RPSBLAST alignment for GI: 254780374 and conserved domain: PRK12701

>gnl|CDD|183691 PRK12701, flgH, flagellar basal body L-ring protein; Reviewed. Length = 230
 Score = 81.0 bits (199), Expect = 3e-16
 Identities = 68/223 (30%), Positives = 107/223 (47%), Gaps = 19/223 (8%)

Query: 1   MYRYSFIVLCYSS-LLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKK 59
           M R +  V C ++ LLFGC +      G           D  +  P   +     +  K 
Sbjct: 1   MNRLNIAVSCLATALLFGCEALHPPAPG-----------DNPDYAPTYPVTPDPKELRKV 49

Query: 60  SYSLWRDSHA-ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSL 118
           S +++    A  LF+  RA + GDILTV + I+      N T   R N   +  +  F  
Sbjct: 50  SGAIYSSETALPLFETPRARHPGDILTVYL-IEKTDAQKNATTTQRKNDTTKITNKLF-- 106

Query: 119 FGQQTPQMNG---NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEV 175
            G+     +G   + + D     +G+G   +  KL   I+  V  +L NGN+++ G + V
Sbjct: 107 LGRPISLGSGYSMDFDLDNQRQFNGEGRSIQNNKLAGSISVTVAKVLANGNMVVQGEKWV 166

Query: 176 RVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGR 218
           R+N     + ++GIVRPQD+ A N+++ D+IA ARISYGG G+
Sbjct: 167 RINQGNEFVRLSGIVRPQDIKADNTITSDRIANARISYGGTGQ 209