RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780374|ref|YP_003064787.1| flagellar basal body L-ring protein [Candidatus Liberibacter asiaticus str. psy62] (238 letters) >2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus HB8} PDB: 2yri_A* (A:1-17,A:252-353) Length = 119 Score = 27.5 bits (61), Expect = 1.5 Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Query: 179 DEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARIS-YGGKGRT-TELLRPPIGH 229 V + P+ VDA + ++ GG G T ++LR +G Sbjct: 47 KASPLPTVLVVRPPEGVDA--DRLVRALYAEGVAVAGGIGPTRGQVLR--LGL 95 >1vio_A Ribosomal small subunit pseudouridine synthase A; structural genomics, lyase; 1.59A {Haemophilus influenzae} (A:1-57) Length = 57 Score = 25.7 bits (57), Expect = 6.3 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 5/46 (10%) Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182 A + + S+A K I +A+ NG ++ SGS ++ DEI Sbjct: 10 AENVGLTRSQATKA---IRQ--SAVKINGEIVKSGSVQISQEDEIY 50 >1ksk_A Ribosomal small subunit pseudouridine synthase A; RSUA, lyase; 2.00A {Escherichia coli} (A:1-58) Length = 58 Score = 25.3 bits (56), Expect = 7.2 Identities = 5/46 (10%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182 A S + A + I + +G ++ + + ++ ++ Sbjct: 11 AQQLGVSRAIAGRE---IRG--NRVTVDGEIVRNAAFKLLPEHDVA 51 >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} (A:232-362) Length = 131 Score = 25.4 bits (55), Expect = 7.4 Identities = 5/33 (15%), Positives = 16/33 (48%) Query: 70 ALFKDSRALNVGDILTVDIRIDDQAVFDNQTGR 102 + + G+ +T+ ++ + +FD +T + Sbjct: 92 VFAPEGEHFSFGEKVTIKVKEELLVLFDKKTEK 124 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.316 0.134 0.381 Gapped Lambda K H 0.267 0.0517 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,712,314 Number of extensions: 71168 Number of successful extensions: 214 Number of sequences better than 10.0: 1 Number of HSP's gapped: 214 Number of HSP's successfully gapped: 9 Length of query: 238 Length of database: 4,956,049 Length adjustment: 86 Effective length of query: 152 Effective length of database: 2,048,819 Effective search space: 311420488 Effective search space used: 311420488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (24.7 bits)