RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780374|ref|YP_003064787.1| flagellar basal body L-ring protein [Candidatus Liberibacter asiaticus str. psy62] (238 letters) >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Length = 223 Score = 26.9 bits (58), Expect = 1.4 Identities = 7/20 (35%), Positives = 12/20 (60%), Gaps = 2/20 (10%) Query: 135 GGASSGKGSISR--AEKLNL 152 G ASSGK ++++ A+ Sbjct: 10 GPASSGKSTVAKIIAKDFGF 29 >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Length = 225 Score = 26.9 bits (58), Expect = 1.5 Identities = 7/20 (35%), Positives = 12/20 (60%), Gaps = 2/20 (10%) Query: 135 GGASSGKGSISR--AEKLNL 152 G + +GKG++ + AE L Sbjct: 10 GPSGAGKGTLCKAMAEALQW 29 >d1smyc_ e.29.1.1 (C:) RNA-polymerase beta {Thermus thermophilus [TaxId: 274]} Length = 1119 Score = 26.7 bits (58), Expect = 2.1 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 162 LENGNLIISGSQEVRVNDEIRSLNV 186 E+G+ II+G+ V V+ RS V Sbjct: 122 TEDGSFIINGADRVIVSQIHRSPGV 146 >d1vioa2 d.66.1.5 (A:0-57) Pseudouridine synthase RsuA N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 58 Score = 25.4 bits (56), Expect = 4.3 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 5/46 (10%) Query: 137 ASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIR 182 A + + S+A K I +A+ NG ++ SGS ++ DEI Sbjct: 9 AENVGLTRSQATKA---IRQ--SAVKINGEIVKSGSVQISQEDEIY 49 >d1o4za_ b.29.1.2 (A:) beta-Agarase A {Zobellia galactanivorans [TaxId: 63186]} Length = 295 Score = 24.9 bits (53), Expect = 5.9 Identities = 7/58 (12%), Positives = 18/58 (31%), Gaps = 10/58 (17%) Query: 160 AILENGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKG 217 + + +G L + +++ + + + + V Y EAR Sbjct: 64 SYVADGELKMWATRK----------PGSDKINMGCITSKTRVVYPVYIEARAKVMNST 111 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.134 0.381 Gapped Lambda K H 0.267 0.0635 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 840,443 Number of extensions: 36520 Number of successful extensions: 80 Number of sequences better than 10.0: 1 Number of HSP's gapped: 80 Number of HSP's successfully gapped: 7 Length of query: 238 Length of database: 2,407,596 Length adjustment: 83 Effective length of query: 155 Effective length of database: 1,268,006 Effective search space: 196540930 Effective search space used: 196540930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.6 bits)