTGNLIVSGEKVISMS 162

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
                L ++G+V P+D++A N V+  K+A ARI   G G
Sbjct: 163 GNRDRLRLSGVVNPKDIEAGNYVASSKVANARIEQAGTG 201


>gi|134095094|ref|YP_001100169.1| basal-body outer-membrane L (lipopolysaccharide layer) ring protein
           [Herminiimonas arsenicoxydans]
 gi|166214821|sp|A4G6A8|FLGH_HERAR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|133738997|emb|CAL62045.1| Flagellar L-ring protein precursor (Basal body L-ring protein)
           [Herminiimonas arsenicoxydans]
          Length = 223

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 73/147 (49%), Gaps = 10/147 (6%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN- 129
           +F+D RA  +GD +T+ I     A     +  S+  S+       F L G  T +++ + 
Sbjct: 58  MFEDRRARLIGDTITIVINEKSSAGKQAGSAASKTGSVTASAPNVFGLLGSLTNRLSASG 117

Query: 130 ---LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
              + Y+       KG+++ +      +   V  +L NGNLI++G ++V ++     +  
Sbjct: 118 SNAIKYED------KGAVTSSNNFISTMTVTVIDVLSNGNLIVAGEKQVSLDKGSEFIRF 171

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISY 213
           +G+V P  V++ N VS  ++A+A+I Y
Sbjct: 172 SGVVDPSTVNSGNIVSSTQVADAKIEY 198


>gi|87119673|ref|ZP_01075570.1| flagellar L-ring protein FlgH [Marinomonas sp. MED121]
 gi|86165149|gb|EAQ66417.1| flagellar L-ring protein FlgH [Marinomonas sp. MED121]
          Length = 280

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 73/154 (47%), Gaps = 17/154 (11%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG-- 128
            F    A  VGDILT+++     +   N    S+++S              Q P++ G  
Sbjct: 117 FFGSQTASRVGDILTINLSETTSSSKSNDATLSKSSSAE-----------VQNPRVVGTE 165

Query: 129 -NLNY---DGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
            N++    DGG   +G    +++  LN  I   V  +  NG L I G + V +N     +
Sbjct: 166 VNIDSVLPDGGTNFAGSAGANQSNSLNGTITVTVYDVYPNGVLAIRGEKWVTLNRGDEYI 225

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
            +TGI+R +D+  +N++   ++A+ARI+Y G G 
Sbjct: 226 RLTGIIRKRDIKPNNTIDSSRVADARITYSGSGE 259


>gi|332296514|ref|YP_004438437.1| flagellar L-ring protein [Thermodesulfobium narugense DSM 14796]
 gi|332179617|gb|AEE15306.1| flagellar L-ring protein [Thermodesulfobium narugense DSM 14796]
          Length = 202

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 79/157 (50%), Gaps = 12/157 (7%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP-- 124
           S+  L+ D +A +VGD + V        +       S + S  ++ S   S    Q P  
Sbjct: 32  SYVNLYSDVKAHSVGDTVMV--------LLSENLNSSTSTSTKKQGSYSNSNSATQVPFV 83

Query: 125 --QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
              +  N++  G G  S +GS  R+  +   I A +  +L +G L I G + ++VN E +
Sbjct: 84  KNPLKTNMSASGSGQYSDQGSNGRSATITGDIEARIVEVLPSGLLRIEGQKNIQVNKEKQ 143

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRT 219
           S+ ++G++RP+D+  +N++   +I++A+I+  G   T
Sbjct: 144 SIIISGLIRPEDISNNNTIYSYQISDAQITIKGTSPT 180


>gi|54308100|ref|YP_129120.1| flagellar basal body L-ring protein [Photobacterium profundum SS9]
 gi|81615376|sp|Q6LTQ7|FLGH_PHOPR RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|46912526|emb|CAG19318.1| putative flagellar L-ring protein FlgH [Photobacterium profundum
           SS9]
          Length = 256

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 72/149 (48%), Gaps = 5/149 (3%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           L+ D++   +GDI+TV +    QA     +   ++  L         L G+     + +L
Sbjct: 92  LYDDTKPRGIGDIVTVMLEEKTQAKKSASSDLDKSTDLSMD---PLVLGGKPLTIGDRDL 148

Query: 131 NYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           +Y+   A+  SG  S  ++  +   I+  V  +L NGNL+I G + + +N     + V+G
Sbjct: 149 SYEVANANKFSGTTSADQSNSIKGSISVEVIDVLANGNLMIRGEKWLTLNTGDEYIRVSG 208

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            +RP D+   N++   +I  ARI Y G G
Sbjct: 209 TIRPDDISQENTIESTRITNARIQYSGTG 237


>gi|262276414|ref|ZP_06054223.1| flagellar L-ring protein FlgH [Grimontia hollisae CIP 101886]
 gi|262220222|gb|EEY71538.1| flagellar L-ring protein FlgH [Grimontia hollisae CIP 101886]
          Length = 263

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 77/149 (51%), Gaps = 5/149 (3%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           L+ D++  ++GDI+TV +    QA     +  ++++ L         L G++      NL
Sbjct: 99  LYDDTKPRSIGDIVTVMLEEKTQAKKSASSDAAKSSDLSMD---PLELGGEEITIGERNL 155

Query: 131 NYDGG--GASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           +Y      ++SG  S  ++  ++  I+  V  ++ NGNL+I G + + +N     + ++G
Sbjct: 156 SYAAAHDNSTSGSTSADQSNSISGSISVEVVDVMSNGNLLIRGEKWLTLNTGDEYIRLSG 215

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            +RP D+   N+++  +I+ ARI Y G G
Sbjct: 216 TIRPDDITPENTIASTRISNARIQYSGTG 244


>gi|167567753|ref|ZP_02360669.1| flagellar basal body L-ring protein [Burkholderia oklahomensis
           EO147]
 gi|167574704|ref|ZP_02367578.1| flagellar basal body L-ring protein [Burkholderia oklahomensis
           C6786]
          Length = 219

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 70/154 (45%), Gaps = 12/154 (7%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP-- 124
           S  +L  D RA   GD LTV +    QA     T   +      K      LFG      
Sbjct: 53  SAWSLASDGRAYRPGDTLTVVLEETTQASKRADTRFGKKGDFEFKPG---MLFGNPLTFD 109

Query: 125 -QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
             +    +++G G SS + ++ R E     I  IV  ++  G L + G + + +N     
Sbjct: 110 SSVGVKRDFNGSGTSSQQNTL-RGE-----ITVIVHQVMAGGLLQVKGEKVLALNQGEEI 163

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           + +TG VRP D+D +N VS  +IA ARI Y GKG
Sbjct: 164 MRLTGYVRPADIDTNNRVSSRRIANARIKYVGKG 197


>gi|331007442|ref|ZP_08330619.1| Flagellar L-ring protein FlgH [gamma proteobacterium IMCC1989]
 gi|330418749|gb|EGG93238.1| Flagellar L-ring protein FlgH [gamma proteobacterium IMCC1989]
          Length = 236

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 77/157 (49%), Gaps = 11/157 (7%)

Query: 70  ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKL--SGGFSLFGQQTPQ-- 125
           +LF ++    +GDI+T  I +D++ +    TG   + +    L   G  ++ G+   +  
Sbjct: 60  SLFGNTNNHRIGDIIT--ITLDEETISSKSTGVGIDKTSDVSLLEGGNSTILGRDNTKNI 117

Query: 126 -----MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                +   L+     + SG  S  ++  L   I+  V  IL NGNLI+ G + + +N  
Sbjct: 118 PIVGDVTIPLSSSQDRSFSGDASADQSNSLQGNISVTVVDILANGNLIVRGEKWMTLNRG 177

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
              + V+G++R +DV   N VS  K+A ARISY G G
Sbjct: 178 EEYIRVSGMLRKEDVSLDNVVSSTKLANARISYSGTG 214


>gi|149184210|ref|ZP_01862528.1| flagellar L-ring protein [Erythrobacter sp. SD-21]
 gi|148831530|gb|EDL49963.1| flagellar L-ring protein [Erythrobacter sp. SD-21]
          Length = 217

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 78/154 (50%), Gaps = 15/154 (9%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +A L+  +RA  VGD++T+ +      V   QT +S + S  R  S G SL     P  +
Sbjct: 54  YAPLYYGNRAARVGDLVTIVL------VERTQTSKSTSGSTKRDGSFGLSL-----PTWS 102

Query: 128 G----NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
           G    +LN  GGG+  G G  S+A  +   +   +  +  NG  ++ G + + ++     
Sbjct: 103 GIDSADLNASGGGSFKGSGDASQASSIRADLTVTIAEVRPNGTALVRGEKVMELSQGTEW 162

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           + ++GI+R  D+D  N +   ++A+ARISY G G
Sbjct: 163 VQLSGIIRLADIDQDNRIPSIRVADARISYSGAG 196


>gi|330445351|ref|ZP_08309003.1| flagellar L-ring protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489542|dbj|GAA03500.1| flagellar L-ring protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 261

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 76/150 (50%), Gaps = 7/150 (4%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           L+ D++   +GDI+T+ +     A     +   ++  L+ K      L G+     + NL
Sbjct: 97  LYDDTKPRGIGDIVTILLEEKTAAKKSASSDLDKSTDLNMK---PIELGGKPVTIRDYNL 153

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQEVRVNDEIRSLNVT 187
           +Y     ++  GS S A++ N +  +I   V  +L NGNL+I G + + +N     + V+
Sbjct: 154 SYGMSNNNTFAGSTS-ADQSNSIKGSISVEVVEVLNNGNLVIRGEKWLTLNTGDEYIRVS 212

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           G +RP D+   N+++  +I+ ARI Y G G
Sbjct: 213 GHIRPDDISQDNTIASTRISNARIQYSGTG 242


>gi|254442059|ref|ZP_05055535.1| flagellar L-ring protein FlgH [Verrucomicrobiae bacterium DG1235]
 gi|198256367|gb|EDY80675.1| flagellar L-ring protein FlgH [Verrucomicrobiae bacterium DG1235]
          Length = 200

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 82/163 (50%), Gaps = 11/163 (6%)

Query: 62  SLW---RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           SLW   +++ A +F D  A  VGDIL   I + ++ + +  + ++  +S    +  GF  
Sbjct: 21  SLWNSKKNNEAGMFADRTAARVGDILM--IEVSEETIVNRSSAKT--SSTDSNVGHGFDS 76

Query: 119 FGQ----QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQE 174
                   +  +  +++     + +G GSIS A  +   I+ +V  +  NGNL+I G+++
Sbjct: 77  LVLPDILDSDTVLPSIDISPTESFNGSGSISDANIMESKISVMVVDVKPNGNLVIEGARK 136

Query: 175 VRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  + E + L V GIVR  DVDA+N+V    +  A +    +G
Sbjct: 137 VMSSGEAQYLVVRGIVRGDDVDANNTVLSANVLNAAVELFSEG 179


>gi|221069319|ref|ZP_03545424.1| flagellar L-ring protein [Comamonas testosteroni KF-1]
 gi|220714342|gb|EED69710.1| flagellar L-ring protein [Comamonas testosteroni KF-1]
          Length = 235

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 75/155 (48%), Gaps = 6/155 (3%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG--QQTPQM 126
           +F+D RA  VGD +TV I  R+      D++ GR+  N L   ++    L G  ++T   
Sbjct: 66  MFEDQRARMVGDSVTVQIVERVSASQSTDSKVGRA--NELSTGITSLPLLRGGAEKTVAD 123

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
              L  +      G G+ S        IA  V  +L NG+L+I+G +++ VN  +  L  
Sbjct: 124 ALTLGAESKNDFKGSGATSSNNTFTGSIATTVVDVLPNGHLVIAGEKQIGVNHNVDVLRF 183

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           TG V P+ +   ++V+  ++A  R+    +G+  E
Sbjct: 184 TGTVDPRSLRPGSTVASTQVANLRVESRSRGQAGE 218


>gi|182412219|ref|YP_001817285.1| flagellar L-ring protein [Opitutus terrae PB90-1]
 gi|177839433|gb|ACB73685.1| flagellar L-ring protein [Opitutus terrae PB90-1]
          Length = 214

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 53/95 (55%)

Query: 144 ISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSY 203
           IS  + L+   A +VT +L NGN +I G++ V  + E + + + G+VR  DV   N+V+ 
Sbjct: 120 ISNTQSLSARAAVLVTDVLPNGNFVIEGTRIVTFSGETQYVVLHGLVRADDVGRDNTVAS 179

Query: 204 DKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
             IA+AR+ +  +G+ T+  +     +L E L P 
Sbjct: 180 SNIADARVEFYSEGQLTDAQKRGWFAKLYEKLRPF 214


>gi|90411008|ref|ZP_01219022.1| flagellar L-ring protein precursor [Photobacterium profundum 3TCK]
 gi|90328221|gb|EAS44532.1| flagellar L-ring protein precursor [Photobacterium profundum 3TCK]
          Length = 256

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 72/149 (48%), Gaps = 5/149 (3%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           L+ D++   +GDI+TV +    QA     +   ++  L         L G+     + +L
Sbjct: 92  LYDDTKPRGIGDIVTVMLEEKTQAKKSASSDLDKSTDLSMD---PLVLGGKPLTIGDRDL 148

Query: 131 NYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           +Y+   A+  SG  S  ++  +   I+  V  +L NGNL++ G + + +N     + V+G
Sbjct: 149 SYEVANANKFSGTTSADQSNSIKGSISVEVIDVLANGNLMVRGEKWLTLNTGDEYIRVSG 208

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            +RP D+   N++   +I  ARI Y G G
Sbjct: 209 TIRPDDISQENTIESTRITNARIQYSGTG 237


>gi|85058014|ref|YP_453716.1| flagellar basal body L-ring protein [Sodalis glossinidius str.
           'morsitans']
 gi|84778534|dbj|BAE73311.1| flagellar L-ring protein precursor FlgH [Sodalis glossinidius str.
           'morsitans']
          Length = 253

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 75/163 (46%), Gaps = 18/163 (11%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSG--GFSL 118
           +  LF+D R  N+GD LT+ ++ +  A   + +   R        N+L   L+G  G   
Sbjct: 83  YQPLFEDRRPRNIGDTLTIMLQENVSASKSSSSNADRKGNADLGINALPSMLNGLIGGDR 142

Query: 119 FGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
                   NG   ++G G ++ K + S        I   V  +L NGNL + G +++ +N
Sbjct: 143 LATDIESSNG---FNGKGGAAAKNTFSGT------ITVTVIDVLTNGNLRVVGEKQIAIN 193

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
                +  +GIV P+ +D +N V    +++ARI Y G G   E
Sbjct: 194 QGTEFIRFSGIVNPRTIDGNNQVVSTLVSDARIEYVGDGYINE 236


>gi|84514830|ref|ZP_01002193.1| Flagellar L-ring protein [Loktanella vestfoldensis SKA53]
 gi|84510989|gb|EAQ07443.1| Flagellar L-ring protein [Loktanella vestfoldensis SKA53]
          Length = 215

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 71/157 (45%), Gaps = 10/157 (6%)

Query: 62  SLWRDSHAALFK-DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG 120
           S++    + LF  + RA  VGD+LTV +    QA         ++++    L        
Sbjct: 47  SIYHPGVSGLFAVEQRASKVGDVLTVALNESFQATKSQTATADKSDTTTANLP---RFIS 103

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
              P+     ++ G GA+       ++     L+   V  +  NGNL I G +++ +N  
Sbjct: 104 PNDPEFGMTQSFAGSGAAE------QSNTFTGLVTVSVVRVFPNGNLQILGQKKLTLNSG 157

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
              + V+GIVR  D+   N VS +++A A I+Y G G
Sbjct: 158 DEYVRVSGIVRRSDISPANIVSSNRLANAEITYTGAG 194


>gi|152980334|ref|YP_001353114.1| FlgH flagellar basal body L-ring protein [Janthinobacterium sp.
           Marseille]
 gi|151280411|gb|ABR88821.1| FlgH flagellar basal body L-ring protein [Janthinobacterium sp.
           Marseille]
          Length = 222

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 73/154 (47%), Gaps = 6/154 (3%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRS--RNNSLHRKLSGGFSLFGQQTP 124
           S+  +F+D RA  +GD  T+ I I++++    Q G S  +  ++       F LFG  T 
Sbjct: 53  SYRPMFEDRRARLIGD--TITITINERSSAGKQAGSSGSKTGTVAAAAPSIFGLFGNVTD 110

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
             N + +         KG ++        +   V  +L NGNL+++G ++V ++     +
Sbjct: 111 --NFSASASSASKYEDKGVVTSGNNFVSTLTVTVIDVLSNGNLVVAGEKQVALDKGGEFI 168

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
             +G+V P  V   N VS  ++A+ARI Y    R
Sbjct: 169 RFSGVVDPATVGPGNVVSSTRVADARIEYRTNAR 202


>gi|264676573|ref|YP_003276479.1| flagellar L-ring protein [Comamonas testosteroni CNB-2]
 gi|299531283|ref|ZP_07044693.1| flagellar L-ring protein [Comamonas testosteroni S44]
 gi|262207085|gb|ACY31183.1| flagellar L-ring protein [Comamonas testosteroni CNB-2]
 gi|298720690|gb|EFI61637.1| flagellar L-ring protein [Comamonas testosteroni S44]
          Length = 235

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 75/155 (48%), Gaps = 6/155 (3%)

Query: 71  LFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG--QQTPQM 126
           +F+D RA  VGD +TV I  R+      D++ GR+  N L   ++    L G  ++T   
Sbjct: 66  MFEDQRARMVGDSVTVQIVERVSASQSTDSKVGRA--NELSTGITSLPLLRGGAEKTVAD 123

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
              L  +      G G+ S        IA  V  +L NG+L+I+G +++ VN  +  L  
Sbjct: 124 ALTLGAESKNDFKGSGATSSNNTFTGSIATTVVDVLPNGHLVIAGEKQIGVNHNVDVLRF 183

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           TG V P+ +   ++V+  ++A  R+    +G+  E
Sbjct: 184 TGTVDPRSLRPGSTVASTQVANLRVESRSRGQAGE 218


>gi|325111111|ref|YP_004272179.1| flagellar L-ring protein [Planctomyces brasiliensis DSM 5305]
 gi|324971379|gb|ADY62157.1| flagellar L-ring protein [Planctomyces brasiliensis DSM 5305]
          Length = 293

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 77/170 (45%), Gaps = 7/170 (4%)

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS-----GGFSLFGQQTPQMNG 128
           + +A  + DI++V +    +   +++  R RN SL  +L       G +L          
Sbjct: 126 EPKAFRINDIVSVIVSERSEVTLNSRFNRQRNASLKSELKEFVKLDGLTLVNDAETSPTI 185

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           ++N      S+G+  ++  E +   IAA V  I  NGNL++   +++  ND++    + G
Sbjct: 186 DMNQQERIQSTGQ--VTDQEGITYRIAATVVDIRPNGNLVLEARKKINANDDLWEYTLHG 243

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            VR +DV  +N+V  + IA   I     GR         G++LI+   P 
Sbjct: 244 EVRYEDVLINNTVLSENIANLNIEKRMHGRVHSSTGRRWGNKLIDTFWPF 293


>gi|260222471|emb|CBA32068.1| Flagellar L-ring protein 1 [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 229

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 74/154 (48%), Gaps = 10/154 (6%)

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLN 131
           F+D RA  VGD +T+ I  +  A   + +  +RN S+   ++        QT    G LN
Sbjct: 65  FEDRRARLVGDAVTIQIVENVTASQKSTSTVNRNTSIDSAITA----LPDQTLAGLGKLN 120

Query: 132 YDGGGAS----SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
              G A+    SGKG    A   +  I A V   L NG+L+++G +++ VN  +  L  +
Sbjct: 121 I--GAATNNNFSGKGGTESANTFSGSITATVMETLPNGHLVVAGEKQIGVNQNVDVLRFS 178

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G + P+ +   + +S  ++A  R+   G+G   E
Sbjct: 179 GTIDPRMLQPGSIISSTQVANVRVESRGRGAQGE 212


>gi|187925553|ref|YP_001897195.1| flagellar L-ring protein [Burkholderia phytofirmans PsJN]
 gi|187716747|gb|ACD17971.1| flagellar L-ring protein [Burkholderia phytofirmans PsJN]
          Length = 223

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 54/93 (58%), Gaps = 3/93 (3%)

Query: 132 YDGGGASS---GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
           ++ G AS+   G+GS++    +N  +A  V   +  GNL++SG + + ++     L ++G
Sbjct: 114 FNIGSASTEYKGQGSLTDVSGMNGTLAVTVIGTMSTGNLVVSGEKVIAMSGNRDRLRLSG 173

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           IV P+D++A N V+  K+A ARI   G G  ++
Sbjct: 174 IVNPKDIEAGNYVASSKVANARIEQAGVGMVSD 206


>gi|253996316|ref|YP_003048380.1| flagellar L-ring protein [Methylotenera mobilis JLW8]
 gi|253982995|gb|ACT47853.1| flagellar L-ring protein [Methylotenera mobilis JLW8]
          Length = 260

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 92/211 (43%), Gaps = 29/211 (13%)

Query: 14  LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFK 73
           LL+GC  + + I   P  +          R P +G +  N++    S S +R     +F+
Sbjct: 43  LLYGCAVTPTSIVNQPTTA----------RAPSIG-NTPNNNGGIYSASSYR----PMFE 87

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG---NL 130
           D R   +GDI+T+ I  +  A   N +  S+  S+        +  G   P + G    L
Sbjct: 88  DHRPRFIGDIVTISITENTSATKANGSSASKQGSVSFSTD---AKLGDNIPVVGGLVSRL 144

Query: 131 NYDGGGASSGKGSISRAEKL-----NLLIAAIVTAI---LENGNLIISGSQEVRVNDEIR 182
            Y   G++S     S  +       N+   +I T +   L NG L +SG ++V ++    
Sbjct: 145 PYAKLGSASASSDNSYTDDAAGNAKNVFSGSITTTVVDVLPNGYLAVSGEKQVALDKGTE 204

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISY 213
            +  +G+V P  +   N+V   K+A+ARI Y
Sbjct: 205 FIRFSGVVNPDTITLGNTVPSTKVADARIEY 235


>gi|254715087|ref|ZP_05176898.1| flagellar basal body L-ring protein [Brucella ceti M13/05/1]
          Length = 36

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (80%)

Query: 203 YDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           YDKIAEARISYGG+GR +E+ +PP G Q+++  SP 
Sbjct: 1   YDKIAEARISYGGRGRLSEIQQPPYGQQILDQFSPF 36


>gi|326796594|ref|YP_004314414.1| flagellar L-ring protein [Marinomonas mediterranea MMB-1]
 gi|326547358|gb|ADZ92578.1| Flagellar L-ring protein [Marinomonas mediterranea MMB-1]
          Length = 222

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 70/154 (45%), Gaps = 17/154 (11%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG------QQTP 124
            F D +A +VGDILTV +     +   N    S+++S      G  ++ G         P
Sbjct: 59  FFGDKKARSVGDILTVTLSESTSSTKSNAANLSKDSS---ATIGNPTILGVPIGLDTTVP 115

Query: 125 QMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSL 184
            +            SG    +++  L   I   V  +  NG L I G + + +N     +
Sbjct: 116 SVTSEF--------SGSADANQSNSLTGSITVTVYEVYPNGLLAIRGEKWITLNQGEEYI 167

Query: 185 NVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
            ++G+VR +D+ A N+V  +++A+ARI+Y G G 
Sbjct: 168 RLSGLVREEDIGADNTVQSNRLADARIAYSGTGE 201


>gi|91791417|ref|YP_561068.1| flagellar L-ring protein [Shewanella denitrificans OS217]
 gi|91713419|gb|ABE53345.1| flagellar L-ring protein [Shewanella denitrificans OS217]
          Length = 187

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 80/156 (51%), Gaps = 17/156 (10%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
           D   AL  D RA+ +GD++T+ +  D +A           +S + K  G F +      +
Sbjct: 24  DKLRALTADKRAVGIGDVVTLLVFEDAKA----------GSSANLKEQGEFEM-SAGARR 72

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN----GNLIISGSQEVRVNDEI 181
            + N  Y  GG SS KG    A + N  I A VT +++     G  ++ G Q++++N E 
Sbjct: 73  SDLNWQYGLGGMSSNKGDA--ATQRNGFIKAHVTVLVQGVDDYGLFVVQGIQKLQINGEE 130

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           + ++V+G +R  D+ A+N+    ++ +A IS+ G+G
Sbjct: 131 QVISVSGKLRKDDIAANNTALSSRLLDASISFTGQG 166


>gi|119477950|ref|ZP_01618050.1| flagellar L-ring protein FlgH [marine gamma proteobacterium
           HTCC2143]
 gi|119448863|gb|EAW30105.1| flagellar L-ring protein FlgH [marine gamma proteobacterium
           HTCC2143]
          Length = 236

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 74/155 (47%), Gaps = 13/155 (8%)

Query: 69  AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK------LSGGFSLFGQQ 122
           A LF+D +A  VGDI++V +    Q+     T   + NS+         +S     +  Q
Sbjct: 67  AGLFEDLKARRVGDIISVILSERTQSSKTADTEIKKENSVSFDAGTVLGVSPSLGDYNMQ 126

Query: 123 TPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           T  +  +    G   S    S+S +      IA  +  IL NG +++ G + + +N    
Sbjct: 127 T-SVTQDRELKGEAGSDQSNSLSGS------IAVTIAEILPNGLMMVRGEKWMTLNRGEE 179

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            + + G++RP+DV   N++   ++A+ARI+Y G G
Sbjct: 180 FIRIQGLIRPEDVQPDNTILSTRLADARITYSGTG 214


>gi|160896076|ref|YP_001561658.1| flagellar L-ring protein [Delftia acidovorans SPH-1]
 gi|160361660|gb|ABX33273.1| flagellar L-ring protein [Delftia acidovorans SPH-1]
          Length = 235

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 71/152 (46%), Gaps = 2/152 (1%)

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN--GN 129
           F++ RA  VGD++TV I     A   + +G  R+N     +S      G     +    N
Sbjct: 67  FENRRARLVGDLVTVQIVERVTASQKSDSGLKRSNKTTAGISALPLFSGNALANLKDRSN 126

Query: 130 LNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGI 189
           + ++     +G GS S        I+  V  +L NG+L+I+G +++ VN  +  L  TG 
Sbjct: 127 IGFNNNNDYTGSGSTSSDNTFTGAISTTVVDVLPNGHLVIAGEKQIGVNHNVDVLRFTGT 186

Query: 190 VRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           V P+ +   + V+  ++A  R+    +G+  E
Sbjct: 187 VDPRTMQPGSLVASTQVANVRVESRSRGQAGE 218


>gi|254440259|ref|ZP_05053753.1| flagellar L-ring protein FlgH [Octadecabacter antarcticus 307]
 gi|198255705|gb|EDY80019.1| flagellar L-ring protein FlgH [Octadecabacter antarcticus 307]
          Length = 162

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 78/164 (47%), Gaps = 13/164 (7%)

Query: 74  DSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG--NLN 131
           + RA  VGD+LTV +    QA+         ++S+   L           P   G  +L+
Sbjct: 7   EQRASRVGDVLTVALNESFQAIKSQSASAGNSDSVTADL-----------PNFLGMNDLS 55

Query: 132 YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVR 191
           +      +G G+ +++     L+   +  +  NGNL + G +++ +N+    + V+GIVR
Sbjct: 56  FSSDQTFAGSGAAAQSNSFTGLVTVSIVRVFSNGNLEVLGQKKLTLNNGDEYVRVSGIVR 115

Query: 192 PQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENL 235
             D+   N V+ ++IA A I+Y G G   +  R  +  +++ +L
Sbjct: 116 RSDISPSNVVNSNRIANAEITYIGAGDVADTGRRGLFSRVLSSL 159


>gi|121607558|ref|YP_995365.1| flagellar L-ring protein [Verminephrobacter eiseniae EF01-2]
 gi|121552198|gb|ABM56347.1| flagellar L-ring protein [Verminephrobacter eiseniae EF01-2]
          Length = 249

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 71/160 (44%), Gaps = 12/160 (7%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSL---HRKLSGGFSLFGQQT 123
           S+   F+D RA  VGD +T+ I        +N T   +++S      ++S G        
Sbjct: 80  SYRPAFEDRRARMVGDSVTIQI-------VENVTASQKSSSTVDRQSQVSAGVQALPFIG 132

Query: 124 PQMNGNLNYDGGG--ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEI 181
             + G L+         SGKG    A   +  I   V  +L NG+L+++G +++ VN  +
Sbjct: 133 KTLTGKLSLGTSADNTFSGKGGTESANTFSGAITTTVVEVLPNGHLVVTGEKQIGVNQNV 192

Query: 182 RSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
             L  +G V P  +   + ++   +A  R+   G+G  TE
Sbjct: 193 DVLRFSGTVDPSALQPGSIIASTLVANVRVESRGRGAQTE 232


>gi|327537339|gb|EGF24072.1| flagellar L-ring protein precursor FlgH [Rhodopirellula baltica
           WH47]
          Length = 296

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 63/133 (47%), Gaps = 9/133 (6%)

Query: 76  RALNVGDILTVDIRIDDQA--VFDNQTGRSRNNSLHRKLSGGFSLFGQ---QTPQMNGNL 130
           RA  V DI+T  IR+D+ A  + +  T + R +     LS    L        PQ  G+ 
Sbjct: 129 RAFRVQDIVT--IRVDEIARMMAEGDTEKRRVSLFQATLSEWIKLGSGGLIPDPQAEGDP 186

Query: 131 NYDGGGA--SSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
             D      S  + S+   E ++  IAA +  I  NGNL++   ++ RVND +   +++G
Sbjct: 187 TVDAQTTANSRAEASVESRESMSFNIAARIVDIRPNGNLVVEARKQYRVNDNLWETSLSG 246

Query: 189 IVRPQDVDAHNSV 201
           I R QD+   N V
Sbjct: 247 ICRAQDIGPDNVV 259


>gi|332525063|ref|ZP_08401243.1| flagellar basal-body L-ring protein [Rubrivivax benzoatilyticus
           JA2]
 gi|332108352|gb|EGJ09576.1| flagellar basal-body L-ring protein [Rubrivivax benzoatilyticus
           JA2]
          Length = 227

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 72/150 (48%), Gaps = 7/150 (4%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF---GQQTPQMN 127
           LF+D RA   GD  T+ +RI ++     ++  S + +    LSGG +        T    
Sbjct: 60  LFEDHRARQAGD--TLQVRIVEKISATAKSTSSLDKTTD--LSGGITALPGINAATALRR 115

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
             ++ +   + +GKGS   +      I   V  +L NG+L+++G +++ VN  +  L  +
Sbjct: 116 AAVSANSENSFAGKGSTQNSNDFQGTITVTVRGVLPNGHLLVAGEKQIGVNANVDVLRFS 175

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           G V P+ ++  N V   +IA  R+   G+G
Sbjct: 176 GQVDPRAIEPGNVVQSTRIANVRLEQRGRG 205


>gi|332531621|ref|ZP_08407518.1| flagellar L-ring protein [Hylemonella gracilis ATCC 19624]
 gi|332038984|gb|EGI75413.1| flagellar L-ring protein [Hylemonella gracilis ATCC 19624]
          Length = 238

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 73/156 (46%), Gaps = 14/156 (8%)

Query: 72  FKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL- 130
           F+D RA  VGD  TV IRI +      Q+  + N S    +SGG +      P ++G   
Sbjct: 74  FEDRRARQVGD--TVTIRIVENVSASQQSSSTANRS--GSISGGIT----AVPGLSGGTL 125

Query: 131 -NYDGGGAS----SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
             +D G  +    SGKG  S     +  I  IV+ +L NG+L++ G +++ +N  +  L 
Sbjct: 126 GKFDIGAENKSDFSGKGGTSATNTFSGSITTIVSEVLPNGHLVVVGEKQIGLNQNVDVLR 185

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            TG V P  +   + V    +A  R+   G+G   E
Sbjct: 186 FTGTVDPLAIQPGSVVLSTNVANVRVESRGRGPQYE 221


>gi|294508675|ref|YP_003572734.1| flagellar L-ring protein [Precursor] [Salinibacter ruber M8]
 gi|294345004|emb|CBH25782.1| Flagellar L-ring protein [Precursor] [Salinibacter ruber M8]
          Length = 215

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 76/176 (43%), Gaps = 36/176 (20%)

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN----------- 106
           ++S +  R +  +L+ D  A   GD++TV        V D QT   R +           
Sbjct: 30  QESSTSVRAAEQSLYADPVAREPGDVITV--------VIDEQTSGQRESSYEGNSSSSLN 81

Query: 107 -----SLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAI 161
                +    +SG FS  G +      N N              ++E LN    A VTAI
Sbjct: 82  GSGSGTFSESISGSFSA-GTEVSSETENSNES-----------VQSEVLNGTFTARVTAI 129

Query: 162 LENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
              GNL + G + + ++     + V+G+VRP DV  +N++   +IA A+I YG +G
Sbjct: 130 NNAGNLEVKGERRLTIDGVTHIMEVSGVVRPTDVRQNNTILSTQIANAKIKYGEEG 185


>gi|226939371|ref|YP_002794444.1| FlgH1 [Laribacter hongkongensis HLHK9]
 gi|226714297|gb|ACO73435.1| FlgH1 [Laribacter hongkongensis HLHK9]
          Length = 233

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 50/94 (53%), Gaps = 9/94 (9%)

Query: 154 IAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNS---------VSYD 204
           +   V  +L NGNL++SG ++VR+N E+  + ++GIV P+D+  ++          VS  
Sbjct: 140 LTTTVIDVLPNGNLMVSGEKQVRINGELEYIRLSGIVNPRDIKPYSRDKGLQQGYYVSST 199

Query: 205 KIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           ++A+ARI   G+G      +P    +    +SP 
Sbjct: 200 RLADARIEQQGEGNNNRFAQPGWLTRFFMTISPF 233


>gi|323527541|ref|YP_004229694.1| flagellar L-ring protein [Burkholderia sp. CCGE1001]
 gi|323384543|gb|ADX56634.1| flagellar L-ring protein [Burkholderia sp. CCGE1001]
          Length = 223

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 47/78 (60%)

Query: 140 GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHN 199
           G+GS++    +N  +A  V   + +GNL++SG + + ++     L ++G+V P+D+++ N
Sbjct: 125 GQGSLTDVSGMNGTLAVTVIGTMPSGNLVVSGEKVISMSGNRDRLRLSGVVNPKDIESGN 184

Query: 200 SVSYDKIAEARISYGGKG 217
            V+  K+A ARI   G G
Sbjct: 185 YVASSKVANARIEQAGTG 202


>gi|302878279|ref|YP_003846843.1| flagellar L-ring protein [Gallionella capsiferriformans ES-2]
 gi|302581068|gb|ADL55079.1| flagellar L-ring protein [Gallionella capsiferriformans ES-2]
          Length = 259

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 74/163 (45%), Gaps = 12/163 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSL----------HRKLSGGFSLFG 120
           LF+D RA NVGDILT++I            G +  NS+          +    G  +   
Sbjct: 80  LFEDKRARNVGDILTINIAETTSGSRKASDGSTSANSIAAGTPSVGRNYAANGGAAAALT 139

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                ++ N +     ASSG G+ S  E L   IA  V  +L NGNL++SG ++V +N  
Sbjct: 140 SLINPISINSSSSNKTASSGNGAAS--ETLTGTIAVTVIEVLANGNLLVSGEKQVALNQN 197

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELL 223
              +  +G++ P  +   N V   ++A+A I Y   G   + +
Sbjct: 198 EEFIRFSGVINPVSISNLNVVQSSQVADAHIEYKNAGAMNQFM 240


>gi|32477360|ref|NP_870354.1| flagellar L-ring protein precursor FlgH [Rhodopirellula baltica SH
           1]
 gi|32447911|emb|CAD77431.1| probable flagellar L-ring protein precursor FlgH [Rhodopirellula
           baltica SH 1]
          Length = 301

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 63/133 (47%), Gaps = 9/133 (6%)

Query: 76  RALNVGDILTVDIRIDDQA--VFDNQTGRSRNNSLHRKLSGGFSLFGQ---QTPQMNGNL 130
           RA  V DI+T  IR+D+ A  + +  T + R +     LS    L        PQ  G+ 
Sbjct: 134 RAFRVQDIVT--IRVDEIARMMAEGDTEKRRVSLFQATLSEWIKLGSGGLIPDPQAEGDP 191

Query: 131 NYDG--GGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
             D      S  + S+   E ++  IAA +  I  NGNL++   ++ RVND +   +++G
Sbjct: 192 TVDAQTTANSRAEASVESRESMSFNIAARIVDIRPNGNLVVEARKQYRVNDNLWETSLSG 251

Query: 189 IVRPQDVDAHNSV 201
           I R QD+   N V
Sbjct: 252 ICRAQDIGPDNVV 264


>gi|103488390|ref|YP_617951.1| flagellar L-ring protein [Sphingopyxis alaskensis RB2256]
 gi|98978467|gb|ABF54618.1| flagellar L-ring protein [Sphingopyxis alaskensis RB2256]
          Length = 219

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 79/179 (44%), Gaps = 8/179 (4%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN--SLHRKLSGGFSLF 119
           S+++ ++  L    RA  VGDILT+ +     A   N  G  R+    L    +G  S F
Sbjct: 47  SIFQGAYVPLTSGGRAGQVGDILTIQLVERTAATKSNAAGTQRDGDIGLSPPTTGPLSFF 106

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                    ++   GG    GKG  S++  L+  ++  V A+  NG +++ G + + +N 
Sbjct: 107 NPS------DIGMGGGQQFKGKGEASQSNALSGEVSVTVAAVYPNGTMLVKGEKFLTLNR 160

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               + ++GIVR  D+   N +   ++A A I Y GKG      R     +    +SP 
Sbjct: 161 GDERVQISGIVRAIDISPDNRILSTRVANATIRYVGKGEIARASRQGWLQRFFSMISPF 219


>gi|83815340|ref|YP_446739.1| flagellar L-ring protein FlgH [Salinibacter ruber DSM 13855]
 gi|83756734|gb|ABC44847.1| flagellar L-ring protein FlgH [Salinibacter ruber DSM 13855]
          Length = 215

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 76/176 (43%), Gaps = 36/176 (20%)

Query: 58  KKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNN----------- 106
           ++S +  R +  +L+ D  A   GD++TV        V D QT   R +           
Sbjct: 30  QESSTSVRAAEQSLYADPVAREPGDVITV--------VIDEQTSGQRESSYEGNSSSSLN 81

Query: 107 -----SLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAI 161
                +    +SG FS  G +      N N              ++E LN    A VTA+
Sbjct: 82  GSGSGTFSESISGSFSA-GTEVSSETENSNES-----------VQSEVLNGTFTARVTAV 129

Query: 162 LENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
              GNL + G + + ++     + V+G+VRP DV  +N++   +IA A+I YG +G
Sbjct: 130 NNAGNLEVKGERRLTIDGVTHIMEVSGVVRPTDVRQNNTILSTQIANAKIKYGEEG 185


>gi|90579912|ref|ZP_01235720.1| flagellar L-ring protein precursor [Vibrio angustum S14]
 gi|90438797|gb|EAS63980.1| flagellar L-ring protein precursor [Vibrio angustum S14]
          Length = 261

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 76/150 (50%), Gaps = 7/150 (4%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           L+ D++   +GDI+T+ +     A     +   ++  L+ K      L G+     + +L
Sbjct: 97  LYDDTKPRGIGDIVTILLEEKTAAKKSASSDLDKSTDLNMK---PIELGGKPVTIRDYSL 153

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQEVRVNDEIRSLNVT 187
           +Y     ++  GS S A++ N +  +I   V  +L NGNL++ G + + +N     + V+
Sbjct: 154 SYGMSNNNTFAGSTS-ADQSNSIKGSISVEVVEVLNNGNLVVRGEKWLMLNTGEEYIRVS 212

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           G +RP D+   N+++  +I+ ARI Y G G
Sbjct: 213 GHIRPDDISQDNTIASTRISNARIQYSGTG 242


>gi|300311355|ref|YP_003775447.1| flagellar basal-body L-ring protein [Herbaspirillum seropedicae
           SmR1]
 gi|300074140|gb|ADJ63539.1| flagellar basal-body L-ring protein [Herbaspirillum seropedicae
           SmR1]
          Length = 219

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 72/150 (48%), Gaps = 13/150 (8%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +  L +D RA  VGD LT+ I     A     +  S+  +++  +    + FG    ++ 
Sbjct: 54  YRPLLEDRRARLVGDTLTIVINEKTSAGKSAASSASKTGAVNSPVP---TFFGTSIKELT 110

Query: 128 GNLNYDGGGASSGK----GSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
            N      G+SS K    G+ + +      I   V  +L NGNL+++G ++V ++  +  
Sbjct: 111 AN------GSSSAKFDDKGATTSSNTFTGTIGVTVVEVLPNGNLVVAGEKQVALDKGVEY 164

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISY 213
           +  +G V P ++   N+VS   +A+A++ Y
Sbjct: 165 VRFSGTVSPDNIQTGNTVSSTLVADAKVEY 194


>gi|148258431|ref|YP_001243016.1| putative flagellar L-ring protein FlgH [Bradyrhizobium sp. BTAi1]
 gi|146410604|gb|ABQ39110.1| putative flagellar L-ring protein FlgH [Bradyrhizobium sp. BTAi1]
          Length = 221

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 86/176 (48%), Gaps = 9/176 (5%)

Query: 39  DENNRMPFLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRI-DDQAVFD 97
           DE    P L        + + +  L   SHA   K  RA  +GDI+T+ + I ++     
Sbjct: 44  DEAPIQPLLPAAAARVPAHQPNRRLRSLSHAWSTKQ-RAPQIGDIVTMTVNIAENPGDMS 102

Query: 98  NQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAI 157
            Q G + N         G ++ G++    + + + D    ++G+ ++ +AE   + +AA+
Sbjct: 103 TQGGTNSNRHADELPDTGGAVAGRRA---DASSSRD----TAGRTTVGQAELKRMSMAAV 155

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISY 213
           VT +  +G L++ G + ++++ EI  L V+G+V    +   +S+   K+ + +ISY
Sbjct: 156 VTRVSPDGGLVVEGRRTMQIDGEIVDLEVSGVVPADSLRVDHSIDASKMKQMQISY 211


>gi|116327822|ref|YP_797542.1| endoflagellar basal body L-ring protein [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116331366|ref|YP_801084.1| endoflagellar basal body L-ring protein [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|116120566|gb|ABJ78609.1| Endoflagellar basal body L-ring protein [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116125055|gb|ABJ76326.1| Endoflagellar basal body L-ring protein [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 354

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 86/174 (49%), Gaps = 11/174 (6%)

Query: 62  SLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQ 121
           SLW D +    + S  + VG  L V I+   QA F+ ++  + + +L  K+     +   
Sbjct: 159 SLWADKNPYSMRQS--IKVGSPLYVKIKNGLQAEFELES--NADETLTLKVMPDKKII-- 212

Query: 122 QTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLI-ISGSQEVRVNDE 180
             P M  + N D       KG I    K+   +  +VTA+  N  L+ I G +   +N E
Sbjct: 213 --PDM-PSYNSDRTITRKNKGKIKSLGKIKGNLTVLVTAVDPNTGLLSIRGQKMNVINGE 269

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIEN 234
             SL ++G V P+ V+  +S+  DKIA+ ++++ GK +  E++ PPI  + + N
Sbjct: 270 ENSLFLSGTVSPEFVEKDSSIDADKIADLQVNFNGKIKRQEVI-PPIALKTVTN 322


>gi|37360909|dbj|BAC98363.1| flagellar L-ring protein [Burkholderia glumae]
          Length = 224

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 54/121 (44%), Gaps = 1/121 (0%)

Query: 101 GRSRNNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTA 160
           GR R + L  +L G      ++ P   G    +        G  S A      I   VT 
Sbjct: 88  GRERESRLRDRLQGADRRLPRR-PVRQGETERERRQQVHATGGASAANTFTGTITVTVTN 146

Query: 161 ILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTT 220
           +L NGNL++SG +++ +N     +  + +V P  +   NSV   ++A+ARI Y  KG   
Sbjct: 147 VLPNGNLVVSGEKQMLINQGNEFVRFSVVVNPNTISGANSVYSTQVADARIEYSSKGYIN 206

Query: 221 E 221
           E
Sbjct: 207 E 207


>gi|87306345|ref|ZP_01088492.1| probable flagellar L-ring protein precursor FlgH [Blastopirellula
           marina DSM 3645]
 gi|87290524|gb|EAQ82411.1| probable flagellar L-ring protein precursor FlgH [Blastopirellula
           marina DSM 3645]
          Length = 231

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 75/154 (48%), Gaps = 18/154 (11%)

Query: 76  RALNVGDILTVDIRIDDQAVFDNQ--TGRSRNNSLHRKLSGGFSLFG-------QQ---T 123
           R + + DI  + IR+D+ A  +++    R +  + +  L+    L         QQ   +
Sbjct: 63  RKIQIKDI--IHIRVDEAAEMESEGNLNRRKQANFNALLANWVHLENLKAIVPDQQEDGS 120

Query: 124 PQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRS 183
           PQ+ G L          +G++   E++   +AA V+ I+ NG L I   +E++VN+E  +
Sbjct: 121 PQITGQLT----SRYRTQGTLETLEEVRFRVAATVSEIMPNGTLKIEAQKEIQVNNETWT 176

Query: 184 LNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
             + G+ R +D+D +N V  +++A   I+    G
Sbjct: 177 YYLRGVCRVEDIDPNNVVLSERLANLSITKQETG 210


>gi|322435950|ref|YP_004218162.1| flagellar L-ring protein [Acidobacterium sp. MP5ACTX9]
 gi|321163677|gb|ADW69382.1| flagellar L-ring protein [Acidobacterium sp. MP5ACTX9]
          Length = 285

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 74/158 (46%), Gaps = 3/158 (1%)

Query: 62  SLWRDSH--AALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF 119
           S+W ++   A L  D RA+   D+++V +     A  D +   SR ++ + ++S  F L 
Sbjct: 107 SIWSENGRLAHLSTDVRAMRPHDLISVVVSESLAASTDGEVKNSRASNANSQISAFFGLL 166

Query: 120 GQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
                 M   LN       + +G+ +    L+      V  +L NG L+I  +++V  + 
Sbjct: 167 -HAGNAMQNLLNQSSTSGLAAQGASATNSSLSTTFGGQVIDVLPNGMLVIEAARQVEFSQ 225

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           + +++ + G+VRP+D+   N V    I+   +   GKG
Sbjct: 226 QTQTIVLRGLVRPEDISQQNQVLSTAISSLELEVRGKG 263


>gi|296159561|ref|ZP_06842385.1| flagellar L-ring protein [Burkholderia sp. Ch1-1]
 gi|295890269|gb|EFG70063.1| flagellar L-ring protein [Burkholderia sp. Ch1-1]
          Length = 222

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 48/82 (58%)

Query: 140 GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHN 199
           G+GS++    ++  +A  V   +  GNL++SG + + ++     L ++GIV P+D++A N
Sbjct: 124 GQGSLTDVSGMSGTLAVTVIGTMSTGNLVVSGEKVIAMSGNRDRLRLSGIVNPKDIEAGN 183

Query: 200 SVSYDKIAEARISYGGKGRTTE 221
            V+  K+A ARI   G G  ++
Sbjct: 184 YVASGKVANARIEQAGVGMVSD 205


>gi|91785402|ref|YP_560608.1| putative flagellar L-ring protein precursor(basal body L-ring
           protein), FlgH [Burkholderia xenovorans LB400]
 gi|91689356|gb|ABE32556.1| Putative flagellar L-ring protein precursor(Basal body L-ring
           protein), FlgH [Burkholderia xenovorans LB400]
          Length = 239

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 48/82 (58%)

Query: 140 GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHN 199
           G+GS++    ++  +A  V   +  GNL++SG + + ++     L ++GIV P+D++A N
Sbjct: 141 GQGSLTDISGMSGTLAVTVIGTMSTGNLVVSGEKVIAMSGNRDRLRLSGIVNPKDIEAGN 200

Query: 200 SVSYDKIAEARISYGGKGRTTE 221
            V+  K+A ARI   G G  ++
Sbjct: 201 YVASSKVANARIEQAGVGMVSD 222


>gi|254499118|ref|ZP_05111808.1| flagellar L-ring protein [Legionella drancourtii LLAP12]
 gi|254351657|gb|EET10502.1| flagellar L-ring protein [Legionella drancourtii LLAP12]
          Length = 201

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 67/152 (44%), Gaps = 9/152 (5%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQ 125
           D +  L  D +A   GD+LTV +     A        S +  +   L  G++       +
Sbjct: 38  DIYRPLIADRKATLPGDVLTVIVLETSNA--QTSADLSSHKEIKTVLEAGYN-------R 88

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
            N  + +   G  S      R  K+   +   +  +  N   ++ G Q + +N E + + 
Sbjct: 89  DNHKVEFGLEGKGSTAAKTGRNGKIKAALTVRIKEVFPNNTYLVEGLQMITINGEQQRIL 148

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++G+VRP+D+   N++   ++A+A I+Y G G
Sbjct: 149 LSGVVRPEDISPQNTILSTRLAQAHITYTGAG 180


>gi|332307220|ref|YP_004435071.1| flagellar L-ring protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332174549|gb|AEE23803.1| flagellar L-ring protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 247

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 72/160 (45%), Gaps = 15/160 (9%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL----FGQ 121
           D+   L++ +    VGD++ V++          +T   +  +  R  SG F+L       
Sbjct: 78  DNLVGLYQRNNRYRVGDMILVELA--------EKTSSKKTLNYSRDKSGNFTLDPVTVNA 129

Query: 122 QTPQMNG---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
              Q+NG   N +++            +   L   +   V  I+ NGNL+++G + + +N
Sbjct: 130 GPLQINGDKLNADFEQENEFDSSAETKQDNSLEGDVTVYVLEIMPNGNLLVAGEKWMTLN 189

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
                +  +G +RP D+D  N+VS  K+  +RI + GKG 
Sbjct: 190 KGEEFIRFSGEIRPSDIDNDNTVSSVKVGNSRIEFSGKGE 229


>gi|254712018|ref|ZP_05173829.1| flagellar basal body L-ring protein [Brucella ceti M644/93/1]
          Length = 35

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%)

Query: 204 DKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
           DKIAEARISYGG+GR +E+ +PP G Q+++  SP 
Sbjct: 1   DKIAEARISYGGRGRLSEIQQPPYGQQILDQFSPF 35


>gi|329901233|ref|ZP_08272758.1| Flagellar L-ring protein FlgH [Oxalobacteraceae bacterium IMCC9480]
 gi|327549165|gb|EGF33757.1| Flagellar L-ring protein FlgH [Oxalobacteraceae bacterium IMCC9480]
          Length = 224

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 71/148 (47%), Gaps = 4/148 (2%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           ++  LF+D RA  +GD LT  I I+++         S + S    L+    LFG  T   
Sbjct: 55  AYRPLFEDRRARLIGDTLT--ITINEKTTAGKAGAASSSKSGSANLAVP-KLFGAPTTTT 111

Query: 127 -NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
            +   N  GG     KG+ +     N  I   V  +L NG L++SG +++ ++     + 
Sbjct: 112 ADLAFNATGGNKYDDKGAATSNNNFNGTIGVTVVDVLANGYLVVSGEKQIGLDRGTEFIR 171

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISY 213
            +G+V P  +   N+V+  ++A+AR+ Y
Sbjct: 172 FSGVVNPDFIVGGNNVASTQVADARVEY 199


>gi|89075498|ref|ZP_01161909.1| flagellar L-ring protein precursor [Photobacterium sp. SKA34]
 gi|89048770|gb|EAR54341.1| flagellar L-ring protein precursor [Photobacterium sp. SKA34]
          Length = 261

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 75/150 (50%), Gaps = 7/150 (4%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           L+ D++   +GDI+T+ +     A     +   ++  L+ K      L G+     + +L
Sbjct: 97  LYDDTKPRGIGDIVTILLEEKTAAKKSASSDLDKSTDLNMK---PIELGGKPVTIRDYSL 153

Query: 131 NYDGGGASSGKGSISRAEKLNLLIAAI---VTAILENGNLIISGSQEVRVNDEIRSLNVT 187
           +Y     ++  GS S A++ N +  +I   V  +L NGNL + G + + +N     + V+
Sbjct: 154 SYGMSNNNTFAGSTS-ADQSNSIKGSISVEVVEVLNNGNLAVRGEKWLMLNTGEEYIRVS 212

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           G +RP D+   N+++  +I+ ARI Y G G
Sbjct: 213 GHIRPDDISQDNTIASTRISNARIQYSGTG 242


>gi|320530441|ref|ZP_08031499.1| flagellar L-ring protein FlgH [Selenomonas artemidis F0399]
 gi|320137274|gb|EFW29198.1| flagellar L-ring protein FlgH [Selenomonas artemidis F0399]
          Length = 200

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 75/161 (46%), Gaps = 13/161 (8%)

Query: 62  SLWRDSHAA----LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           SLW++        +F D RA+NVGDI+T+ I           +   ++ S+   +  G  
Sbjct: 29  SLWKNPSGYPTRNVFADHRAMNVGDIVTIIISETTTTSATRSSANEKSGSV--SIGAGVG 86

Query: 118 LFG-QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           +F   +    +G+  ++       KGS S   +    +   +T I   GN I+ G+Q + 
Sbjct: 87  IFDFLKAASASGSDKFNA------KGSASSTNRTIGNVTVTITEITPAGNFILEGTQSIW 140

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            N     +   G+ RP+D+ A N+V   ++A+A + + GKG
Sbjct: 141 QNRNEHKITFRGMCRPEDISATNTVLSTRVADATVRFDGKG 181


>gi|313894978|ref|ZP_07828537.1| flagellar L-ring protein FlgH [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312976431|gb|EFR41887.1| flagellar L-ring protein FlgH [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 199

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 75/161 (46%), Gaps = 13/161 (8%)

Query: 62  SLWRDSHAA----LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFS 117
           SLW++        +F D RA+NVGDI+T+ I           +   ++ S+   +  G  
Sbjct: 28  SLWKNPSGYPTRNVFADHRAMNVGDIVTIIISETTTTSATRSSANEKSGSV--SIGAGVG 85

Query: 118 LFG-QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVR 176
           +F   +    +G+  ++       KGS S   +    +   +T I   GN I+ G+Q + 
Sbjct: 86  IFDFLKAASASGSDKFNA------KGSASSTNRTIGNVTVTITEITPAGNFILEGTQSIW 139

Query: 177 VNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            N     +   G+ RP+D+ A N+V   ++A+A + + GKG
Sbjct: 140 QNRNEHKITFRGMCRPEDISATNTVLSTRVADATVRFDGKG 180


>gi|330719498|gb|EGG98114.1| Flagellar L-ring protein FlgH [gamma proteobacterium IMCC2047]
          Length = 188

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 72/150 (48%), Gaps = 3/150 (2%)

Query: 70  ALFKDSRALNVGDILTVDI--RIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           + F D +A +VGDILT+++  R       + +   S  ++L    +  F+ +  +     
Sbjct: 18  SYFVDRKARHVGDILTINLVERTTASKKAETEIADSTAHNLATP-TLPFTDYTDKLKDYG 76

Query: 128 GNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
              N  G  + +G     ++  L+  I   VT +L NG L + G + + +N     + ++
Sbjct: 77  LATNVAGDNSFTGDAESDQSNSLSGNITVTVTDVLPNGVLRVRGEKWMTLNTGDEYIRIS 136

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           G+VR  D+   N V   K+A+ARI+Y G G
Sbjct: 137 GMVRLDDIAPDNVVPSTKLADARITYSGTG 166


>gi|268317783|ref|YP_003291502.1| flagellar L-ring protein [Rhodothermus marinus DSM 4252]
 gi|262335317|gb|ACY49114.1| flagellar L-ring protein [Rhodothermus marinus DSM 4252]
          Length = 193

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 75/165 (45%), Gaps = 17/165 (10%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           + ++L+ D RA+  GD++T+        +   +T   R ++     +      G  +  +
Sbjct: 19  AQSSLYADFRAVRPGDVITI--------ILAERTAAQRESNFEHLANAKIGGAGAVSGTL 70

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNL-LIAAIVTAIL-----ENGNLIISGSQEVRVNDE 180
            G  + D   A+  + S +  E L   L+   VTA++       GNL+I G +++ +N  
Sbjct: 71  GGKFSAD---ATFSRESKANNETLQRDLLEGTVTALVVGIDSTTGNLLIRGERKLNINGV 127

Query: 181 IRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
              + ++G VRP DV   N+V   +IA A I Y   G   +  RP
Sbjct: 128 THLMRISGTVRPYDVRYDNTVFSYQIANAHIEYRQSGLPRKFFRP 172


>gi|222112275|ref|YP_002554539.1| flagellar l-ring protein [Acidovorax ebreus TPSY]
 gi|221731719|gb|ACM34539.1| flagellar L-ring protein [Acidovorax ebreus TPSY]
          Length = 238

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 10/133 (7%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           S+   F+D RA  VGD++T++I     A  D ++  +RN        G  +      P  
Sbjct: 59  SYRPAFEDQRARLVGDMVTIEILESIDAKQDTKSNVNRNGDTK----GSITALPLLAPST 114

Query: 127 NGNLNYDGG-GAS-----SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            G L    G GA      +G G+ +   +    I  +VT +L NG+L+I+G ++V VN  
Sbjct: 115 VGKLAARSGLGAGYENTFNGSGNTASKNEFKSNITTLVTEVLPNGHLVITGEKQVGVNRS 174

Query: 181 IRSLNVTGIVRPQ 193
           +  L  +GIV P+
Sbjct: 175 VDVLRFSGIVDPR 187


>gi|121596120|ref|YP_988016.1| flagellar L-ring protein [Acidovorax sp. JS42]
 gi|120608200|gb|ABM43940.1| flagellar L-ring protein [Acidovorax sp. JS42]
          Length = 238

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 10/133 (7%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           S+   F+D RA  VGD++T++I     A  D ++  +RN        G  +      P  
Sbjct: 59  SYRPAFEDQRARLVGDMVTIEILESIDAKQDTKSNVNRNGDTK----GSITALPLLAPST 114

Query: 127 NGNLNYDGG-GAS-----SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
            G L    G GA      +G G+ +   +    I  +VT +L NG+L+I+G ++V VN  
Sbjct: 115 VGKLAARSGLGAGYENTFNGSGNTASKNEFKSNITTLVTEVLPNGHLVITGEKQVGVNRS 174

Query: 181 IRSLNVTGIVRPQ 193
           +  L  +GIV P+
Sbjct: 175 VDVLRFSGIVDPR 187


>gi|209520045|ref|ZP_03268822.1| flagellar L-ring protein [Burkholderia sp. H160]
 gi|209499530|gb|EDZ99608.1| flagellar L-ring protein [Burkholderia sp. H160]
          Length = 224

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 78/152 (51%), Gaps = 12/152 (7%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGNL 130
           +++  RA ++GD+LT+ +        ++ +G +  N+   + S   +    Q+      L
Sbjct: 59  VYETPRAQHIGDVLTIRLA-------ESYSGNNTANASASRASSITATAADQSTSAAARL 111

Query: 131 N--YDGGGASS---GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
              ++ G AS+   G+G++S    +   +A  V   +  GNL++SG + + ++     L 
Sbjct: 112 AKLFNIGTASTDYKGQGNLSDISDMTGTLAVTVIGTVSGGNLVVSGEKIISMSGNKDRLR 171

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++GIV P+D++A N VS  K+A ARI   G G
Sbjct: 172 LSGIVNPKDIEAGNYVSSSKVANARIEQAGIG 203


>gi|295677873|ref|YP_003606397.1| flagellar L-ring protein [Burkholderia sp. CCGE1002]
 gi|295437716|gb|ADG16886.1| flagellar L-ring protein [Burkholderia sp. CCGE1002]
          Length = 223

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 73/160 (45%), Gaps = 28/160 (17%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFD-------------NQTGRSRNNSLHRKLSGGFS 117
           L++  RA ++GD+LT  IR+ +                    T   ++ S   +L+  F+
Sbjct: 58  LYETPRAQHIGDVLT--IRLSESYSGSNSASASANRASSITATAADQSTSAAARLAKLFN 115

Query: 118 LFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRV 177
           +    T       +Y G      +G +S    +   +A  V   +  GNL++SG + + +
Sbjct: 116 IGSAST-------DYKG------QGRLSDISDMTGTLAVTVIGTVSGGNLVVSGEKVIAM 162

Query: 178 NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           +     L ++GIV P+D++A N V+  K+A ARI   G G
Sbjct: 163 SGTRDRLRLSGIVNPKDIEAGNYVASSKVANARIEQAGLG 202


>gi|45657206|ref|YP_001292.1| flagellar L-ring protein precursor [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45600444|gb|AAS69929.1| flagellar L-ring protein precursor [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 333

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 89/190 (46%), Gaps = 14/190 (7%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN 105
           FLG +F  S + ++S SLW D +   +   +++ VG  L V IR   QA F+ ++     
Sbjct: 125 FLGSNF--SLNAQES-SLWTDKNP--YSVRQSMKVGSTLYVKIRNGLQAEFELESNADET 179

Query: 106 NSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENG 165
            +L               P M  + N D       KG I    K+   +  +VTAI  N 
Sbjct: 180 LTLKAMPDKKI------IPDM-PSYNNDRTITRKNKGKIKSIGKIKGNLTVLVTAIDPNT 232

Query: 166 NLIISGSQEVRV-NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
            L+    Q+V V N E  SL ++G V P+ V+   S+  DKIA  ++++ GK +  + + 
Sbjct: 233 GLLNVQGQKVSVINGEENSLLLSGTVSPEFVEKDLSIDSDKIANLQLNFNGKIKPQQ-VS 291

Query: 225 PPIGHQLIEN 234
           PPI  + I N
Sbjct: 292 PPISIKTITN 301


>gi|24215365|ref|NP_712846.1| flagellar L-ring protein precursor [Leptospira interrogans serovar
           Lai str. 56601]
 gi|24196476|gb|AAN49864.1|AE011433_8 flagellar L-ring protein precursor [Leptospira interrogans serovar
           Lai str. 56601]
          Length = 333

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 89/190 (46%), Gaps = 14/190 (7%)

Query: 46  FLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN 105
           FLG +F  S + ++S SLW D +   +   +++ VG  L V IR   QA F+ ++     
Sbjct: 125 FLGSNF--SLNAQES-SLWTDKNP--YSVRQSMKVGSTLYVKIRNGLQAEFELESNADET 179

Query: 106 NSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENG 165
            +L               P M  + N D       KG I    K+   +  +VTAI  N 
Sbjct: 180 LTLKAMPDKKI------IPDM-PSYNNDRTITRKNKGKIKSIGKIKGNLTVLVTAIDPNT 232

Query: 166 NLIISGSQEVRV-NDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
            L+    Q+V V N E  SL ++G V P+ V+   S+  DKIA  ++++ GK +  + + 
Sbjct: 233 GLLNVQGQKVSVINGEENSLLLSGTVSPEFVEKDLSIDSDKIANLQLNFNGKIKPQQ-VS 291

Query: 225 PPIGHQLIEN 234
           PPI  + I N
Sbjct: 292 PPISIKTITN 301


>gi|90408391|ref|ZP_01216553.1| Flagellar basal body L-ring protein [Psychromonas sp. CNPT3]
 gi|90310484|gb|EAS38607.1| Flagellar basal body L-ring protein [Psychromonas sp. CNPT3]
          Length = 252

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 46/92 (50%), Gaps = 6/92 (6%)

Query: 126 MNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLN 185
           M    ++DG   S+      ++  L   I   +  IL NGNL + G + + +N+    + 
Sbjct: 145 MKQGQDFDGAADSA------QSHSLTARITVSIVEILNNGNLKVRGEKWLVINNGKEYIR 198

Query: 186 VTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
            TGIVRP D+   NSV   ++A +RI + G G
Sbjct: 199 FTGIVRPSDITEKNSVESYQVANSRIEFSGTG 230


>gi|30248325|ref|NP_840395.1| flagellar basal body L-ring protein [Nitrosomonas europaea ATCC
           19718]
 gi|30138211|emb|CAD84219.1| Flagellar L-ring protein [Nitrosomonas europaea ATCC 19718]
          Length = 264

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 80/160 (50%), Gaps = 6/160 (3%)

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
           R  +  LF+D RA ++GD  T+ + ++++     +TG +   +    LS   S  G    
Sbjct: 93  RGRYIPLFEDRRARSIGD--TIIVALNEKTNASKKTGSNAQRAGEIGLSVP-SFLGLPFK 149

Query: 125 QMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
            +  +L+ +   ++   GKG  S        IA  V  IL NGNL++SG +++ +N    
Sbjct: 150 SIFQDLDLEATSSNKFDGKGESSSNNNFTGTIAVTVLDILPNGNLLVSGEKQIGINQGHE 209

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
            + ++G++       +N+VS  ++A+ARI Y G G   E+
Sbjct: 210 FIRLSGVIN-PINIINNTVSSIQVADARIEYRGNGYLDEV 248


>gi|297538899|ref|YP_003674668.1| flagellar L-ring protein [Methylotenera sp. 301]
 gi|297258246|gb|ADI30091.1| flagellar L-ring protein [Methylotenera sp. 301]
          Length = 228

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 68/147 (46%), Gaps = 5/147 (3%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQM 126
           ++  LF+D R   VGD +T++I  +     + ++  S++      ++   SLFG   P  
Sbjct: 62  AYHPLFEDRRPRYVGDTVTINIIENTNTTKNFESNGSKDGKAANSIT---SLFGHNVPA- 117

Query: 127 NGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNV 186
             + +     +   K     +   N  I   V  +L NGNL +SG +++  +     +  
Sbjct: 118 -ASFSGSSSNSVKEKEDAKSSNVFNGSITVTVIDVLPNGNLSVSGEKQISFDRGTEFVRF 176

Query: 187 TGIVRPQDVDAHNSVSYDKIAEARISY 213
           +G+V P  +   N V  +K+A+ARI Y
Sbjct: 177 SGVVSPDSITVGNFVPSNKVADARIEY 203


>gi|88911316|sp|Q82XG6|FLGH_NITEU RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
          Length = 234

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 80/160 (50%), Gaps = 6/160 (3%)

Query: 65  RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTP 124
           R  +  LF+D RA ++GD  T+ + ++++     +TG +   +    LS   S  G    
Sbjct: 63  RGRYIPLFEDRRARSIGD--TIIVALNEKTNASKKTGSNAQRAGEIGLSVP-SFLGLPFK 119

Query: 125 QMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
            +  +L+ +   ++   GKG  S        IA  V  IL NGNL++SG +++ +N    
Sbjct: 120 SIFQDLDLEATSSNKFDGKGESSSNNNFTGTIAVTVLDILPNGNLLVSGEKQIGINQGHE 179

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL 222
            + ++G++       +N+VS  ++A+ARI Y G G   E+
Sbjct: 180 FIRLSGVIN-PINIINNTVSSIQVADARIEYRGNGYLDEV 218


>gi|82702456|ref|YP_412022.1| flagellar basal body L-ring protein [Nitrosospira multiformis ATCC
           25196]
 gi|82410521|gb|ABB74630.1| Flagellar L-ring protein [Nitrosospira multiformis ATCC 25196]
          Length = 230

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 80/171 (46%), Gaps = 24/171 (14%)

Query: 62  SLWRDS--HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRK---LSGGF 116
           ++++D+  + +LF D RA  +GD L + +        +      R+NS   K   +S G 
Sbjct: 56  AVYQDANQYHSLFIDRRARQIGDTLVILLT-------ERTNASKRSNSSANKNGDVSFGI 108

Query: 117 S--LFGQQTPQMNGNLNYDGGGASS----GKGSISRAEKLNLLIAAIVTAILENGNLIIS 170
              +FG    +       D G +SS    GKG  + A   +  I   V  +L N  L++S
Sbjct: 109 PPIVFGVPITK-----KIDLGASSSNDFAGKGEAASANNFSGTITVTVVDVLPNSYLVVS 163

Query: 171 GSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
           G +++ +      +  +G+VRP+ V   N+VS  ++A+ARI Y   G   E
Sbjct: 164 GEKQLAMTQGSEYIRFSGVVRPETV-ISNTVSSIQVADARIEYKANGYIDE 213


>gi|109899122|ref|YP_662377.1| flagellar L-ring protein [Pseudoalteromonas atlantica T6c]
 gi|109701403|gb|ABG41323.1| flagellar L-ring protein [Pseudoalteromonas atlantica T6c]
          Length = 247

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 71/160 (44%), Gaps = 15/160 (9%)

Query: 66  DSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL----FGQ 121
           D+   L++ +    VGD++ V++          +T   +  +  R  SG F+L       
Sbjct: 78  DNLVGLYQRNNRYRVGDMILVELA--------EKTSSKKTLNYSRDKSGNFTLDPVTVKA 129

Query: 122 QTPQMNG---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVN 178
              Q+NG   N +++            +   L   +   V  I+ NGNL+++G + + +N
Sbjct: 130 GPLQINGDKLNADFEQENEFDSSAETKQDNSLEGDVTVYVLEIMPNGNLLVAGEKWMTLN 189

Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
                +  +G +RP D+   N+VS  K+  +RI + GKG 
Sbjct: 190 KGEEFIRFSGEIRPTDISNDNTVSSVKVGNSRIEFSGKGE 229


>gi|229897907|ref|ZP_04513058.1| Flagellar L-ring protein flgH [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229688948|gb|EEO81013.1| Flagellar L-ring protein flgH [Yersinia pestis biovar Orientalis
           str. India 195]
          Length = 83

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%)

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL + G +++ +N     +  +G+V P+ +   NSV+  ++A+ARI Y G G
Sbjct: 3   VDQVLANGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNSVTSTQVADARIEYVGNG 62

Query: 218 RTTELLRPPIGHQLIENLSP 237
              E        +   N+SP
Sbjct: 63  YINEAQTMGWLQRFFLNVSP 82


>gi|323209684|gb|EFZ94613.1| flagellar basal body L-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
          Length = 194

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 67/140 (47%), Gaps = 14/140 (10%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRN-------NSLHRKLSGGFSLFG 120
           +  LF+D R  N+GD LT+ ++ +  A   +    SR+       +++ R L G   LFG
Sbjct: 62  YQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQG---LFG 118

Query: 121 QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDE 180
                M  +    GG + +GKG  + +   +  +   V  +L NGNL + G +++ +N  
Sbjct: 119 NSRADMEAS----GGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQG 174

Query: 181 IRSLNVTGIVRPQDVDAHNS 200
              +  +G+V P+ +   NS
Sbjct: 175 TEFIRFSGVVNPRTISGSNS 194


>gi|326319100|ref|YP_004236772.1| flagellar L-ring protein [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323375936|gb|ADX48205.1| flagellar L-ring protein [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 251

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 72/159 (45%), Gaps = 10/159 (6%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG--GFSLFGQQTP 124
           S+   F+D RA  VGDI+T+ I    + +  +Q   S+ +      +G   F   G    
Sbjct: 82  SYRPAFEDRRARLVGDIVTIQIV---ETISASQKSSSKVDRTAANTAGVTAFPFIGASD- 137

Query: 125 QMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
              G L   G   ++  GKG +         I   V  +L NG+L+I+G +++ V + + 
Sbjct: 138 --IGKLKLGGNSTNNFEGKGDLQSTNTFTGTITTTVVDVLPNGHLVIAGEKQIGVAENVD 195

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            L  +G V P+ +   + VS   +A AR+   G+G   E
Sbjct: 196 VLRFSGTVDPRSLQPGSVVSSTLVANARVQSRGRGSPAE 234


>gi|120613062|ref|YP_972740.1| flagellar L-ring protein [Acidovorax citrulli AAC00-1]
 gi|120591526|gb|ABM34966.1| flagellar L-ring protein [Acidovorax citrulli AAC00-1]
          Length = 237

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 73/159 (45%), Gaps = 10/159 (6%)

Query: 67  SHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSG--GFSLFGQQTP 124
           S+   F+D RA  VGDI+T+ I    + +  +Q   S+ +      +G   F   G    
Sbjct: 68  SYRPAFEDRRARLVGDIVTIQIV---ETISASQKSSSKVDRTAANTAGVSAFPFIGAGD- 123

Query: 125 QMNGNLNYDGGGASS--GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
              G L   G   ++  GKG +  +      I   V  +L NG+L+I+G +++ V + + 
Sbjct: 124 --LGKLKLGGNSTNNFEGKGDLQSSNTFTGTITTTVVEVLPNGHLVIAGEKQIGVAENVD 181

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTE 221
            L  +G V P+ +   + VS   +A AR+   G+G   E
Sbjct: 182 VLRFSGTVDPRSLQPGSVVSSTLVANARVQSRGRGSPAE 220


>gi|194428441|ref|ZP_03060981.1| flagellar L-ring protein FlgH [Escherichia coli B171]
 gi|194413493|gb|EDX29775.1| flagellar L-ring protein FlgH [Escherichia coli B171]
          Length = 83

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%)

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL + G +++ +N     +  +G+V P+ +   N+V   ++A+ARI Y G G
Sbjct: 3   VDQVLVNGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNG 62

Query: 218 RTTELLRPPIGHQLIENLSPL 238
              E        +   NLSP+
Sbjct: 63  YINEAQNMGWLQRFFLNLSPM 83


>gi|315287429|gb|EFU46840.1| flagellar L-ring protein FlgH [Escherichia coli MS 110-3]
          Length = 81

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%)

Query: 158 VTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           V  +L NGNL + G +++ +N     +  +G+V P+ +   N+V   ++A+ARI Y G G
Sbjct: 1   VDQVLVNGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNTVPSTQVADARIEYVGNG 60

Query: 218 RTTELLRPPIGHQLIENLSPL 238
              E        +   NLSP+
Sbjct: 61  YINEAQNMGWLQRFFLNLSPM 81


>gi|85710167|ref|ZP_01041232.1| flagellar L-ring protein precursor [Erythrobacter sp. NAP1]
 gi|85688877|gb|EAQ28881.1| flagellar L-ring protein precursor [Erythrobacter sp. NAP1]
          Length = 227

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 80/176 (45%), Gaps = 14/176 (7%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMN 127
           +A L   +RA  +GD++T+ + ++  A   + TG++         SGG +L       + 
Sbjct: 61  YAPLVTGTRARGLGDMVTI-LLVESTATSKSITGQTDR-------SGGLALIPPSAGPL- 111

Query: 128 GNLNYDGGGASSGKGS-----ISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182
           G LN D   AS           ++  +L   +A  + AI  NG   + G +++ ++    
Sbjct: 112 GFLNPDALNASGSGSFNGSGNAAQQSQLTGTVAVTIAAIYPNGTAEVVGEKQMALSQGDE 171

Query: 183 SLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
            +  +G +R  D+D  N++   ++A ARI Y G+G      RP    +   ++SP 
Sbjct: 172 WVQFSGRIRLVDIDVDNTLPSSRVANARIIYTGQGAVQRASRPGWLSRFFGSISPF 227


>gi|332994664|gb|AEF04719.1| flagellar L-ring protein [Alteromonas sp. SN2]
          Length = 293

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 36/68 (52%)

Query: 154 IAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISY 213
           I   VTAI   GNL+++G + + +N     +  +G VR QDVD  N+V   K+  A I Y
Sbjct: 211 ITVYVTAITPAGNLLVTGEKWITMNKGKEYIRFSGEVRKQDVDESNTVVSSKVGNALIEY 270

Query: 214 GGKGRTTE 221
            G G   E
Sbjct: 271 SGTGDLQE 278


>gi|225871946|ref|YP_002753400.1| flagellar L-ring protein FlgH [Acidobacterium capsulatum ATCC
           51196]
 gi|225792620|gb|ACO32710.1| flagellar L-ring protein FlgH [Acidobacterium capsulatum ATCC
           51196]
          Length = 246

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 73/149 (48%), Gaps = 5/149 (3%)

Query: 71  LFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFG--QQTPQMNG 128
           L+ D RA++V D ++V +    +++  +  G  +++      S   SLFG       +N 
Sbjct: 79  LYSDVRAVHVHDPVSVVV---SESLAASTDGTVKDSRSSSANSQVSSLFGALHAGNALNN 135

Query: 129 NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTG 188
            +N   G   + +G    +  L  +    V A+L NG ++I   +++  + + + + + G
Sbjct: 136 LVNQASGSTLNAQGESVTSSSLTTIFGGEVEAVLPNGMMVIQAVRQLTFSQQTQLITLRG 195

Query: 189 IVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           ++RP+D+++ N +    I++  I   GKG
Sbjct: 196 LIRPEDINSQNQILSTNISDLEIQVTGKG 224


>gi|226225709|ref|YP_002759815.1| putative flagellar L-ring protein [Gemmatimonas aurantiaca T-27]
 gi|226088900|dbj|BAH37345.1| putative flagellar L-ring protein [Gemmatimonas aurantiaca T-27]
          Length = 235

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 70/150 (46%), Gaps = 17/150 (11%)

Query: 74  DSRALNVGDILTVDIRIDD----QAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNGN 129
           D RA  VGDI+TV   +DD     AV +N +  +R   L             + P+ + +
Sbjct: 78  DRRAFAVGDIITV--LVDDYTITTAVKENVSSDTRTRGLS---------VNARMPESSKS 126

Query: 130 LNYDGGGAS--SGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVT 187
           +  D   A+  + +G   R  +    ++  V A+ +NG L + GS+ + V+   + +  T
Sbjct: 127 VGIDSRNAADQTQRGQARRENRFQNELSVRVVAVGQNGLLQVKGSKIIDVDKSKQDIVFT 186

Query: 188 GIVRPQDVDAHNSVSYDKIAEARISYGGKG 217
           G VR QD+   N V   ++A+ +I Y   G
Sbjct: 187 GWVRAQDISVANLVESSRVADLQIGYASPG 216


>gi|21672607|ref|NP_660674.1| flagellar basal body L-ring protein [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25008453|sp|Q8K9K3|FLGH_BUCAP RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|21623238|gb|AAM67885.1| flagellar L-ring protein precursor [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 238

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 88/179 (49%), Gaps = 12/179 (6%)

Query: 68  HAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLF-GQQTPQM 126
           +  LF+D R+ N+GD +TV ++ +  A   + +  +R+     K + G ++  G   P +
Sbjct: 64  YQPLFEDHRSHNIGDTITVVLQENISASNSSSSNLTRDG----KANVGVTVTPGTLNPIL 119

Query: 127 NGNLNYDGGGASS-------GKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVND 179
             N+N +  G  S       GKGS S       LI   V  +L NGNL + G ++V +N 
Sbjct: 120 GLNVNDNKTGIDSIGKNDFSGKGSNSAKNTFTGLITVTVKNVLPNGNLKVIGEKQVAINQ 179

Query: 180 EIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL 238
               +  +G++ P +++ +N V+  +IA+ RI Y    R  ++ +     + +  +SP+
Sbjct: 180 GTEFIRFSGVINPNNINKNNLVASTQIADTRIEYVSNNRINDIQKMGWLQRFLLKISPI 238


>gi|296122949|ref|YP_003630727.1| flagellar L-ring protein [Planctomyces limnophilus DSM 3776]
 gi|296015289|gb|ADG68528.1| flagellar L-ring protein [Planctomyces limnophilus DSM 3776]
          Length = 232

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 84/194 (43%), Gaps = 17/194 (8%)

Query: 54  SDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLS 113
           SD+  + YSL       L  +   + V DI+T+ +    + + +++  R RN +   +LS
Sbjct: 47  SDTRIEDYSLIYVEPPPLPPE---IKVHDIITIQVDEKAEVIVNSRFNRQRNGAYAAELS 103

Query: 114 GGFSLFG---------QQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILEN 164
             F  FG         Q +P + G LN          G ++  E ++  IAA V  +L N
Sbjct: 104 D-FVRFGDNFNLLPAAQNSPAIEGTLN----NRLQTIGQLTDQEGISYNIAATVVDVLPN 158

Query: 165 GNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLR 224
           G +++   + +R N +     + G +    +  + +   + IAE +I    KG+     +
Sbjct: 159 GTVVLEARKSIRTNQDFFEYRLAGRIDRLAILPNRTARSEDIAELKIERTQKGKVYNSTK 218

Query: 225 PPIGHQLIENLSPL 238
              G  +++ +SP 
Sbjct: 219 TNWGTNILDIISPF 232


>gi|170695743|ref|ZP_02886885.1| flagellar L-ring protein [Burkholderia graminis C4D1M]
 gi|170139348|gb|EDT07534.1| flagellar L-ring protein [Burkholderia graminis C4D1M]
          Length = 123

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 41/75 (54%)

Query: 143 SISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVS 202
           S++ A  +   +A  V   +  GNL++SG + + +      L ++G+V P+D++  N V+
Sbjct: 28  SLTDASAMTGTLAVTVIGTMPTGNLVVSGEKVISMGGNRDRLRLSGVVNPKDIETGNYVA 87

Query: 203 YDKIAEARISYGGKG 217
             K+A ARI   G G
Sbjct: 88  SSKVANARIEQAGSG 102


>gi|2494537|sp|Q52081|FLGH_PSEPU RecName: Full=Flagellar L-ring protein; AltName: Full=Basal body
           L-ring protein; Flags: Precursor
 gi|405549|gb|AAA62845.1| flagellar L-ring protein [Pseudomonas putida]
          Length = 231

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 56/118 (47%), Gaps = 10/118 (8%)

Query: 117 SLFGQQTPQMN-----GNLN----YDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNL 167
           SLFG  TP  N     G+L+    Y G  A+ G    ++   L   I   V  +L NGN 
Sbjct: 101 SLFGS-TPNTNNPFGGGDLSLEAGYSGDRATKGDSKATQGNTLTGSITVTVAEVLPNGNH 159

Query: 168 IISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTELLRP 225
             +  + + +N     + + G+VR  D+   N+V   ++A+ARI+Y G G   +  +P
Sbjct: 160 RRARQKWLTLNTGEELVRIAGMVRADDIATDNTVPSTRVADARITYSGTGSFADASQP 217


>gi|291613041|ref|YP_003523198.1| flagellar L-ring protein [Sideroxydans lithotrophicus ES-1]
 gi|291583153|gb|ADE10811.1| flagellar L-ring protein [Sideroxydans lithotrophicus ES-1]
          Length = 223

 Score = 47.