Query gi|254780375|ref|YP_003064788.1| hypothetical protein CLIBASIA_01300 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 175 No_of_seqs 153 out of 463 Neff 5.9 Searched_HMMs 39220 Date Sun May 29 17:41:09 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780375.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 COG3334 Uncharacterized conser 100.0 8.3E-27 2.1E-31 188.7 20.3 165 2-169 13-186 (192) 2 COG3334 Uncharacterized conser 98.6 2E-05 5.2E-10 53.6 17.6 106 56-162 60-167 (192) 3 pfam03448 MgtE_N MgtE intracel 98.1 1.9E-05 4.9E-10 53.8 7.8 60 104-163 39-98 (102) 4 pfam03448 MgtE_N MgtE intracel 97.6 0.00026 6.7E-09 46.6 7.4 58 105-162 28-85 (102) 5 COG2239 MgtE Mg/Co/Ni transpor 97.6 0.0003 7.8E-09 46.2 6.9 59 106-164 71-129 (451) 6 TIGR00207 fliG flagellar motor 97.3 0.00087 2.2E-08 43.3 6.9 63 107-169 118-180 (346) 7 PRK07194 fliG flagellar motor 97.3 0.0013 3.3E-08 42.2 7.4 67 104-170 105-171 (334) 8 PRK05686 fliG flagellar motor 97.2 0.0027 6.8E-08 40.2 8.1 67 104-170 108-174 (337) 9 COG2239 MgtE Mg/Co/Ni transpor 96.7 0.0088 2.3E-07 37.0 7.1 59 104-162 45-103 (451) 10 PRK07194 fliG flagellar motor 95.5 0.1 2.7E-06 30.2 7.8 64 101-164 114-183 (334) 11 PRK05686 fliG flagellar motor 95.1 0.17 4.5E-06 28.8 8.0 65 101-165 117-187 (337) 12 PRK12705 hypothetical protein; 94.2 0.43 1.1E-05 26.3 13.8 71 58-129 59-130 (485) 13 TIGR00207 fliG flagellar motor 93.8 0.34 8.6E-06 27.0 6.9 66 105-170 128-199 (346) 14 PRK11637 hypothetical protein; 93.8 0.53 1.3E-05 25.7 12.7 77 59-135 58-134 (404) 15 pfam12072 DUF3552 Domain of un 93.0 0.7 1.8E-05 25.0 14.5 29 109-137 141-173 (201) 16 COG1536 FliG Flagellar motor s 92.7 0.76 1.9E-05 24.7 13.2 63 107-169 113-175 (339) 17 TIGR03319 YmdA_YtgF conserved 91.1 1.1 2.9E-05 23.6 13.9 30 109-138 139-172 (514) 18 pfam06447 consensus 89.6 1.6 4E-05 22.8 8.3 46 53-98 56-101 (407) 19 KOG3088 consensus 88.6 1.1 2.8E-05 23.8 5.0 34 58-91 59-92 (313) 20 PRK05934 type III secretion sy 87.2 1.5 3.8E-05 22.9 5.0 52 111-163 278-329 (341) 21 KOG1962 consensus 86.1 2.5 6.4E-05 21.4 8.2 53 61-114 153-205 (216) 22 PRK10642 proline/glycine betai 85.6 2.7 6.8E-05 21.3 9.3 30 60-89 453-482 (490) 23 pfam01706 FliG_C FliG C-termin 85.2 2.8 7.1E-05 21.2 9.3 58 112-169 26-83 (110) 24 PRK12704 phosphodiesterase; Pr 84.0 3.2 8E-05 20.8 12.2 72 57-129 22-101 (455) 25 PRK00106 hypothetical protein; 82.4 3.6 9.3E-05 20.4 12.2 19 111-129 162-181 (535) 26 COG4942 Membrane-bound metallo 82.0 3.8 9.6E-05 20.3 12.2 121 40-170 42-175 (420) 27 PRK13454 F0F1 ATP synthase sub 80.0 4.4 0.00011 19.9 12.4 63 16-78 31-102 (181) 28 pfam04156 IncA IncA protein. C 73.5 6.6 0.00017 18.8 12.6 61 55-116 82-142 (186) 29 pfam05377 FlaC_arch Flagella a 67.2 9.1 0.00023 17.9 6.9 44 69-113 3-46 (55) 30 pfam05529 Bap31 B-cell recepto 65.6 9.8 0.00025 17.7 5.6 19 74-92 162-180 (192) 31 KOG0979 consensus 64.5 10 0.00026 17.6 9.5 57 58-114 862-922 (1072) 32 PRK10803 hypothetical protein; 63.8 11 0.00027 17.5 12.5 85 13-97 6-92 (262) 33 COG3883 Uncharacterized protei 62.6 11 0.00028 17.4 13.1 81 12-92 3-92 (265) 34 TIGR02976 phageshock_pspB phag 60.8 12 0.0003 17.2 6.8 21 66-86 45-65 (75) 35 TIGR03052 PS_I_psaI photosyste 60.6 9 0.00023 18.0 2.9 23 4-26 3-25 (31) 36 PRK05724 acetyl-CoA carboxylas 58.3 13 0.00034 16.9 5.7 65 74-138 13-78 (318) 37 TIGR03545 conserved hypothetic 56.9 14 0.00035 16.8 10.4 24 102-126 262-285 (554) 38 TIGR02044 CueR Cu(I)-responsiv 55.3 15 0.00038 16.6 3.7 26 70-95 86-111 (127) 39 KOG0933 consensus 55.2 15 0.00038 16.6 7.9 50 52-101 780-829 (1174) 40 PRK06569 F0F1 ATP synthase sub 53.9 16 0.0004 16.5 13.5 62 16-77 10-80 (157) 41 PRK09039 hypothetical protein; 53.8 16 0.0004 16.4 13.1 18 14-31 21-38 (343) 42 PRK00708 sec-independent trans 53.1 16 0.00041 16.4 7.2 27 46-72 44-70 (197) 43 cd03687 Dehydratase_LU Dehydra 52.6 16 0.00041 16.3 3.8 39 105-143 92-130 (545) 44 pfam02286 Dehydratase_LU Dehyd 51.8 17 0.00043 16.2 3.9 39 105-143 99-137 (554) 45 COG1792 MreC Cell shape-determ 51.6 17 0.00043 16.2 7.6 51 46-96 55-106 (284) 46 PRK09174 F0F1 ATP synthase sub 50.8 17 0.00044 16.2 12.7 61 16-76 53-122 (204) 47 KOG0646 consensus 50.7 17 0.00044 16.1 4.5 45 74-118 429-473 (476) 48 pfam04568 IATP Mitochondrial A 48.5 19 0.00048 15.9 4.9 36 54-89 52-89 (90) 49 pfam04012 PspA_IM30 PspA/IM30 48.1 19 0.00049 15.9 9.9 28 102-129 146-173 (220) 50 PRK11546 zraP zinc resistance 46.8 20 0.00051 15.8 10.1 90 14-103 9-108 (139) 51 PRK00409 recombination and DNA 45.3 21 0.00054 15.6 9.0 36 60-95 522-557 (780) 52 PRK00295 hypothetical protein; 43.0 23 0.00059 15.4 7.2 45 56-100 9-53 (68) 53 cd02434 Nodulin-21_like_3 Nodu 42.6 23 0.00059 15.4 7.2 13 114-126 95-107 (225) 54 KOG2150 consensus 42.3 23 0.0006 15.3 3.3 30 67-96 39-68 (575) 55 COG1842 PspA Phage shock prote 42.0 24 0.00061 15.3 10.1 29 101-129 146-174 (225) 56 PRK10361 DNA recombination pro 41.7 24 0.00061 15.3 14.2 16 14-29 9-24 (475) 57 CHL00198 accA acetyl-CoA carbo 41.6 24 0.00061 15.3 5.7 65 74-138 17-82 (322) 58 CHL00186 psaI photosystem I su 40.9 25 0.00063 15.2 2.6 25 3-27 5-29 (36) 59 cd04787 HTH_HMRTR_unk Helix-Tu 40.0 25 0.00065 15.1 6.1 35 64-98 80-114 (133) 60 pfam00796 PSI_8 Photosystem I 39.8 14 0.00035 16.8 1.1 23 4-26 1-23 (26) 61 COG2900 SlyX Uncharacterized p 39.6 26 0.00066 15.1 6.2 45 57-101 13-57 (72) 62 pfam11853 DUF3373 Protein of u 39.4 26 0.00066 15.0 4.3 18 68-85 33-50 (485) 63 pfam08564 CDC37_C Cdc37 C term 39.3 26 0.00067 15.0 3.2 41 121-162 9-49 (87) 64 cd01282 HTH_MerR-like_sg3 Heli 39.2 26 0.00067 15.0 5.3 31 63-93 81-111 (112) 65 pfam02979 NHase_alpha Nitrile 37.2 28 0.00072 14.8 4.1 58 80-137 4-64 (189) 66 pfam07374 DUF1492 Protein of u 37.0 28 0.00072 14.8 4.1 62 62-124 21-82 (100) 67 PRK10698 phage shock protein P 36.9 28 0.00073 14.8 10.2 62 67-128 100-173 (222) 68 cd04783 HTH_MerR1 Helix-Turn-H 35.9 29 0.00075 14.7 4.9 31 65-95 79-109 (126) 69 PRK10780 periplasmic chaperone 35.5 30 0.00076 14.7 12.6 64 15-83 4-72 (161) 70 cd04770 HTH_HMRTR Helix-Turn-H 35.1 30 0.00078 14.6 5.6 33 63-95 79-111 (123) 71 TIGR00400 mgtE magnesium trans 34.7 31 0.00079 14.6 6.1 51 111-161 79-129 (460) 72 PRK00736 hypothetical protein; 34.5 31 0.00079 14.6 7.1 45 56-100 9-53 (68) 73 pfam10526 NADH_ub_rd_NUML NADH 32.6 33 0.00085 14.4 2.6 23 3-26 13-35 (80) 74 cd04776 HTH_GnyR Helix-Turn-He 32.6 33 0.00085 14.4 6.6 35 68-102 78-112 (118) 75 PRK09514 zntR zinc-responsive 32.5 34 0.00085 14.3 5.1 31 65-95 83-113 (140) 76 pfam03255 ACCA Acetyl co-enzym 32.4 34 0.00086 14.3 6.1 63 74-136 11-74 (145) 77 COG5665 NOT5 CCR4-NOT transcri 31.6 35 0.00088 14.3 3.9 29 69-97 31-59 (548) 78 PRK03947 prefoldin subunit alp 31.1 35 0.0009 14.2 4.7 16 110-125 87-102 (141) 79 COG2959 HemX Uncharacterized e 31.1 35 0.0009 14.2 13.5 86 60-158 91-178 (391) 80 pfam07996 T4SS Type IV secreti 30.2 37 0.00093 14.1 8.0 63 13-92 4-67 (217) 81 cd04769 HTH_MerR2 Helix-Turn-H 30.1 37 0.00094 14.1 6.3 35 64-98 80-114 (116) 82 PRK02793 hypothetical protein; 30.1 37 0.00094 14.1 6.7 42 57-98 13-54 (72) 83 TIGR02894 DNA_bind_RsfA transc 30.0 37 0.00094 14.1 7.3 45 67-112 107-151 (163) 84 PRK02119 hypothetical protein; 27.4 41 0.001 13.8 6.7 43 57-99 14-56 (73) 85 pfam01988 VIT1 VIT family. Thi 27.3 41 0.001 13.8 5.0 22 105-126 83-106 (210) 86 PRK13752 putative transcriptio 27.3 41 0.001 13.8 5.1 29 67-95 88-116 (144) 87 cd01108 HTH_CueR Helix-Turn-He 26.9 42 0.0011 13.8 5.6 31 65-95 81-111 (127) 88 cd01111 HTH_MerD Helix-Turn-He 26.8 42 0.0011 13.7 4.7 27 66-92 80-106 (107) 89 cd04785 HTH_CadR-PbrR-like Hel 26.3 43 0.0011 13.7 5.8 32 64-95 80-111 (126) 90 cd04789 HTH_Cfa Helix-Turn-Hel 25.9 44 0.0011 13.6 4.2 28 66-93 74-101 (102) 91 pfam09726 Macoilin Transmembra 25.6 44 0.0011 13.6 7.1 24 67-90 541-564 (680) 92 PRK11877 psaI photosystem I re 25.4 18 0.00045 16.1 -0.3 23 4-26 10-32 (38) 93 pfam11857 DUF3377 Domain of un 25.0 45 0.0012 13.5 2.5 21 1-25 33-53 (74) 94 pfam06810 Phage_GP20 Phage min 24.6 46 0.0012 13.5 9.9 26 61-86 22-47 (156) 95 cd04784 HTH_CadR-PbrR Helix-Tu 24.5 46 0.0012 13.5 5.6 32 64-95 80-111 (127) 96 pfam01763 Herpes_UL6 Herpesvir 24.5 46 0.0012 13.5 7.2 42 62-103 353-394 (551) 97 PRK11677 cytochrome d ubiquino 23.8 48 0.0012 13.4 6.9 18 60-77 37-54 (134) 98 PRK04406 hypothetical protein; 23.7 48 0.0012 13.4 6.8 42 57-98 16-57 (75) 99 pfam08781 DP Transcription fac 23.4 48 0.0012 13.3 5.3 32 67-98 2-33 (141) 100 PRK12765 flagellar capping pro 23.4 49 0.0012 13.3 6.5 52 63-114 527-578 (597) 101 PRK09921 permease DsdX; Provis 23.3 49 0.0012 13.3 2.0 39 1-39 123-161 (445) 102 cd04781 HTH_MerR-like_sg6 Heli 23.1 49 0.0013 13.3 4.6 29 65-93 76-104 (120) 103 pfam09851 DUF2078 Predicted me 22.8 50 0.0013 13.3 5.6 12 58-69 61-72 (73) 104 cd01107 HTH_BmrR Helix-Turn-He 22.6 50 0.0013 13.2 5.6 33 63-95 75-107 (108) 105 cd04775 HTH_Cfa-like Helix-Tur 21.1 54 0.0014 13.1 4.3 28 66-93 74-101 (102) 106 pfam09403 FadA Adhesion protei 20.7 55 0.0014 13.0 10.1 36 67-102 63-104 (126) No 1 >COG3334 Uncharacterized conserved protein [Function unknown] Probab=99.96 E-value=8.3e-27 Score=188.66 Aligned_cols=165 Identities=27% Similarity=0.449 Sum_probs=141.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCHHHHCCCC----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHH Q ss_conf 3788999998999999999999841302210146----6778576899999997667999999999999999999--999 Q gi|254780375|r 2 ILLPIIYYYKKRDMLSQLLFLLFFFLQGFANQSY----GDPTLVDREIQQYCTNVIDSVRERDYLSQKKVLEDLQ--KDI 75 (175) Q Consensus 2 i~ip~if~~~~~~~l~~~~~~l~~~~~~~a~~~~----~~~~~~~~ei~~~~~~~~~~~re~~l~~~e~eL~~le--~~l 75 (175) +++|++|+. .....+.+..+...+.++++.. .......++++.+|.++.++.+++.+..|.+.++.++ .++ T Consensus 13 ~~~~~~~~~---~~~~~~a~~~~~~~~~e~ed~~~~~~~~~~~~~~e~~k~~~~i~da~~dq~~~~q~e~~~~lk~~a~~ 89 (192) T COG3334 13 ILIPSRFLL---LLASAFALFAAKPVGAEAEDAAAELAEKKAAAQSEIEKFCANIADAAADQLYALQKELLEKLKDLAEV 89 (192) T ss_pred HHHHHHHHH---HHHHHHHHHHHCCCCHHCCCHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 974489999---99999999872442100032654200223033307788878899999999999888899998888889 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHH--HHHH-HHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCH Q ss_conf 9999999999999999999999999--9999-999999951998999999963798999999972998999999962999 Q gi|254780375|r 76 EQRVILLENHKKEYNLWFQKYDSFI--MSYN-KNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNP 152 (175) Q Consensus 76 ~~r~~eLe~~~~ei~~~l~~~~~~~--~~~~-~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p 152 (175) +++++.|+.++.+|+.|+++++.+. +++. ++||+||++|+|++||.+|+.|+++.|+.|+++|+||++|.||++||| T Consensus 90 ~E~lk~lE~~kae~k~~~e~re~~l~~~qae~~klv~iY~~Mkp~~aA~~le~l~~e~Aa~Il~~L~~r~~~~ILakMdP 169 (192) T COG3334 90 NERLKALEKKKAELKDLEEEREGILRSKQAEDGKLVKIYSKMKPDAAAAILENLPDEEAAAILMKLKPRKLGLILAKMDP 169 (192) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHCCCH T ss_conf 99999999989999999999989988778656279999980791668999983898889999983882189999873898 Q ss_pred HHHHHHHHHHHCCCCCH Q ss_conf 99999999995271121 Q gi|254780375|r 153 KSATMITNVVANMLKFK 169 (175) Q Consensus 153 ~~Aa~it~~la~~~~~~ 169 (175) ++|+.+|.+|++...-+ T Consensus 170 ekAA~lt~~i~~~~~~~ 186 (192) T COG3334 170 EKAATLTELIASPPRNN 186 (192) T ss_pred HHHHHHHHHHHCCCCCC T ss_conf 88999999986578766 No 2 >COG3334 Uncharacterized conserved protein [Function unknown] Probab=98.59 E-value=2e-05 Score=53.62 Aligned_cols=106 Identities=16% Similarity=0.210 Sum_probs=59.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHCCHHHHHHHHHHCCHHHHHH Q ss_conf 99999999999999999999999999999999999999999999999999999999--5199899999996379899999 Q gi|254780375|r 56 VRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIY--KKMDSDSAALQLEQIDPDISSH 133 (175) Q Consensus 56 ~re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~~~~~~lv~iy--~~M~p~~AA~il~~m~~d~aa~ 133 (175) .+..=.+.-...+-.++.+++++..++....+.+..+.++ +.....-.+.-=.+. .+=+...-..+.+.|+++.++. T Consensus 60 ~~~~i~da~~dq~~~~q~e~~~~lk~~a~~~E~lk~lE~~-kae~k~~~e~re~~l~~~qae~~klv~iY~~Mkp~~aA~ 138 (192) T COG3334 60 FCANIADAAADQLYALQKELLEKLKDLAEVNERLKALEKK-KAELKDLEEEREGILRSKQAEDGKLVKIYSKMKPDAAAA 138 (192) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH T ss_conf 8788999999999998888999988888899999999998-999999999998998877865627999998079166899 Q ss_pred HHHHCCHHHHHHHHHHCCHHHHHHHHHHH Q ss_conf 99729989999999629999999999999 Q gi|254780375|r 134 ILMRLSPRQSSLIMSKMNPKSATMITNVV 162 (175) Q Consensus 134 iL~~m~~~~~a~IL~~M~p~~Aa~it~~l 162 (175) +|..|++..++.||..|+|.+.+.|..-| T Consensus 139 ~le~l~~e~Aa~Il~~L~~r~~~~ILakM 167 (192) T COG3334 139 ILENLPDEEAAAILMKLKPRKLGLILAKM 167 (192) T ss_pred HHHCCCHHHHHHHHHHCCHHHHHHHHHCC T ss_conf 99838988899999838821899998738 No 3 >pfam03448 MgtE_N MgtE intracellular N domain. This domain is found at the N-terminus of eubacterial magnesium transporters of the MgtE family pfam01769. This domain is an intracellular domain that has an alpha-helical structure. The crystal structure of the MgtE transporter shows two of 5 magnesium ions are in the interface between the N domain and the CBS domains. In the absence of magnesium there is a large shift between the N and CBS domains. Probab=98.09 E-value=1.9e-05 Score=53.75 Aligned_cols=60 Identities=18% Similarity=0.358 Sum_probs=54.4 Q ss_pred HHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHH Q ss_conf 999999995199899999996379899999997299899999996299999999999995 Q gi|254780375|r 104 NKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVA 163 (175) Q Consensus 104 ~~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~la 163 (175) ......+.+.|++..++.+++.|+.|+++++|..|+++....||+.|+++.+..+..+++ T Consensus 39 ~~~~~~il~~l~~~~~~~il~~m~~Dd~~dll~~L~~~~~~~iL~~l~~~~r~~i~~ll~ 98 (102) T pfam03448 39 EDVQAELLEALPPEELAELLEELDPDDAADLLEELPEEVREELLSLLDPEEREEIRELLS 98 (102) T ss_pred HHHHHHHHHHCCHHHHHHHHHHCCCHHHHHHHHHCCHHHHHHHHHCCCHHHHHHHHHHCC T ss_conf 999999998689898999998189278999998799999999998599999999999828 No 4 >pfam03448 MgtE_N MgtE intracellular N domain. This domain is found at the N-terminus of eubacterial magnesium transporters of the MgtE family pfam01769. This domain is an intracellular domain that has an alpha-helical structure. The crystal structure of the MgtE transporter shows two of 5 magnesium ions are in the interface between the N domain and the CBS domains. In the absence of magnesium there is a large shift between the N and CBS domains. Probab=97.64 E-value=0.00026 Score=46.58 Aligned_cols=58 Identities=16% Similarity=0.354 Sum_probs=33.8 Q ss_pred HHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHH Q ss_conf 9999999519989999999637989999999729989999999629999999999999 Q gi|254780375|r 105 KNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVV 162 (175) Q Consensus 105 ~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~l 162 (175) ...++|+..|+|...+.+++.|+.+.++.++..|+++.++.||..|+++.+..+...| T Consensus 28 ~~~~~il~~l~~~~~~~il~~l~~~~~~~il~~m~~Dd~~dll~~L~~~~~~~iL~~l 85 (102) T pfam03448 28 ERAAEVLEELDEDVQAELLEALPPEELAELLEELDPDDAADLLEELPEEVREELLSLL 85 (102) T ss_pred HHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCCHHHHHHHHHCCHHHHHHHHHCC T ss_conf 5599999817999999999868989899999818927899999879999999999859 No 5 >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Probab=97.57 E-value=0.0003 Score=46.19 Aligned_cols=59 Identities=15% Similarity=0.293 Sum_probs=53.9 Q ss_pred HHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHC Q ss_conf 99999951998999999963798999999972998999999962999999999999952 Q gi|254780375|r 106 NILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVAN 164 (175) Q Consensus 106 ~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~la~ 164 (175) .=-+++..|+++..+..+++|++|++++++..|+.+....+|+.|+|+++.++...+.- T Consensus 71 ~~~~ii~~~~~~~~~~~ie~m~~Dd~~~ll~elp~~~~~~lL~~l~~~~r~~v~~~l~y 129 (451) T COG2239 71 VREEIIEALSDEELAAAIEELDIDDAADLLDELPDEVRDELLSLLDPEERARVRQLLSY 129 (451) T ss_pred HHHHHHHHCCHHHHHHHHHHCCCHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCC T ss_conf 89999985599999999872692778999986877789999981899999999986589 No 6 >TIGR00207 fliG flagellar motor switch protein FliG; InterPro: IPR000090 The flagellar motor switch in Escherichia coli and Salmonella typhimurium regulates the direction of flagellar rotation and hence controls swimming behaviour . The switch is a complex apparatus that responds to signals transduced by the chemotaxis sensory signalling system during chemotactic behaviour . CheY, the chemotaxis response regulator, is believed to act directly on the switch to induce tumbles in the swimming pattern, but no physical interactions of CheY and switch proteins have yet been demonstrated. The switch complex comprises at least three proteins - FliG, FliM and FliN. It has been shown that FliG interacts with FliM, FliM interacts with itself, and FliM interacts with FliN . Several residues within the middle third of FliG appear to be strongly involved in the FliG-FliM interaction, with residues near the N- or C-termini being less important . Such clustering suggests that FliG-FliM interaction plays a central role in switching. Analysis of the FliG, FliM and FliN sequences shows that none are especially hydrophobic or appear to be integral membrane proteins . This result is consistent with other evidence suggesting that the proteins may be peripheral to the membrane, possibly mounted on the basal body M ring , . FliG is present in about 25 copies per flagellum. This structure of the C-terminal domain is known, this domain functions specifically in motor rotation .; GO: 0003774 motor activity, 0001539 ciliary or flagellar motility, 0006935 chemotaxis, 0009288 flagellin-based flagellum. Probab=97.34 E-value=0.00087 Score=43.30 Aligned_cols=63 Identities=21% Similarity=0.263 Sum_probs=58.7 Q ss_pred HHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHCCCCCH Q ss_conf 999995199899999996379899999997299899999996299999999999995271121 Q gi|254780375|r 107 ILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFK 169 (175) Q Consensus 107 lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~la~~~~~~ 169 (175) =.++...|+|.++|..+.+=.|-+.|-||..|+|.+||.||+++|++--+++..-||.+.... T Consensus 118 ~f~~~~~~~P~~~~dfI~~EHPQtiAlIL~hL~~~~Aa~iLs~l~~e~~~~v~~RiA~~g~~s 180 (346) T TIGR00207 118 GFEFLRKAEPQQIADFIQQEHPQTIALILSHLDPAQAAEILSLLPEEVQAEVARRIAVMGRTS 180 (346) T ss_pred CHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHCHHHHHHHHHCCCHHHHHHHHHHHHHCCCCC T ss_conf 156763158688998775058679999998518304788873068568999999998507867 No 7 >PRK07194 fliG flagellar motor switch protein G; Reviewed Probab=97.30 E-value=0.0013 Score=42.18 Aligned_cols=67 Identities=10% Similarity=0.153 Sum_probs=58.7 Q ss_pred HHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHCCCCCHH Q ss_conf 9999999951998999999963798999999972998999999962999999999999952711214 Q gi|254780375|r 104 NKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFKK 170 (175) Q Consensus 104 ~~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~la~~~~~~~ 170 (175) .....+....|+|+.-|.+|..=.+.+.+-||++|+|++++.||+.++++.+.++..-|+++.+.+. T Consensus 105 ~~~~~~~L~~~dp~~La~~L~~EhPQtiAlILs~L~~~~AA~VL~~Lp~~~~~evi~Ria~l~~v~p 171 (334) T PRK07194 105 IRHKMQRLQWVDPQQLARLIANEHLQMQAVFLAFLPPESAAAVLKYLPEDRQDDILYRIAQLDDVDR 171 (334) T ss_pred CCCHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCH T ss_conf 4567899867999999999873485799999980899999999997899989999999974478999 No 8 >PRK05686 fliG flagellar motor switch protein G; Validated Probab=97.20 E-value=0.0027 Score=40.25 Aligned_cols=67 Identities=21% Similarity=0.256 Sum_probs=60.5 Q ss_pred HHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHCCCCCHH Q ss_conf 9999999951998999999963798999999972998999999962999999999999952711214 Q gi|254780375|r 104 NKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFKK 170 (175) Q Consensus 104 ~~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~la~~~~~~~ 170 (175) .....+....|+|+.-+..|..=.+.+.+-||++|+|++++.||..++++...++..-|+++.+.+. T Consensus 108 ~~~~~~~L~~~dp~~La~~L~~EhPQtiAlILs~L~~~~AA~VL~~Lp~~~~~eVi~RiA~l~~v~p 174 (337) T PRK05686 108 QTSGFDFLRKMDPQQLANFIRNEHPQTIALILSYLDPDQAAEILSLLPEELRADVMMRIATLEGVQP 174 (337) T ss_pred CCCHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCH T ss_conf 5876899865999999999872485899999980999999999986999999999999867789999 No 9 >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Probab=96.68 E-value=0.0088 Score=36.95 Aligned_cols=59 Identities=14% Similarity=0.294 Sum_probs=39.9 Q ss_pred HHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHH Q ss_conf 99999999519989999999637989999999729989999999629999999999999 Q gi|254780375|r 104 NKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVV 162 (175) Q Consensus 104 ~~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~l 162 (175) .+.-..+|.-++++.++++|.+++++....|+..|+..+.+.++++|+|+.++.+.+.+ T Consensus 45 ~~~r~~v~~ll~~~~~~~v~~~l~~~~~~~ii~~~~~~~~~~~ie~m~~Dd~~~ll~el 103 (451) T COG2239 45 GRERVVVWRLLPKEDAAEVLGELDDEVREEIIEALSDEELAAAIEELDIDDAADLLDEL 103 (451) T ss_pred HHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCCHHHHHHHHHC T ss_conf 99888888738876778999832986899999855999999998726927789999868 No 10 >PRK07194 fliG flagellar motor switch protein G; Reviewed Probab=95.50 E-value=0.1 Score=30.18 Aligned_cols=64 Identities=9% Similarity=0.182 Sum_probs=52.9 Q ss_pred HHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHC------CHHHHHHHHHHHHC Q ss_conf 99999999999519989999999637989999999729989999999629------99999999999952 Q gi|254780375|r 101 MSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKM------NPKSATMITNVVAN 164 (175) Q Consensus 101 ~~~~~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M------~p~~Aa~it~~la~ 164 (175) .-.-+.|+.+..+=.|+-.|-||+.|+++.|+.||..++++....|+-.| +|+--.++...|.+ T Consensus 114 ~~dp~~La~~L~~EhPQtiAlILs~L~~~~AA~VL~~Lp~~~~~evi~Ria~l~~v~p~~i~~i~~~L~~ 183 (334) T PRK07194 114 WVDPQQLARLIANEHLQMQAVFLAFLPPESAAAVLKYLPEDRQDDILYRIAQLDDVDRDVVDELDELIER 183 (334) T ss_pred CCCHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHH T ss_conf 7999999999873485799999980899999999997899989999999974478999999999999999 No 11 >PRK05686 fliG flagellar motor switch protein G; Validated Probab=95.14 E-value=0.17 Score=28.76 Aligned_cols=65 Identities=18% Similarity=0.320 Sum_probs=45.0 Q ss_pred HHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHC------CHHHHHHHHHHHHCC Q ss_conf 99999999999519989999999637989999999729989999999629------999999999999527 Q gi|254780375|r 101 MSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKM------NPKSATMITNVVANM 165 (175) Q Consensus 101 ~~~~~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M------~p~~Aa~it~~la~~ 165 (175) .-.-+.|+.+..+=.|+..|-+|+.|+++.|+.||..+++.....|+-.| +|+--..+...|... T Consensus 117 ~~dp~~La~~L~~EhPQtiAlILs~L~~~~AA~VL~~Lp~~~~~eVi~RiA~l~~v~p~~v~~ie~~L~~~ 187 (337) T PRK05686 117 KMDPQQLANFIRNEHPQTIALILSYLDPDQAAEILSLLPEELRADVMMRIATLEGVQPEALKELEEVLEKK 187 (337) T ss_pred CCCHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHH T ss_conf 59999999998724858999999809999999999869999999999998677899999999999999999 No 12 >PRK12705 hypothetical protein; Provisional Probab=94.23 E-value=0.43 Score=26.32 Aligned_cols=71 Identities=14% Similarity=0.214 Sum_probs=39.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHH-HHCCHH Q ss_conf 999999999999999999999999999999999999999999999999999999519989999999-637989 Q gi|254780375|r 58 ERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAALQL-EQIDPD 129 (175) Q Consensus 58 e~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~~~~~~lv~iy~~M~p~~AA~il-~~m~~d 129 (175) ..+...++..|...+..++.+...|+.++..+...-++.+....+... -.+..++|..+.|-.+| +.++.+ T Consensus 59 r~e~q~~e~rl~q~ee~Ld~k~~~l~~~e~~l~~~~~~l~~~~~~~~~-~Le~ia~lt~eeAk~~ll~~~e~e 130 (485) T PRK12705 59 KEQNQREINRLAKRTEQLDERNNKLDKREEALSQQNQQLEELEKQYEN-ELYIVSGLTNEQARKLIIELLDEE 130 (485) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHCCCHHHHHHHHHHHHHHH T ss_conf 999999999999889889888888888899999999999999999999-999986789999999999999999 No 13 >TIGR00207 fliG flagellar motor switch protein FliG; InterPro: IPR000090 The flagellar motor switch in Escherichia coli and Salmonella typhimurium regulates the direction of flagellar rotation and hence controls swimming behaviour . The switch is a complex apparatus that responds to signals transduced by the chemotaxis sensory signalling system during chemotactic behaviour . CheY, the chemotaxis response regulator, is believed to act directly on the switch to induce tumbles in the swimming pattern, but no physical interactions of CheY and switch proteins have yet been demonstrated. The switch complex comprises at least three proteins - FliG, FliM and FliN. It has been shown that FliG interacts with FliM, FliM interacts with itself, and FliM interacts with FliN . Several residues within the middle third of FliG appear to be strongly involved in the FliG-FliM interaction, with residues near the N- or C-termini being less important . Such clustering suggests that FliG-FliM interaction plays a central role in switching. Analysis of the FliG, FliM and FliN sequences shows that none are especially hydrophobic or appear to be integral membrane proteins . This result is consistent with other evidence suggesting that the proteins may be peripheral to the membrane, possibly mounted on the basal body M ring , . FliG is present in about 25 copies per flagellum. This structure of the C-terminal domain is known, this domain functions specifically in motor rotation .; GO: 0003774 motor activity, 0001539 ciliary or flagellar motility, 0006935 chemotaxis, 0009288 flagellin-based flagellum. Probab=93.76 E-value=0.34 Score=26.97 Aligned_cols=66 Identities=21% Similarity=0.353 Sum_probs=47.7 Q ss_pred HHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHH------HHHCCHHHHHHHHHHHHCCCCCHH Q ss_conf 999999951998999999963798999999972998999999------962999999999999952711214 Q gi|254780375|r 105 KNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLI------MSKMNPKSATMITNVVANMLKFKK 170 (175) Q Consensus 105 ~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~I------L~~M~p~~Aa~it~~la~~~~~~~ 170 (175) ..+++...+=-|..-|-||..|++..|+.||+.++++..+.| |+..+|+--.+++.+|-+...--. T Consensus 128 ~~~~dfI~~EHPQtiAlIL~hL~~~~Aa~iLs~l~~e~~~~v~~RiA~~g~~sP~vv~ev~~VLe~kL~s~~ 199 (346) T TIGR00207 128 QQIADFIQQEHPQTIALILSHLDPAQAAEILSLLPEEVQAEVARRIAVMGRTSPEVVKEVERVLEKKLESLT 199 (346) T ss_pred HHHHHHHHCCCHHHHHHHHHHHCHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC T ss_conf 889987750586799999985183047888730685689999999985078678999999999977622442 No 14 >PRK11637 hypothetical protein; Provisional Probab=93.75 E-value=0.53 Score=25.74 Aligned_cols=77 Identities=9% Similarity=0.063 Sum_probs=38.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHH Q ss_conf 99999999999999999999999999999999999999999999999999999519989999999637989999999 Q gi|254780375|r 59 RDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHIL 135 (175) Q Consensus 59 ~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~~~~~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL 135 (175) ..+...+++|..++.+++....+|+.++.++..+-.+.+.....--..+..+|..=....-.-+|+.=+......++ T Consensus 58 ~~i~~~~~~i~~~~~~i~~~~~eI~~l~~~i~~l~~~~~~~~~~l~~~i~~~y~~g~~~~l~~ll~~~~~~~~~r~~ 134 (404) T PRK11637 58 EAISQASRKLRETQNTLNQLNKQIDEMNASIAKLEQQKAAQERSLAAQLDAAFRQGEHTGIQLILSGEESQRGQRLQ 134 (404) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCCHHHHHHHH T ss_conf 99999999999999999999999999999999999999999999999999999847842888975556677899999 No 15 >pfam12072 DUF3552 Domain of unknown function (DUF3552). This presumed domain is functionally uncharacterized. This domain is found in bacteria, archaea and eukaryotes. This domain is about 200 amino acids in length. This domain is found associated with pfam00013, pfam01966. This domain has a single completely conserved residue A that may be functionally important. Probab=92.99 E-value=0.7 Score=24.98 Aligned_cols=29 Identities=10% Similarity=0.291 Sum_probs=15.4 Q ss_pred HHHHHCCHHHHHHH-HHHCCHH---HHHHHHHH Q ss_conf 99951998999999-9637989---99999972 Q gi|254780375|r 109 DIYKKMDSDSAALQ-LEQIDPD---ISSHILMR 137 (175) Q Consensus 109 ~iy~~M~p~~AA~i-l~~m~~d---~aa~iL~~ 137 (175) .-.++|+++.|-.+ |+.+..+ .++.++.. T Consensus 141 E~iaglt~eEAk~~Ll~~~e~e~~~e~a~~ir~ 173 (201) T pfam12072 141 ERISGLTAEEAKEILLEEVEAELKHEAAKMIKE 173 (201) T ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 988699999999999999999999999999999 No 16 >COG1536 FliG Flagellar motor switch protein [Cell motility and secretion] Probab=92.72 E-value=0.76 Score=24.75 Aligned_cols=63 Identities=21% Similarity=0.303 Sum_probs=49.4 Q ss_pred HHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHCCCCCH Q ss_conf 999995199899999996379899999997299899999996299999999999995271121 Q gi|254780375|r 107 ILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFK 169 (175) Q Consensus 107 lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~la~~~~~~ 169 (175) .-+....|+|...+..|.+=.+.+.+-||+.|+|++++.||+..+++...++..-++++.... T Consensus 113 ~~~~l~~~~p~~l~~~i~~EhPQtia~iLs~L~~~~aa~vL~~l~~e~r~~v~~Ria~l~~v~ 175 (339) T COG1536 113 PFDLLRKLDPSQLADLIKNEHPQTIALILSYLPPDQAAEILSTLPEELRADVVKRIATLEGVS 175 (339) T ss_pred HHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHCCCC T ss_conf 777750178999999987125188999998158777899998599989999999987112699 No 17 >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF. Probab=91.14 E-value=1.1 Score=23.62 Aligned_cols=30 Identities=10% Similarity=0.297 Sum_probs=15.9 Q ss_pred HHHHHCCHHHHHHH-HHHCCHH---HHHHHHHHC Q ss_conf 99951998999999-9637989---999999729 Q gi|254780375|r 109 DIYKKMDSDSAALQ-LEQIDPD---ISSHILMRL 138 (175) Q Consensus 109 ~iy~~M~p~~AA~i-l~~m~~d---~aa~iL~~m 138 (175) .=.+.|+.+.|-.+ |+++..+ +++.++..+ T Consensus 139 E~iAgLT~eEAKe~Ll~~le~e~~~eaa~~ir~~ 172 (514) T TIGR03319 139 ERISGLTQEEAKEILLEEVEEEARHEAAKLIKEI 172 (514) T ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9885899999999999999999999999999999 No 18 >pfam06447 consensus Probab=89.57 E-value=1.6 Score=22.78 Aligned_cols=46 Identities=11% Similarity=0.121 Sum_probs=27.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 6799999999999999999999999999999999999999999999 Q gi|254780375|r 53 IDSVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDS 98 (175) Q Consensus 53 ~~~~re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~ 98 (175) +-++..+.+...+++|+.+..+++.....++..++++..+..+.++ T Consensus 56 ala~qq~~~~~l~kql~~l~~e~~~~~~~~~~~q~~l~~l~qe~~~ 101 (407) T pfam06447 56 AIAEQQKTLSEMQKQIRRLRAEREEKERDLDQNQERIASLEQENQQ 101 (407) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999999988788889999999999999 No 19 >KOG3088 consensus Probab=88.60 E-value=1.1 Score=23.77 Aligned_cols=34 Identities=12% Similarity=0.227 Sum_probs=17.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999999999999999999 Q gi|254780375|r 58 ERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNL 91 (175) Q Consensus 58 e~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~ 91 (175) ..++...+++|.+.++||++|-.||+.++.++.. T Consensus 59 a~~~~~kq~eL~~rqeEL~Rke~ELdRREr~~a~ 92 (313) T KOG3088 59 AKDLAKKQAELLKKQEELRRKEQELDRRERALAR 92 (313) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 0689999999999999998789887378999862 No 20 >PRK05934 type III secretion system protein; Validated Probab=87.25 E-value=1.5 Score=22.89 Aligned_cols=52 Identities=23% Similarity=0.374 Sum_probs=37.6 Q ss_pred HHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHH Q ss_conf 95199899999996379899999997299899999996299999999999995 Q gi|254780375|r 111 YKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVA 163 (175) Q Consensus 111 y~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~la 163 (175) |+...++. -.|=...+..-.+.|+.+=+|++.+-||+++||.+|.++..-|- T Consensus 278 Ye~v~~e~-~KIkqgINI~KLiEi~qkESPEKi~lILSYLDpkKAeelln~LP 329 (341) T PRK05934 278 YERVSQEK-EKIKQGINIPKLIEIMQKESPEKIALILSYLDPKKAEELLNKLP 329 (341) T ss_pred HHHCCCHH-HHHHCCCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCH T ss_conf 87448017-77860388799999986418687658988438175999998690 No 21 >KOG1962 consensus Probab=86.08 E-value=2.5 Score=21.44 Aligned_cols=53 Identities=21% Similarity=0.270 Sum_probs=27.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 999999999999999999999999999999999999999999999999999519 Q gi|254780375|r 61 YLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKM 114 (175) Q Consensus 61 l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~~~~~~lv~iy~~M 114 (175) .+.-..+++.++.+++.+..+|+..+.+...+.++-++... -++++.+=|++. T Consensus 153 ~~~~~~~~~kL~~el~~~~~~Le~~~~~~~al~Kq~e~~~~-EydrLlee~~~L 205 (216) T KOG1962 153 NDKLKADLEKLETELEKKQKKLEKAQKKVDALKKQSEGLQD-EYDRLLEEYSKL 205 (216) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-HHHHHHHHHHHH T ss_conf 78877667889999998777888887779999999987110-899998999999 No 22 >PRK10642 proline/glycine betaine transporter; Provisional Probab=85.58 E-value=2.7 Score=21.28 Aligned_cols=30 Identities=17% Similarity=0.261 Sum_probs=22.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999999 Q gi|254780375|r 60 DYLSQKKVLEDLQKDIEQRVILLENHKKEY 89 (175) Q Consensus 60 ~l~~~e~eL~~le~~l~~r~~eLe~~~~ei 89 (175) -++++...++..++++|+++++++++++.+ T Consensus 453 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 482 (490) T PRK10642 453 ILVEHYDNIEQKIEDIDQEIAELQAKRTRL 482 (490) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 987577789888855898999999876888 No 23 >pfam01706 FliG_C FliG C-terminal domain. FliG is a component of the flageller rotor, present in about 25 copies per flagellum. This domain functions specifically in motor rotation. Probab=85.24 E-value=2.8 Score=21.18 Aligned_cols=58 Identities=19% Similarity=0.284 Sum_probs=42.8 Q ss_pred HHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHCCCCCH Q ss_conf 5199899999996379899999997299899999996299999999999995271121 Q gi|254780375|r 112 KKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFK 169 (175) Q Consensus 112 ~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~la~~~~~~ 169 (175) ..+++..--.++.+++.+..+--|...++.....||+.|++-.+..+..-|..+...+ T Consensus 26 ~~l~~~~l~~ll~~v~~~~L~~ALkga~~~~~~~il~nms~R~~~~i~~e~~~~g~v~ 83 (110) T pfam01706 26 VRLDDRDIQRLLREVDKDVLALALKGASEELREKILSNMSKRAAEMLREELEALGPVR 83 (110) T ss_pred HCCCHHHHHHHHHHCCHHHHHHHHCCCCHHHHHHHHHHCCHHHHHHHHHHHHHCCCCC T ss_conf 5579999999998499999999886798999999998768999999999998639988 No 24 >PRK12704 phosphodiesterase; Provisional Probab=83.97 E-value=3.2 Score=20.83 Aligned_cols=72 Identities=13% Similarity=0.212 Sum_probs=33.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH-HHHCCH Q ss_conf 9999999999999999999999999999999999-------99999999999999999999951998999999-963798 Q gi|254780375|r 57 RERDYLSQKKVLEDLQKDIEQRVILLENHKKEYN-------LWFQKYDSFIMSYNKNILDIYKKMDSDSAALQ-LEQIDP 128 (175) Q Consensus 57 re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~-------~~l~~~~~~~~~~~~~lv~iy~~M~p~~AA~i-l~~m~~ 128 (175) ++.++..++..|......++.+..+|+.+++.+. ..-++.++...+....|- -.+.|+.+.|-.. |+++.. T Consensus 22 ~E~rl~qrE~~L~~k~~~L~kre~~Le~~e~~L~~~~~~l~~~~~el~~~~~~~~~~LE-~iAgLT~eEAK~~Ll~~le~ 100 (455) T PRK12704 22 LEKRLLQKEENLDRKSETLDKKEEELEKKEESLEQKQQEVEKKESELEELIAEQLQELE-RISGLTAEEAKEILLEKVEE 100 (455) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHCCCHHHHHHHHHHHHHH T ss_conf 99999999999999999999999999999999999999999999999999999999999-98499999999999999999 Q ss_pred H Q ss_conf 9 Q gi|254780375|r 129 D 129 (175) Q Consensus 129 d 129 (175) + T Consensus 101 e 101 (455) T PRK12704 101 E 101 (455) T ss_pred H T ss_conf 9 No 25 >PRK00106 hypothetical protein; Provisional Probab=82.42 E-value=3.6 Score=20.44 Aligned_cols=19 Identities=11% Similarity=0.080 Sum_probs=10.2 Q ss_pred HHHCCHHHHHHH-HHHCCHH Q ss_conf 951998999999-9637989 Q gi|254780375|r 111 YKKMDSDSAALQ-LEQIDPD 129 (175) Q Consensus 111 y~~M~p~~AA~i-l~~m~~d 129 (175) .+.|+.+.|-.+ |+.|..+ T Consensus 162 iaglt~eeAk~~ll~~~e~e 181 (535) T PRK00106 162 VAALSQAEAREVILMETENK 181 (535) T ss_pred HHCCCHHHHHHHHHHHHHHH T ss_conf 84999999999999999999 No 26 >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Probab=81.99 E-value=3.8 Score=20.34 Aligned_cols=121 Identities=12% Similarity=0.195 Sum_probs=55.6 Q ss_pred CCHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHH- Q ss_conf 57689999999766799-----9999999999999999999999999999999999999999999999---99999999- Q gi|254780375|r 40 LVDREIQQYCTNVIDSV-----RERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMS---YNKNILDI- 110 (175) Q Consensus 40 ~~~~ei~~~~~~~~~~~-----re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~~---~~~~lv~i- 110 (175) ...+++.+....+.... -+.++...+.++..++.++-+....+.+.++.|.......+....+ ....|+.+ T Consensus 42 q~q~ei~~~~~~i~~~~~~~~kL~~~lk~~e~~i~~~~~ql~~s~~~l~~~~~~I~~~~~~l~~l~~q~r~qr~~La~~L 121 (420) T COG4942 42 QIQKEIAALEKKIREQQDQRAKLEKQLKSLETEIASLEAQLIETADDLKKLRKQIADLNARLNALEVQEREQRRRLAEQL 121 (420) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 89999999999999999999999999999998899999999998868999885799999999998889999999999999 Q ss_pred --HHHC--CHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHCCCCCHH Q ss_conf --9519--98999999963798999999972998999999962999999999999952711214 Q gi|254780375|r 111 --YKKM--DSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFKK 170 (175) Q Consensus 111 --y~~M--~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~la~~~~~~~ 170 (175) +..| .|.-+ ..+.++++ .+....+..+.+|+|+.+..+-.+-+.+..+.. T Consensus 122 ~A~~r~g~~p~~~----ll~~~eda------~~~~R~ai~~~~l~~~~~~~i~~l~~~~~~l~~ 175 (420) T COG4942 122 AALQRSGRNPPPA----LLVSPEDA------QRSVRLAIYYGALNPARAERIDALKATLKQLAA 175 (420) T ss_pred HHHHHCCCCCCHH----HHCCHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9998726799803----52586456------677899999998669999999999999999999 No 27 >PRK13454 F0F1 ATP synthase subunit B'; Provisional Probab=79.96 E-value=4.4 Score=19.91 Aligned_cols=63 Identities=10% Similarity=0.114 Sum_probs=28.0 Q ss_pred HHHHHHHHHHHCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHH Q ss_conf 99999999841302210146677857689999999766799999---------9999999999999999999 Q gi|254780375|r 16 LSQLLFLLFFFLQGFANQSYGDPTLVDREIQQYCTNVIDSVRER---------DYLSQKKVLEDLQKDIEQR 78 (175) Q Consensus 16 l~~~~~~l~~~~~~~a~~~~~~~~~~~~ei~~~~~~~~~~~re~---------~l~~~e~eL~~le~~l~~r 78 (175) .++++|+++++...|.--..--.|-..+-+++....+.+...++ -....+..|...+.+-..- T Consensus 31 ~sQiFWl~i~F~ily~vl~k~~lPrI~~vLe~R~~~I~~dL~~Ae~~k~eAe~~~~~ye~~L~~Ar~eA~~i 102 (181) T PRK13454 31 PNQIFWLLVTLVAIYFVLTRVALPRIGAVLAERQGTITNDLAAAEELKQKAVEAEKAYNKALADARAEAQRI 102 (181) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 789999999999999999999998889899999999998899999999999999999999999999999999 No 28 >pfam04156 IncA IncA protein. Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is non-fusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA, is functionally associated with the homotypic fusion of inclusions. This family probably includes members of the wider Inc family rather than just IncA. Probab=73.53 E-value=6.6 Score=18.79 Aligned_cols=61 Identities=18% Similarity=0.185 Sum_probs=33.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH Q ss_conf 99999999999999999999999999999999999999999999999999999999951998 Q gi|254780375|r 55 SVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDS 116 (175) Q Consensus 55 ~~re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~~~~~~lv~iy~~M~p 116 (175) .....++..-.+++...+..+.+...+++..+..+....+... ...+....+-.-|.++.. T Consensus 82 ~~~~~~l~~l~~el~~~~~~~~~~~~~l~~~~~~~~~~~~~~~-~~~~~l~~l~~~~~~~~~ 142 (186) T pfam04156 82 SELKQQLSELQEELEDLEERIAELESELEDLKEDLQLLRELLK-SLEERLESLEESIKELAK 142 (186) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHH T ss_conf 9899999999998998987688874475978878999899878-888889999989998999 No 29 >pfam05377 FlaC_arch Flagella accessory protein C (FlaC). Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct. In several archaea, the flagellin genes are followed immediately by the flagellar accessory genes flaCDEFGHIJ. The gene products may have a role in translocation, secretion, or assembly of the flagellum. FlaC is a protein whose exact role is unknown but it has been shown to be membrane-associated (by immuno-blotting fractionated cells). Probab=67.18 E-value=9.1 Score=17.93 Aligned_cols=44 Identities=16% Similarity=0.322 Sum_probs=24.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999999999999999999951 Q gi|254780375|r 69 EDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKK 113 (175) Q Consensus 69 ~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~~~~~~lv~iy~~ 113 (175) ..++.++..--..+...+.+++.+-...+. .++.++++.++|+- T Consensus 3 ~elEn~~~~l~~~i~t~~~en~~i~~~ie~-i~envk~v~~lYEv 46 (55) T pfam05377 3 DELENKLPKISSMVSTVRKENEELSEEVEK-IDENVKDVLSLYEV 46 (55) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHH T ss_conf 788867588999999899889999999999-99999999999999 No 30 >pfam05529 Bap31 B-cell receptor-associated protein 31-like. Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8. Bap31 is cleaved within its cytosolic domain, generating pro-apoptotic p20 Bap31. Probab=65.60 E-value=9.8 Score=17.73 Aligned_cols=19 Identities=26% Similarity=0.309 Sum_probs=6.6 Q ss_pred HHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999 Q gi|254780375|r 74 DIEQRVILLENHKKEYNLW 92 (175) Q Consensus 74 ~l~~r~~eLe~~~~ei~~~ 92 (175) ++.+..++|+..+.+++.+ T Consensus 162 el~~lk~el~~~~~d~eal 180 (192) T pfam05529 162 EIEKLKKELEEKDKDLEAL 180 (192) T ss_pred HHHHHHHHHHHHHHHHHHH T ss_conf 9999999999888779999 No 31 >KOG0979 consensus Probab=64.46 E-value=10 Score=17.60 Aligned_cols=57 Identities=19% Similarity=0.424 Sum_probs=24.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 99999999999999999999999999999999----9999999999999999999999519 Q gi|254780375|r 58 ERDYLSQKKVLEDLQKDIEQRVILLENHKKEY----NLWFQKYDSFIMSYNKNILDIYKKM 114 (175) Q Consensus 58 e~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei----~~~l~~~~~~~~~~~~~lv~iy~~M 114 (175) .++|..++++|..++.++......|+..++++ +.|+.+.++...+-..+.+..|++| T Consensus 862 vq~y~~r~~el~~l~~~~~~~~~~le~i~~kl~~~ke~w~~~le~~V~~In~~Fs~~F~~m 922 (1072) T KOG0979 862 VQQYEVREDELRELETKLEKLSEDLERIKDKLSDVKEVWLPKLEEMVEQINERFSQLFSSM 922 (1072) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 9999989999999986654555369999998766999988999999999999999987635 No 32 >PRK10803 hypothetical protein; Provisional Probab=63.76 E-value=11 Score=17.51 Aligned_cols=85 Identities=16% Similarity=0.083 Sum_probs=31.2 Q ss_pred HHHHHHHHHHHHHHCHH--HHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999841302--2101466778576899999997667999999999999999999999999999999999999 Q gi|254780375|r 13 RDMLSQLLFLLFFFLQG--FANQSYGDPTLVDREIQQYCTNVIDSVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYN 90 (175) Q Consensus 13 ~~~l~~~~~~l~~~~~~--~a~~~~~~~~~~~~ei~~~~~~~~~~~re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~ 90 (175) |..+..+.+.++...+. ||+-+-.+.-..+-|-.-..-+-.-.++.+.+..-++.|..++.+|.+--..+|...-+++ T Consensus 6 ~~~~~~~~~~~~~~~~~~a~a~apv~~~~~gs~e~Rl~~LEr~~~~~~~~~~qlq~Ql~~LQ~EV~~LRGqiEe~~~~l~ 85 (262) T PRK10803 6 RHHLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVTQLERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLN 85 (262) T ss_pred HHHHHHHHHHHHHHHHHHHCCCCCHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999986078770344376603786999999999999974279999999999999999999879999999999 Q ss_pred HHHHHHH Q ss_conf 9999999 Q gi|254780375|r 91 LWFQKYD 97 (175) Q Consensus 91 ~~l~~~~ 97 (175) .+.++.. T Consensus 86 ql~~rQr 92 (262) T PRK10803 86 QVVERQK 92 (262) T ss_pred HHHHHHH T ss_conf 9999999 No 33 >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Probab=62.60 E-value=11 Score=17.38 Aligned_cols=81 Identities=19% Similarity=0.179 Sum_probs=35.5 Q ss_pred HHHHHHHHHHHHHHH----CHHHHCCCCCCCCCCHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999841----302210146677857689999999766799-----99999999999999999999999999 Q gi|254780375|r 12 KRDMLSQLLFLLFFF----LQGFANQSYGDPTLVDREIQQYCTNVIDSV-----RERDYLSQKKVLEDLQKDIEQRVILL 82 (175) Q Consensus 12 ~~~~l~~~~~~l~~~----~~~~a~~~~~~~~~~~~ei~~~~~~~~~~~-----re~~l~~~e~eL~~le~~l~~r~~eL 82 (175) +++++++++.++++. ..+|+......+.-...++.....+..+.. -+..+..-......++.++++...++ T Consensus 3 kk~~~a~~~s~v~~s~~~~t~V~a~~~~~~i~~~ds~l~~~~~~~~~~q~ei~~L~~qi~~~~~k~~~~~~~i~~~~~ei 82 (265) T COG3883 3 KKILLAVLLSLVIISTAFLTTVFAALLSDKIQNQDSKLSELQKEKKNIQNEIESLDNQIEEIQSKIDELQKEIDQSKAEI 82 (265) T ss_pred HHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 48999999999999981100021335334777668899999999998999999999999999998887898888899999 Q ss_pred HHHHHHHHHH Q ss_conf 9999999999 Q gi|254780375|r 83 ENHKKEYNLW 92 (175) Q Consensus 83 e~~~~ei~~~ 92 (175) +.++.+|+.+ T Consensus 83 k~l~~eI~~~ 92 (265) T COG3883 83 KKLQKEIAEL 92 (265) T ss_pred HHHHHHHHHH T ss_conf 9999899999 No 34 >TIGR02976 phageshock_pspB phage shock protein B; InterPro: IPR009554 This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages . Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one .. Probab=60.79 E-value=12 Score=17.18 Aligned_cols=21 Identities=24% Similarity=0.207 Sum_probs=12.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999 Q gi|254780375|r 66 KVLEDLQKDIEQRVILLENHK 86 (175) Q Consensus 66 ~eL~~le~~l~~r~~eLe~~~ 86 (175) ++|...-.++++|+..||..= T Consensus 45 ~~L~~~A~Rl~~Ri~tLE~iL 65 (75) T TIGR02976 45 QELYAKADRLEERIDTLERIL 65 (75) T ss_pred HHHHHHHHHHHHHHHHHHHHH T ss_conf 999999989999999999987 No 35 >TIGR03052 PS_I_psaI photosystem I reaction center subunit VIII. Members of this protein family are PsaI, subunit VIII of the photosystem I reaction center. This protein is found in both the Cyanobacteria and the chloroplasts of plants, but is absent from non-oxygenic photosynthetic bacteria such as Rhodobacter sphaeroides. Species that contain photosystem I also contain photosystem II, which splits water and releases molecular oxygen. Probab=60.62 E-value=9 Score=17.97 Aligned_cols=23 Identities=22% Similarity=0.345 Sum_probs=19.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 88999998999999999999841 Q gi|254780375|r 4 LPIIYYYKKRDMLSQLLFLLFFF 26 (175) Q Consensus 4 ip~if~~~~~~~l~~~~~~l~~~ 26 (175) +|+||.=-.+++++++.+++.|- T Consensus 3 LPsifVPlvglvfPAv~m~llf~ 25 (31) T TIGR03052 3 LPSIFVPLVGLVFPAVFMALLFR 25 (31) T ss_pred CHHHHHHHHHHHHHHHHHHHHHH T ss_conf 50478998988899999999999 No 36 >PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Probab=58.31 E-value=13 Score=16.91 Aligned_cols=65 Identities=11% Similarity=0.065 Sum_probs=36.1 Q ss_pred HHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHC Q ss_conf 99999999999999999-999999999999999999999519989999999637989999999729 Q gi|254780375|r 74 DIEQRVILLENHKKEYN-LWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRL 138 (175) Q Consensus 74 ~l~~r~~eLe~~~~ei~-~~l~~~~~~~~~~~~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m 138 (175) +|++++.+|+....+-. ..-.+-...+.+..+.+-+||++++|=+-..+--.-+.....+.+..+ T Consensus 13 eLe~kI~eLk~~~~~~~~d~~~eI~~Le~k~~~l~k~iYsnLspw~~v~~aRhp~Rp~~~dyi~~~ 78 (318) T PRK05724 13 ELEAKIEELRALADESDVDISEEIERLEKKLEKLTKKIYANLTPWQKLQVARHPQRPYTLDYIELL 78 (318) T ss_pred HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCHHHHHHHH T ss_conf 999999999866315787889999999999999999998579999999996478999899999998 No 37 >TIGR03545 conserved hypothetical protein TIGR03545. This model represents a relatively rare but broadly distributed uncharacterized protein family, distributed in 1-2 percent of bacterial genomes, all of which have outer membranes. In many of these genomes, it is part of a two-gene pair. Probab=56.87 E-value=14 Score=16.76 Aligned_cols=24 Identities=4% Similarity=-0.015 Sum_probs=9.5 Q ss_pred HHHHHHHHHHHHCCHHHHHHHHHHC Q ss_conf 9999999999519989999999637 Q gi|254780375|r 102 SYNKNILDIYKKMDSDSAALQLEQI 126 (175) Q Consensus 102 ~~~~~lv~iy~~M~p~~AA~il~~m 126 (175) +++++|-..|. |++..+..+-..+ T Consensus 262 ~D~~~L~~~~~-l~~~~~~~l~~~L 285 (554) T TIGR03545 262 KDLNRLENLAA-INSGDLKNFAVDL 285 (554) T ss_pred HHHHHHHHHCC-CCCHHHHHHHHHH T ss_conf 67999997648-9801199999999 No 38 >TIGR02044 CueR Cu(I)-responsive transcriptional regulator; InterPro: IPR011789 This entry represents the copper-, silver- and gold- (I) responsive transcriptional activator of the gamma proteobacterial copper efflux system . This protein is a member of the MerR family of transcriptional activators and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-X7-Cys. This family also lacks a conserved cysteine at the N-terminal end of the dimerization helix which is required for the binding of divalent metals such as zinc; here it is replaced by a serine residue .; GO: 0003677 DNA binding, 0005507 copper ion binding, 0016563 transcription activator activity, 0045941 positive regulation of transcription. Probab=55.26 E-value=15 Score=16.60 Aligned_cols=26 Identities=12% Similarity=0.227 Sum_probs=22.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999999 Q gi|254780375|r 70 DLQKDIEQRVILLENHKKEYNLWFQK 95 (175) Q Consensus 70 ~le~~l~~r~~eLe~~~~ei~~~l~~ 95 (175) ..=++|++++.+|...++.+..|... T Consensus 86 ~k~~E~~~kI~eL~~m~~qL~~la~~ 111 (127) T TIGR02044 86 EKVAELERKISELQEMKDQLEELAEA 111 (127) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 88999999999998899999999985 No 39 >KOG0933 consensus Probab=55.17 E-value=15 Score=16.59 Aligned_cols=50 Identities=18% Similarity=0.186 Sum_probs=37.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 66799999999999999999999999999999999999999999999999 Q gi|254780375|r 52 VIDSVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIM 101 (175) Q Consensus 52 ~~~~~re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~ 101 (175) .+++.|++++...+++|+.+.+++++.-.+++.++.+++.+.-+.++... T Consensus 780 d~~~~re~rlkdl~keik~~k~~~e~~~~~~ek~~~e~e~l~lE~e~l~~ 829 (1174) T KOG0933 780 DAKANRERRLKDLEKEIKTAKQRAEESSKELEKRENEYERLQLEHEELEK 829 (1174) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 76665675799999999999999998777778889999999988999998 No 40 >PRK06569 F0F1 ATP synthase subunit B'; Validated Probab=53.90 E-value=16 Score=16.46 Aligned_cols=62 Identities=15% Similarity=0.141 Sum_probs=30.5 Q ss_pred HHHHHHHHHHHCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHH Q ss_conf 999999998413022101466778576899999997667999---------99999999999999999999 Q gi|254780375|r 16 LSQLLFLLFFFLQGFANQSYGDPTLVDREIQQYCTNVIDSVR---------ERDYLSQKKVLEDLQKDIEQ 77 (175) Q Consensus 16 l~~~~~~l~~~~~~~a~~~~~~~~~~~~ei~~~~~~~~~~~r---------e~~l~~~e~eL~~le~~l~~ 77 (175) .++++|++.++...|.--+.--+|....-++.....+.+... +.-+...+..|...+.+... T Consensus 10 ~sQifWL~itF~~ly~~~sk~~lPri~~~le~R~~~I~~dl~~A~~~k~eae~~~~~ye~~l~~Ak~eA~~ 80 (157) T PRK06569 10 YSQIFWLIVTFGLLYIFVYKFITPKAEEIFNNRQTNIQDNITQADTLTLEVEKLNKYYNEEIDKTNTEIDR 80 (157) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 89999999999999999999986048779998999999889999999999999999999999999999999 No 41 >PRK09039 hypothetical protein; Validated Probab=53.80 E-value=16 Score=16.45 Aligned_cols=18 Identities=44% Similarity=0.800 Sum_probs=11.0 Q ss_pred HHHHHHHHHHHHHCHHHH Q ss_conf 999999999984130221 Q gi|254780375|r 14 DMLSQLLFLLFFFLQGFA 31 (175) Q Consensus 14 ~~l~~~~~~l~~~~~~~a 31 (175) ++++.++|+++|.+..|. T Consensus 21 DamAtLLmViIFvL~IFv 38 (343) T PRK09039 21 DALSTLLLVIMFLLTVFV 38 (343) T ss_pred HHHHHHHHHHHHHHHHHH T ss_conf 999999999999999999 No 42 >PRK00708 sec-independent translocase; Provisional Probab=53.08 E-value=16 Score=16.38 Aligned_cols=27 Identities=15% Similarity=0.330 Sum_probs=12.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999997667999999999999999999 Q gi|254780375|r 46 QQYCTNVIDSVRERDYLSQKKVLEDLQ 72 (175) Q Consensus 46 ~~~~~~~~~~~re~~l~~~e~eL~~le 72 (175) .+|.....+..|+.+|+.-+++++.++ T Consensus 44 ~efq~~~de~~re~ELdd~rK~i~~a~ 70 (197) T PRK00708 44 GEFRRQFDEALREAELDDVKQTIDDAR 70 (197) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999999999999999987 No 43 >cd03687 Dehydratase_LU Dehydratase large subunit. This family contains the large (alpha) subunit of B12-dependent glycerol dehydratases (GDHs) and B12-dependent diol dehydratases (DDHs). GDH is isofunctional with DDH. These enzymes can each catalyze the conversion of 1,2-propanediol, glycerol, and 1,2-ethanediol to the corresponding aldehydes via a coenzyme B12 (adenosylcobalamin)-dependent radical mechanism. Both enzymes exhibit a subunit composition of alpha2beta2gamma2. The enzymes differ in substrate specificity; glycerol is the preferred substrate for GDH and 1,2-propanediol for DDH. GDH shows almost equal affinity for both (R) and (S)-isomers while DDH prefers the (S) isomer. GDH plays a key role in the dihydroxyacetone (DHA) pathway and DDH in the anaerobic degradation of 1,2-diols. The radical mechanism has been well studied for Klebsiella oxytoca DDH and involves binding of 1,2-propanediol to the enzyme to induce hemolytic cleavage of the Co-C5' bond of the coenzyme to form co Probab=52.64 E-value=16 Score=16.33 Aligned_cols=39 Identities=10% Similarity=0.169 Sum_probs=30.3 Q ss_pred HHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHH Q ss_conf 999999951998999999963798999999972998999 Q gi|254780375|r 105 KNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQS 143 (175) Q Consensus 105 ~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~ 143 (175) +.++++...|.|.+.+++++.|+.-+..--+.+|.+|+. T Consensus 92 ~ei~~l~~~~TPAK~~eVv~~ln~vEmmma~qKMRaRrt 130 (545) T cd03687 92 EEIVRLTTAMTPAKLVEVVSQMNVVEMMMAMQKMRARRT 130 (545) T ss_pred HHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHHCCCC T ss_conf 999998705887999999973579999999997415479 No 44 >pfam02286 Dehydratase_LU Dehydratase large subunit. This family contains the large subunit of the trimeric diol dehydratases and glycerol dehydratases. These enzymes are produced by some enterobacteria in response to growth substances. Probab=51.76 E-value=17 Score=16.24 Aligned_cols=39 Identities=13% Similarity=0.185 Sum_probs=30.9 Q ss_pred HHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHH Q ss_conf 999999951998999999963798999999972998999 Q gi|254780375|r 105 KNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQS 143 (175) Q Consensus 105 ~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~ 143 (175) +.++++...|.|.+.+++++.|+.-+..--+.+|.+|+. T Consensus 99 ~ei~~l~~~~TPAK~~eVv~~ln~vEmmma~qKMRaRrt 137 (554) T pfam02286 99 EEIVRLTTGMTPAKLAEVVSQLNVVEMMMAMQKMRARRT 137 (554) T ss_pred HHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHHCCCC T ss_conf 999998705885999999973689999999997305479 No 45 >COG1792 MreC Cell shape-determining protein [Cell envelope biogenesis, outer membrane] Probab=51.60 E-value=17 Score=16.23 Aligned_cols=51 Identities=14% Similarity=0.206 Sum_probs=29.1 Q ss_pred HHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999976679999-99999999999999999999999999999999999999 Q gi|254780375|r 46 QQYCTNVIDSVRE-RDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKY 96 (175) Q Consensus 46 ~~~~~~~~~~~re-~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~ 96 (175) ..+|....+...+ .++..+.+.|+..-+++.+...+++.+++|+..|-.-. T Consensus 55 ~~~v~~~~~~~~~~~~~~~en~~Lk~~l~~~~~~~~~~~~l~~EN~~Lr~lL 106 (284) T COG1792 55 FEFVDGVLEFLKSLKDLALENEELKKELAELEQLLEEVESLEEENKRLKELL 106 (284) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999768889887788888779999999999999998999999999989973 No 46 >PRK09174 F0F1 ATP synthase subunit B'; Validated Probab=50.84 E-value=17 Score=16.15 Aligned_cols=61 Identities=15% Similarity=0.069 Sum_probs=31.4 Q ss_pred HHHHHHHHHHHCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHH Q ss_conf 999999998413022101466778576899999997667999---------9999999999999999999 Q gi|254780375|r 16 LSQLLFLLFFFLQGFANQSYGDPTLVDREIQQYCTNVIDSVR---------ERDYLSQKKVLEDLQKDIE 76 (175) Q Consensus 16 l~~~~~~l~~~~~~~a~~~~~~~~~~~~ei~~~~~~~~~~~r---------e~~l~~~e~eL~~le~~l~ 76 (175) .+.++|+++++...|.--+.--.|.+.+-++.....|.+... +.-+...++.|...+.+-. T Consensus 53 ~sQifWL~I~F~~lY~~~sk~~lPrI~~vLe~R~~~I~~DLe~Ae~lk~EAe~~~a~Ye~~LaeAR~eA~ 122 (204) T PRK09174 53 ASQLLWLAITFGLFYLFLSRVILPRIGGIIETRRDRIAQDLDQAARLKQEADAAVAAYEQELAQARSKAA 122 (204) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 8999999999999999999997603777999999999879999999999999999999999999999999 No 47 >KOG0646 consensus Probab=50.73 E-value=17 Score=16.14 Aligned_cols=45 Identities=11% Similarity=0.036 Sum_probs=34.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHH Q ss_conf 999999999999999999999999999999999999995199899 Q gi|254780375|r 74 DIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDS 118 (175) Q Consensus 74 ~l~~r~~eLe~~~~ei~~~l~~~~~~~~~~~~~lv~iy~~M~p~~ 118 (175) +..+...+.+.++.|+++.++...+..++..+.+.+||++|.-.- T Consensus 429 ~s~~~e~e~~rl~~e~k~~~q~~~~~~k~~~~~~~~i~ee~~~~~ 473 (476) T KOG0646 429 RSLELEAEVDRLKTELKRSLQALTHAYKELRNMLEEIYEEHQQML 473 (476) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 456668889999999999999999998606778999999998754 No 48 >pfam04568 IATP Mitochondrial ATPase inhibitor, IATP. ATP synthase inhibitor prevents the enzyme from switching to ATP hydrolysis during collapse of the electrochemical gradient, for example during oxygen deprivation ATP synthase inhibitor forms a one to one complex with the F1 ATPase, possibly by binding at the alpha-beta interface. It is thought to inhibit ATP synthesis by preventing the release of ATP. The minimum inhibitory region for bovine inhibitor is from residues 39 to 72. The inhibitor has two oligomeric states, dimer (the active state) and tetramer. At low pH, the inhibitor forms a dimer via antiparallel coiled coil interactions between the C terminal regions of two monomers. At high pH, the inhibitor forms tetramers and higher oligomers by coiled coil interactions involving the N terminus and inhibitory region, thus preventing the inhibitory activity. Probab=48.52 E-value=19 Score=15.93 Aligned_cols=36 Identities=25% Similarity=0.462 Sum_probs=24.5 Q ss_pred HHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 79999999999--9999999999999999999999999 Q gi|254780375|r 54 DSVRERDYLSQ--KKVLEDLQKDIEQRVILLENHKKEY 89 (175) Q Consensus 54 ~~~re~~l~~~--e~eL~~le~~l~~r~~eLe~~~~ei 89 (175) +++.|..|-.| +..|.+|.+.+.++.++|+.++++| T Consensus 52 E~A~E~~y~rq~ekEqL~~Lk~~l~~q~~~i~~le~~I 89 (90) T pfam04568 52 EAAQEEEYFRQKEKEQLAALKEKLEEHKKEIEELEKHI 89 (90) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 88728899999999999999999999999999998744 No 49 >pfam04012 PspA_IM30 PspA/IM30 family. This family includes PspA a protein that suppresses sigma54-dependent transcription. The PspA protein, a negative regulator of the Escherichia coli phage shock psp operon, is produced when virulence factors are exported through secretins in many Gram-negative pathogenic bacteria and its homologue in plants, VIPP1, plays a critical role in thylakoid biogenesis, essential for photosynthesis. Activation of transcription by the enhancer-dependent bacterial sigma(54) containing RNA polymerase occurs through ATP hydrolysis-driven protein conformational changes enabled by activator proteins that belong to the large AAA(+) mechanochemical protein family. It has been shown that PspA directly and specifically acts upon and binds to the AAA(+) domain of the PspF transcription activator. Probab=48.11 E-value=19 Score=15.89 Aligned_cols=28 Identities=14% Similarity=0.192 Sum_probs=18.2 Q ss_pred HHHHHHHHHHHHCCHHHHHHHHHHCCHH Q ss_conf 9999999999519989999999637989 Q gi|254780375|r 102 SYNKNILDIYKKMDSDSAALQLEQIDPD 129 (175) Q Consensus 102 ~~~~~lv~iy~~M~p~~AA~il~~m~~d 129 (175) .....+.....++++..|..-|+.|... T Consensus 146 ~a~~~v~~~~~~~~~~~a~~~fer~eek 173 (220) T pfam04012 146 KAQEAVNTSLGSASTESATDSFERIEEK 173 (220) T ss_pred HHHHHHHHHHHCCCCCCHHHHHHHHHHH T ss_conf 9999999987379956389899999999 No 50 >PRK11546 zraP zinc resistance protein; Provisional Probab=46.80 E-value=20 Score=15.76 Aligned_cols=90 Identities=17% Similarity=0.070 Sum_probs=39.5 Q ss_pred HHHHHHHHHHHHHCHHHHCCC-----CCCCCCCHHH--HHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999984130221014-----6677857689--99999976679---9999999999999999999999999999 Q gi|254780375|r 14 DMLSQLLFLLFFFLQGFANQS-----YGDPTLVDRE--IQQYCTNVIDS---VRERDYLSQKKVLEDLQKDIEQRVILLE 83 (175) Q Consensus 14 ~~l~~~~~~l~~~~~~~a~~~-----~~~~~~~~~e--i~~~~~~~~~~---~re~~l~~~e~eL~~le~~l~~r~~eLe 83 (175) .++..+..+.++.-+.++... -+.-|.+++. .-+-.-+...+ .-.+++..++.||.+|-..-+--.+.+. T Consensus 9 ~~l~~~~~~~~~~~~a~a~~~~~~~~~~~~~LT~EQQa~~qkL~~eF~~eTa~LRqqL~aKr~ElNALL~at~PD~~kI~ 88 (139) T PRK11546 9 LVLMALSALAMGSGSAFAHNGHGMWQQGAAPLTTEQQAAAQKIHNDFYAQTSALRQQLVSKRYEYNALLTANPPDSSKIN 88 (139) T ss_pred HHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHH T ss_conf 99999999998035231257877778888988999999999999999999999999999989999999806997799999 Q ss_pred HHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999 Q gi|254780375|r 84 NHKKEYNLWFQKYDSFIMSY 103 (175) Q Consensus 84 ~~~~ei~~~l~~~~~~~~~~ 103 (175) +.-+|+..+-...++..-+. T Consensus 89 avakEis~LR~kl~e~rv~~ 108 (139) T PRK11546 89 AVAKEMETLRQSLDEQRVKR 108 (139) T ss_pred HHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999 No 51 >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Probab=45.28 E-value=21 Score=15.61 Aligned_cols=36 Identities=19% Similarity=0.146 Sum_probs=15.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999999999999 Q gi|254780375|r 60 DYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQK 95 (175) Q Consensus 60 ~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~ 95 (175) ++..++.+++....+++....+++.++.+++...+. T Consensus 522 ~l~~~~~~~e~~~~~~~~~~~e~~~~~~~l~~~~~~ 557 (780) T PRK00409 522 SLEELERELEEKAEEAEKLLKEAEKLKEELEEQKEK 557 (780) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999999999999999999999999999 No 52 >PRK00295 hypothetical protein; Provisional Probab=42.97 E-value=23 Score=15.39 Aligned_cols=45 Identities=9% Similarity=0.153 Sum_probs=37.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999999999999999999999 Q gi|254780375|r 56 VRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFI 100 (175) Q Consensus 56 ~re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~ 100 (175) .-|-+++-|+..++.|...+-++...++.++..+..+.++.++.. T Consensus 9 dLE~rlAfQedtIe~LN~~l~~Qq~~id~L~~q~~~l~~rl~~~~ 53 (68) T PRK00295 9 ELESRQAFQDDTIQALNDVVVEQQRVIERLQLQMAALIKRQEEMV 53 (68) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999989999999999999999999999999999999999988 No 53 >cd02434 Nodulin-21_like_3 Nodulin-21 and CCC1-related protein family. Nodulin-21_like_3: This is a family of proteins closely related to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation. This family is also related to CCC1, a yeast vacuole transmembrane protein that functions as an iron and manganese transporter. Probab=42.62 E-value=23 Score=15.35 Aligned_cols=13 Identities=15% Similarity=0.279 Sum_probs=5.9 Q ss_pred CCHHHHHHHHHHC Q ss_conf 9989999999637 Q gi|254780375|r 114 MDSDSAALQLEQI 126 (175) Q Consensus 114 M~p~~AA~il~~m 126 (175) |+|+.|..+.+.+ T Consensus 95 ~~~~~A~~v~~~l 107 (225) T cd02434 95 LSEEVADQVVELL 107 (225) T ss_pred CCHHHHHHHHHHH T ss_conf 9989999999999 No 54 >KOG2150 consensus Probab=42.33 E-value=23 Score=15.33 Aligned_cols=30 Identities=17% Similarity=0.375 Sum_probs=21.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999999 Q gi|254780375|r 67 VLEDLQKDIEQRVILLENHKKEYNLWFQKY 96 (175) Q Consensus 67 eL~~le~~l~~r~~eLe~~~~ei~~~l~~~ 96 (175) .=++++.+|...|+.|+.++.+|+.|+... T Consensus 39 qkeK~e~DLKkEIKKLQRlRdQIKtW~ss~ 68 (575) T KOG2150 39 QKEKLESDLKKEIKKLQRLRDQIKTWQSSS 68 (575) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCC T ss_conf 778888899999999999999998641440 No 55 >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Probab=42.00 E-value=24 Score=15.29 Aligned_cols=29 Identities=14% Similarity=0.119 Sum_probs=23.5 Q ss_pred HHHHHHHHHHHHHCCHHHHHHHHHHCCHH Q ss_conf 99999999999519989999999637989 Q gi|254780375|r 101 MSYNKNILDIYKKMDSDSAALQLEQIDPD 129 (175) Q Consensus 101 ~~~~~~lv~iy~~M~p~~AA~il~~m~~d 129 (175) .+...++.+.+..+++..+..-|+.|... T Consensus 146 akA~~~v~~~~~~~s~~sa~~~fer~e~k 174 (225) T COG1842 146 AKAQEKVNRSLGGGSSSSAMAAFERMEEK 174 (225) T ss_pred HHHHHHHHHHHCCCCCHHHHHHHHHHHHH T ss_conf 99999999871378933369999999998 No 56 >PRK10361 DNA recombination protein RmuC; Provisional Probab=41.73 E-value=24 Score=15.27 Aligned_cols=16 Identities=0% Similarity=0.112 Sum_probs=8.1 Q ss_pred HHHHHHHHHHHHHCHH Q ss_conf 9999999999841302 Q gi|254780375|r 14 DMLSQLLFLLFFFLQG 29 (175) Q Consensus 14 ~~l~~~~~~l~~~~~~ 29 (175) ++++.++.++||.... T Consensus 9 ~i~al~G~~igwl~~~ 24 (475) T PRK10361 9 AVIALVGVAIGWLFAS 24 (475) T ss_pred HHHHHHHHHHHHHHHH T ss_conf 9999999999999999 No 57 >CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Probab=41.62 E-value=24 Score=15.26 Aligned_cols=65 Identities=11% Similarity=0.076 Sum_probs=33.5 Q ss_pred HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHC Q ss_conf 999999999999999999-99999999999999999999519989999999637989999999729 Q gi|254780375|r 74 DIEQRVILLENHKKEYNL-WFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILMRL 138 (175) Q Consensus 74 ~l~~r~~eLe~~~~ei~~-~l~~~~~~~~~~~~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~~m 138 (175) +++.++.+|+..-.+-.. .-.+....+.+..+-.-+||+++.|=+...+--.-+.....+.+..+ T Consensus 17 eLe~ki~eL~~~~~~~~~~~~~ei~~Le~k~~~~~~~iy~nLt~wq~vq~aRhp~RP~~~dyi~~~ 82 (322) T CHL00198 17 ELEQQIEELSKLAPKNDVVVNNKLKSFQRKLTILKKEIFYGLTPLQKLQLARHPERPTTLDYIPYI 82 (322) T ss_pred HHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCHHHHHHHH T ss_conf 999999999734104675679999999999999999998579999999986289999889999998 No 58 >CHL00186 psaI photosystem I subunit VIII; Validated Probab=40.95 E-value=25 Score=15.19 Aligned_cols=25 Identities=16% Similarity=0.236 Sum_probs=19.7 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 7889999989999999999998413 Q gi|254780375|r 3 LLPIIYYYKKRDMLSQLLFLLFFFL 27 (175) Q Consensus 3 ~ip~if~~~~~~~l~~~~~~l~~~~ 27 (175) -+|+||.--+|.+++++.+...|.- T Consensus 5 ~lPSIlVPlVGLvFPAiaMAslfly 29 (36) T CHL00186 5 NLPSIFVPLVGLVFPAIAMASLFLY 29 (36) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHH T ss_conf 0635788767788899999999985 No 59 >cd04787 HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain of putative Heavy Metal Resistance transcription regulators. Putative helix-turn-helix (HTH) heavy metal resistance transcription regulators (HMRTR), unknown subgroup. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to heavy metal stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules, such as, metal ions, drugs, and organic substrates. This subgroup lacks one of the c Probab=39.99 E-value=25 Score=15.10 Aligned_cols=35 Identities=11% Similarity=0.239 Sum_probs=25.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999999999999999 Q gi|254780375|r 64 QKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDS 98 (175) Q Consensus 64 ~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~ 98 (175) ..+.|....+++++++++|+..++.++..+...++ T Consensus 80 ~~~ll~~~l~~i~~kI~eL~~~r~~L~~~l~~~~~ 114 (133) T cd04787 80 VRRLIEQRLAETERRIKELLKLRDRMQQAVSQWQQ 114 (133) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999999999999999985 No 60 >pfam00796 PSI_8 Photosystem I reaction centre subunit VIII. Probab=39.81 E-value=14 Score=16.80 Aligned_cols=23 Identities=22% Similarity=0.374 Sum_probs=16.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 88999998999999999999841 Q gi|254780375|r 4 LPIIYYYKKRDMLSQLLFLLFFF 26 (175) Q Consensus 4 ip~if~~~~~~~l~~~~~~l~~~ 26 (175) +|+||.=..+.+++++.+++.|. T Consensus 1 LPsi~VPlVGlv~Pav~m~llf~ 23 (26) T pfam00796 1 LPSIFVPLVGLVFPAVAMALLFL 23 (26) T ss_pred CCCEEHHHHHHHHHHHHHHHHHH T ss_conf 98332016877789999999998 No 61 >COG2900 SlyX Uncharacterized protein conserved in bacteria [Function unknown] Probab=39.56 E-value=26 Score=15.06 Aligned_cols=45 Identities=13% Similarity=0.264 Sum_probs=33.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999999999999999999999 Q gi|254780375|r 57 RERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIM 101 (175) Q Consensus 57 re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~ 101 (175) -+-+++-|++.|+.+...+.++...++..+..++.+.++..+... T Consensus 13 LE~r~AfQE~tieeLn~~laEq~~~i~k~q~qlr~L~~kl~~~~~ 57 (72) T COG2900 13 LEIRLAFQEQTIEELNDALAEQQLVIDKLQAQLRLLTEKLKDLQP 57 (72) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 999999999999999999999999999999999999999985132 No 62 >pfam11853 DUF3373 Protein of unknown function (DUF3373). This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 472 to 574 amino acids in length. Probab=39.41 E-value=26 Score=15.04 Aligned_cols=18 Identities=22% Similarity=0.394 Sum_probs=7.2 Q ss_pred HHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999 Q gi|254780375|r 68 LEDLQKDIEQRVILLENH 85 (175) Q Consensus 68 L~~le~~l~~r~~eLe~~ 85 (175) +++|+++|++..+++.++ T Consensus 33 I~~L~~ql~eLk~~~~~~ 50 (485) T pfam11853 33 IEALKKELAELKAQLKDL 50 (485) T ss_pred HHHHHHHHHHHHHHHHHH T ss_conf 999999999999999987 No 63 >pfam08564 CDC37_C Cdc37 C terminal domain. Cdc37 is a protein required for the activity of numerous eukaryotic protein kinases. This domains corresponds to the C terminal domain whose function is unclear. It is found C terminal to the Hsp90 chaperone (Heat shocked protein 90) binding domain pfam08565 and the N terminal kinase binding domain of Cdc37 pfam03234. Probab=39.28 E-value=26 Score=15.03 Aligned_cols=41 Identities=12% Similarity=0.201 Sum_probs=16.1 Q ss_pred HHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHH Q ss_conf 999637989999999729989999999629999999999999 Q gi|254780375|r 121 LQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVV 162 (175) Q Consensus 121 ~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~l 162 (175) .||+.++++.-.. +..=+-+..-.+|++|+++.|..+...+ T Consensus 9 evFeslP~emq~a-~es~dld~ln~vl~~M~~eeAe~~~~~~ 49 (87) T pfam08564 9 EVFESLPPELQKA-FETKDLDEVNKVLAKMPVEEAEYHMERL 49 (87) T ss_pred HHHHHCCHHHHHH-HHHCCHHHHHHHHHCCCHHHHHHHHHHH T ss_conf 9998689999999-9857899999999809999999999998 No 64 >cd01282 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 3). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates. Probab=39.15 E-value=26 Score=15.02 Aligned_cols=31 Identities=13% Similarity=0.233 Sum_probs=22.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999999999999999 Q gi|254780375|r 63 SQKKVLEDLQKDIEQRVILLENHKKEYNLWF 93 (175) Q Consensus 63 ~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l 93 (175) .....|....+++++++++|+..+..++.++ T Consensus 81 ~~~~~l~~kl~ei~~~I~~L~~lr~~L~~~l 111 (112) T cd01282 81 DLLAVLRRELARIDRQIADLTRSRDRLDAYL 111 (112) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999999999975 No 65 >pfam02979 NHase_alpha Nitrile hydratase, alpha chain. Probab=37.16 E-value=28 Score=14.82 Aligned_cols=58 Identities=12% Similarity=0.205 Sum_probs=44.7 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCHHHHHHHHHHC--CHHHHHHHHHH Q ss_conf 9999999999999999999999999999999951-9989999999637--98999999972 Q gi|254780375|r 80 ILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKK-MDSDSAALQLEQI--DPDISSHILMR 137 (175) Q Consensus 80 ~eLe~~~~ei~~~l~~~~~~~~~~~~~lv~iy~~-M~p~~AA~il~~m--~~d~aa~iL~~ 137 (175) .+.+.+...++.++-++--+....++.+++.|++ +.|.+.|.+...= |++....+|.. T Consensus 4 s~~~~r~~Ale~lLieKGli~~~~id~~ie~~e~~~gP~~GArvVArAW~Dp~fk~~Ll~D 64 (189) T pfam02979 4 SEFAARVKALEELLIEKGLITPAAVDRIIETYETKVGPRNGARVVARAWVDPEFKARLLAD 64 (189) T ss_pred CHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCHHHHHHHHHC T ss_conf 4699999999999998599999999999999874249842388999986699999999978 No 66 >pfam07374 DUF1492 Protein of unknown function (DUF1492). This family consists of several hypothetical, highly conserved Streptococcal and related phage proteins of around 100 residues in length. The function of this family is unknown. It appears to be distantly related to pfam08281. Probab=37.04 E-value=28 Score=14.81 Aligned_cols=62 Identities=16% Similarity=0.002 Sum_probs=40.7 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHH Q ss_conf 999999999999999999999999999999999999999999999999995199899999996 Q gi|254780375|r 62 LSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLE 124 (175) Q Consensus 62 ~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~~~~~~lv~iy~~M~p~~AA~il~ 124 (175) +..--+|-.+..+++++++++-+.+.|+..++...+......+-+++ +...|...++++.|+ T Consensus 21 ed~~v~l~~~kE~i~~~i~e~ik~r~El~rlI~~l~np~~RtvL~m~-Yid~~~~~~v~e~l~ 82 (100) T pfam07374 21 DDVYVELIVMKEAIEQDTAEAIKRKLELGRLIDKLENPDSRTILRMV-YIDKMTVWQVCDKLN 82 (100) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHEEE-EECCCCHHHHHHHHC T ss_conf 66999999999999999999999999999999845780221311143-443474999999976 No 67 >PRK10698 phage shock protein PspA; Provisional Probab=36.94 E-value=28 Score=14.80 Aligned_cols=62 Identities=15% Similarity=0.126 Sum_probs=27.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------HHHHHHHHHCCHHHHHHHHHHCCH Q ss_conf 99999999999999999999999999999999999999------------999999951998999999963798 Q gi|254780375|r 67 VLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYN------------KNILDIYKKMDSDSAALQLEQIDP 128 (175) Q Consensus 67 eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~~~~------------~~lv~iy~~M~p~~AA~il~~m~~ 128 (175) .+..++.+++..-..++.++..+..+-.+..+...+.. .++-+.....+...+-.-|+.|.. T Consensus 100 ~~~~l~~q~~~~~~~~~~L~~~l~~L~~k~~e~k~k~~~L~AR~~~A~a~~~v~~~l~~~~~~~a~~~fer~E~ 173 (222) T PRK10698 100 LIATLEHEVTLVDDTLARMKKEIGELENKLSETRARQQALMLRHQAASSSRDVRRQLDSGKLDEAMARFESFER 173 (222) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH T ss_conf 99999999999999999999999999999999999999999988889999999987516885419999999999 No 68 >cd04783 HTH_MerR1 Helix-Turn-Helix DNA binding domain of the MerR1 transcription regulator. Helix-turn-helix (HTH) transcription regulator MerR1. MerR1 transcription regulators, such as Tn21 MerR and Tn501 MerR, mediate response to mercury exposure in eubacteria. These proteins are comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain winged HTH motifs that mediate DNA binding, while the C-terminal domains have three conserved cysteines that define a mercury binding site. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Probab=35.95 E-value=29 Score=14.70 Aligned_cols=31 Identities=6% Similarity=0.242 Sum_probs=24.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999999999999999 Q gi|254780375|r 65 KKVLEDLQKDIEQRVILLENHKKEYNLWFQK 95 (175) Q Consensus 65 e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~ 95 (175) ..-+.....++++++.+|+..+..+..++.+ T Consensus 79 ~~~l~~~~~~i~~~I~~L~~~~~~L~~l~~~ 109 (126) T cd04783 79 RELAEQKLAEVDEKIADLQRMRASLQELVSQ 109 (126) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999999999985 No 69 >PRK10780 periplasmic chaperone; Provisional Probab=35.53 E-value=30 Score=14.66 Aligned_cols=64 Identities=14% Similarity=0.217 Sum_probs=29.7 Q ss_pred HHHHHHHHHHHHCHHHHCCCCCCCCCCH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999998413022101466778576-----89999999766799999999999999999999999999999 Q gi|254780375|r 15 MLSQLLFLLFFFLQGFANQSYGDPTLVD-----REIQQYCTNVIDSVRERDYLSQKKVLEDLQKDIEQRVILLE 83 (175) Q Consensus 15 ~l~~~~~~l~~~~~~~a~~~~~~~~~~~-----~ei~~~~~~~~~~~re~~l~~~e~eL~~le~~l~~r~~eLe 83 (175) ++.++++.+++..+..|.+ .+.++. .+.+++ .-+...-+.++..+..+|+.++.+++.....++ T Consensus 4 ~l~~~~l~l~l~~~a~Aa~---KIgvVd~~~i~~~~pq~--~~a~~~Le~ef~~r~~eL~~~~~~lq~k~~k~~ 72 (161) T PRK10780 4 WLLAAGLGLALATSAQAAD---KIAIVNMGSLFQQVAQK--TGVSNTLENEFKGRASELQRMETDLQAKMQKLQ 72 (161) T ss_pred HHHHHHHHHHHHHHHHHHH---CEEEEEHHHHHHHCHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999998588887753---54553299999879899--999999999986799999999999999999988 No 70 >cd04770 HTH_HMRTR Helix-Turn-Helix DNA binding domain of Heavy Metal Resistance transcription regulators. Helix-turn-helix (HTH) heavy metal resistance transcription regulators (HMRTR): MerR1 (mercury), CueR (copper), CadR (cadmium), PbrR (lead), ZntR (zinc), and other related proteins. These transcription regulators mediate responses to heavy metal stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates. Probab=35.11 E-value=30 Score=14.62 Aligned_cols=33 Identities=15% Similarity=0.266 Sum_probs=25.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999999999 Q gi|254780375|r 63 SQKKVLEDLQKDIEQRVILLENHKKEYNLWFQK 95 (175) Q Consensus 63 ~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~ 95 (175) .....|.....+|++++++|+..+..+..++.. T Consensus 79 ~~~~~l~~~~~~i~~~i~~L~~~~~~L~~l~~~ 111 (123) T cd04770 79 EVRALLEEKLAEVEAKIAELQALRAELAGLLSA 111 (123) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999999999999999999999984 No 71 >TIGR00400 mgtE magnesium transporter; InterPro: IPR006669 This is the MgtE family of magnesium transporters. All the archaebacterial and eukaryotic examples have two copies of the integral membrane region. This suggests that the eubacterial examples may act as dimers. Members of this family probably transport Mg^2+ or other divalent cations into the cell. The alignment contains two highly conserved aspartates that may be involved in cation binding.; GO: 0008324 cation transmembrane transporter activity, 0006812 cation transport. Probab=34.66 E-value=31 Score=14.57 Aligned_cols=51 Identities=12% Similarity=0.242 Sum_probs=23.3 Q ss_pred HHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHH Q ss_conf 951998999999963798999999972998999999962999999999999 Q gi|254780375|r 111 YKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNV 161 (175) Q Consensus 111 y~~M~p~~AA~il~~m~~d~aa~iL~~m~~~~~a~IL~~M~p~~Aa~it~~ 161 (175) ........+...+++++.|+.+.++..++.+.....+..+..+....+... T Consensus 79 ~~~~~~~~~~~~~~~~~~dd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 129 (460) T TIGR00400 79 LNDFGNPEVLELLNELDPDDLVDLLEELPAEVVEQLLASLSEEERKAVNLL 129 (460) T ss_pred HHHCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 753043367888651370268999873028999999864212356788887 No 72 >PRK00736 hypothetical protein; Provisional Probab=34.47 E-value=31 Score=14.55 Aligned_cols=45 Identities=18% Similarity=0.250 Sum_probs=36.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999999999999999999999 Q gi|254780375|r 56 VRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFI 100 (175) Q Consensus 56 ~re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~ 100 (175) .-|-+++.|.+.++.|...|.++-+.++.++..+..+..+..+.. T Consensus 9 ~LEi~lAhQ~~tIeeLs~~va~Qwk~Id~L~r~l~~L~eR~~~le 53 (68) T PRK00736 9 ELEIRVAEQEKTIEELSDQLAEQWKTVEQMRKKLDALTERFLSLE 53 (68) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999979988999999999999999999999999999999988 No 73 >pfam10526 NADH_ub_rd_NUML NADH-ubiquinone reductase complex 1 MLRQ subunit. This subunit appears to be a recent vertebrate addition to the MADH-ubiquinone reductase complex 1, acting within the membrane. its exact function is not known, but it is highly expressed in muscle and neural tissue, indicative of a role in ATP generation. Probab=32.61 E-value=33 Score=14.36 Aligned_cols=23 Identities=22% Similarity=0.428 Sum_probs=13.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 788999998999999999999841 Q gi|254780375|r 3 LLPIIYYYKKRDMLSQLLFLLFFF 26 (175) Q Consensus 3 ~ip~if~~~~~~~l~~~~~~l~~~ 26 (175) |||+++++-.+ +..+.++++-++ T Consensus 13 LIPLfv~ig~g-~~gA~~y~~rla 35 (80) T pfam10526 13 LIPLFVFIGAG-ATGATLYLLRLA 35 (80) T ss_pred HHHHHHHHHCC-HHHHHHHHHHHH T ss_conf 32489999413-889999999998 No 74 >cd04776 HTH_GnyR Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR. Putative helix-turn-helix (HTH) regulatory protein, GnyR, and other related proteins. GnyR belongs to the gnyRDBHAL cluster, which is involved in acyclic isoprenoid degradation in Pseudomonas aeruginosa. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules. Probab=32.57 E-value=33 Score=14.36 Aligned_cols=35 Identities=23% Similarity=0.336 Sum_probs=18.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999999999999999 Q gi|254780375|r 68 LEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMS 102 (175) Q Consensus 68 L~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~~ 102 (175) +...-+.+++++.+|+..+++++.++...+...+. T Consensus 78 l~~~l~~l~~~i~~Le~~~~~L~~~l~~L~~~~~~ 112 (118) T cd04776 78 LEKMLEKIEKRRAELEQQRRDIDAALAELDAAEER 112 (118) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999999999999999999 No 75 >PRK09514 zntR zinc-responsive transcriptional regulator; Provisional Probab=32.50 E-value=34 Score=14.35 Aligned_cols=31 Identities=10% Similarity=0.282 Sum_probs=24.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999999999999999 Q gi|254780375|r 65 KKVLEDLQKDIEQRVILLENHKKEYNLWFQK 95 (175) Q Consensus 65 e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~ 95 (175) ++.+...-.+|++++++|+.++..+..|... T Consensus 83 ~~l~~~kl~~i~~rI~eLq~l~~~L~~l~~~ 113 (140) T PRK09514 83 KGIVDEKLAEVEAKIAELQHMRRSLQRLNDA 113 (140) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999999999986 No 76 >pfam03255 ACCA Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit. Acetyl co-enzyme A carboxylase carboxyltransferase is composed of an alpha and beta subunit. Probab=32.42 E-value=34 Score=14.34 Aligned_cols=63 Identities=10% Similarity=0.077 Sum_probs=31.9 Q ss_pred HHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHH Q ss_conf 99999999999999999-9999999999999999999995199899999996379899999997 Q gi|254780375|r 74 DIEQRVILLENHKKEYN-LWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDPDISSHILM 136 (175) Q Consensus 74 ~l~~r~~eLe~~~~ei~-~~l~~~~~~~~~~~~~lv~iy~~M~p~~AA~il~~m~~d~aa~iL~ 136 (175) +++.++.+|+..-..-. ..-.+....+.+..+-+-+||+++.|=+-..+=-.=+.....+.+. T Consensus 11 ele~kI~eLk~~~~~~~~d~~~eI~~Le~k~~~~~~~iys~LtpWQkVqvARHP~RP~t~DYI~ 74 (145) T pfam03255 11 ELEAKIDELRKLARKNDVDVSDEIHRLEKKLDKLKREIYSNLTPWQRVQLARHPDRPTTLDYIE 74 (145) T ss_pred HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCHHHHHH T ss_conf 9999999998475335766899999999999999999996799999999874878886999999 No 77 >COG5665 NOT5 CCR4-NOT transcriptional regulation complex, NOT5 subunit [Transcription] Probab=31.63 E-value=35 Score=14.26 Aligned_cols=29 Identities=28% Similarity=0.658 Sum_probs=19.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999999999 Q gi|254780375|r 69 EDLQKDIEQRVILLENHKKEYNLWFQKYD 97 (175) Q Consensus 69 ~~le~~l~~r~~eLe~~~~ei~~~l~~~~ 97 (175) ++|+.++...|+.|+..+.+|+.|+-..+ T Consensus 31 ekle~dlk~~ikklq~~rdqiktw~s~~d 59 (548) T COG5665 31 EKLESDLKREIKKLQKHRDQIKTWLSKED 59 (548) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 77645899999999999999986622021 No 78 >PRK03947 prefoldin subunit alpha; Reviewed Probab=31.08 E-value=35 Score=14.20 Aligned_cols=16 Identities=25% Similarity=0.198 Sum_probs=8.8 Q ss_pred HHHHCCHHHHHHHHHH Q ss_conf 9951998999999963 Q gi|254780375|r 110 IYKKMDSDSAALQLEQ 125 (175) Q Consensus 110 iy~~M~p~~AA~il~~ 125 (175) +|-.++++.|..+++. T Consensus 87 ~~vE~~~~eA~~~l~~ 102 (141) T PRK03947 87 YSAEKDLDEAIEILDK 102 (141) T ss_pred EEEEECHHHHHHHHHH T ss_conf 6999759999999999 No 79 >COG2959 HemX Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Probab=31.07 E-value=35 Score=14.20 Aligned_cols=86 Identities=16% Similarity=0.181 Sum_probs=35.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHCCHHHHHHHH-HHCCHHHHHHHHHH Q ss_conf 999999999999999999999999999999999999-9999999999999999519989999999-63798999999972 Q gi|254780375|r 60 DYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQK-YDSFIMSYNKNILDIYKKMDSDSAALQL-EQIDPDISSHILMR 137 (175) Q Consensus 60 ~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~-~~~~~~~~~~~lv~iy~~M~p~~AA~il-~~m~~d~aa~iL~~ 137 (175) .+..++.+|..++..+..+-..|...++.+...-+. +++-.-...+.+++. |+..| ..=|-+.|+.+|.. T Consensus 91 ~~~~~q~el~~l~~~~~~~~~ql~e~Q~~v~~is~~~~~dWllaEad~Ll~l--------A~rkL~l~~DV~TAv~lLk~ 162 (391) T COG2959 91 LIAQQQAELDRLERQLETLQKQLSELQKKVATISGSDRKDWLLAEADFLLKL--------AGRKLVLDQDVTTAVALLKS 162 (391) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH--------HHHHHHHCCCHHHHHHHHHH T ss_conf 8999999999999999877768999999998860578466889999999999--------98887653666899999997 Q ss_pred CCHHHHHHHHHHCCHHHHHHH Q ss_conf 998999999962999999999 Q gi|254780375|r 138 LSPRQSSLIMSKMNPKSATMI 158 (175) Q Consensus 138 m~~~~~a~IL~~M~p~~Aa~i 158 (175) +-.+|+.|+--..-.+ T Consensus 163 -----aD~~La~~NdP~l~~~ 178 (391) T COG2959 163 -----ADARLAAMNDPSLIAV 178 (391) T ss_pred -----HHHHHHHCCCCHHHHH T ss_conf -----8899986258137999 No 80 >pfam07996 T4SS Type IV secretion system proteins. Members of this family are components of the type IV secretion system. They mediate intracellular transfer of macromolecules via a mechanism ancestrally related to that of bacterial conjugation machineries. Probab=30.21 E-value=37 Score=14.11 Aligned_cols=63 Identities=21% Similarity=0.227 Sum_probs=27.0 Q ss_pred HHHHHHHHHHHHHHCHHHHCCCCCCCCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999998413022101466778576-8999999976679999999999999999999999999999999999999 Q gi|254780375|r 13 RDMLSQLLFLLFFFLQGFANQSYGDPTLVD-REIQQYCTNVIDSVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNL 91 (175) Q Consensus 13 ~~~l~~~~~~l~~~~~~~a~~~~~~~~~~~-~ei~~~~~~~~~~~re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~ 91 (175) +.+...+...+++..+.++. .+|+.. .-+.+. ...-+.+.....+++.....++..+..|.. T Consensus 4 ~~~~~~~~~~l~~~~~a~a~----GIPV~D~a~i~q~-------------~~~~qq~~q~~~ql~q~k~Qi~q~k~qy~s 66 (217) T pfam07996 4 KLIILALALALLAASPAAAA----GIPVVDAASISQI-------------ANQLQQLAQWAQQLKQLKQQIQQAKQQYNS 66 (217) T ss_pred HHHHHHHHHHHHCCCHHHCC----CCCEECCHHHHHH-------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 79999999998477777608----9981034139999-------------999999999999999999999999999998 Q ss_pred H Q ss_conf 9 Q gi|254780375|r 92 W 92 (175) Q Consensus 92 ~ 92 (175) . T Consensus 67 ~ 67 (217) T pfam07996 67 I 67 (217) T ss_pred H T ss_conf 7 No 81 >cd04769 HTH_MerR2 Helix-Turn-Helix DNA binding domain of MerR2-like transcription regulators. Helix-turn-helix (HTH) transcription regulator MerR2 and related proteins. MerR2 in Bacillus cereus RC607 regulates resistance to organomercurials. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates. Probab=30.15 E-value=37 Score=14.10 Aligned_cols=35 Identities=14% Similarity=0.257 Sum_probs=24.7 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999999999999999 Q gi|254780375|r 64 QKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDS 98 (175) Q Consensus 64 ~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~ 98 (175) ....|.....++++++++|+..+..++.+.....+ T Consensus 80 ~~~~l~~~~~~i~~qI~~L~~~~~~L~~~~~~l~~ 114 (116) T cd04769 80 LQQALEDKKQEIRAQITELQQLLARLDAFEASLKD 114 (116) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999999999999999987 No 82 >PRK02793 hypothetical protein; Provisional Probab=30.14 E-value=37 Score=14.10 Aligned_cols=42 Identities=14% Similarity=0.199 Sum_probs=32.7 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999999999999999999 Q gi|254780375|r 57 RERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDS 98 (175) Q Consensus 57 re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~ 98 (175) -+-+++-|+..++.|...+-++..++..++..+..+..+..+ T Consensus 13 LE~rlAfQe~tIe~LN~~v~~Qq~~i~~L~~ql~~L~~rLk~ 54 (72) T PRK02793 13 LESRLAFQEITIEELNLTVTAHEMEMAKLRDHLRLLTEKLKA 54 (72) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999689999999999999999999999999999999985 No 83 >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family; InterPro: IPR014243 This entry represents a set of transcription factors found in some endospore-forming bacteria within the Firmicutes (low-GC Gram-positive bacteria). In some species these proteins are encoded multiple times. The best characterised protein in this entry is the prespore-specific transcription factor RsfA from Bacillus subtilis, previously known as YwfN. Expression of RsfA is controlled by sigma factor F, and it seems to improve the efficiency of sporulation by fine-tuning the expression of genes in the sigma F regulon, particularly the timing of their expression . It also negatively regulates spoIIR and its own synthesis. A paralog in B. subtilis is designated YlbO, though its function is not known. A highly variable linker region separates two very strongly conserved sequence regions within the protein. . Probab=30.01 E-value=37 Score=14.09 Aligned_cols=45 Identities=22% Similarity=0.189 Sum_probs=24.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999999999999999999999999999995 Q gi|254780375|r 67 VLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYK 112 (175) Q Consensus 67 eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~~~~~~lv~iy~ 112 (175) +=+.|..++.....+++.++++++.+.++.. ...+++..|++|.. T Consensus 107 E~~~L~~~~~~Lq~~ne~L~~el~~L~~~~~-~~eEDY~~L~~IMd 151 (163) T TIGR02894 107 ENERLKKELESLQKRNEELEKELEKLEKRQS-TIEEDYETLIDIMD 151 (163) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHH T ss_conf 9999999999999999999999999999846-78999999999998 No 84 >PRK02119 hypothetical protein; Provisional Probab=27.44 E-value=41 Score=13.81 Aligned_cols=43 Identities=19% Similarity=0.291 Sum_probs=31.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999999999999999999999999999 Q gi|254780375|r 57 RERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSF 99 (175) Q Consensus 57 re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~ 99 (175) -+-+++-|+..++.|.+.+-++...++.++..+..+..+..+. T Consensus 14 LE~rlAFQe~tIe~LNq~v~~Qq~~i~~l~~ql~~L~~rlk~~ 56 (73) T PRK02119 14 LEMKIAFQENLLEELNQALIQQQFVIDKMQVQLRHMANKLKDF 56 (73) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 9999997898999999999999999999999999999999852 No 85 >pfam01988 VIT1 VIT family. This family includes the vacuolar Fe2+/Mn2+ uptake transporter, Ccc1 and the vacuolar iron transporter VIT1. Probab=27.32 E-value=41 Score=13.79 Aligned_cols=22 Identities=14% Similarity=0.329 Sum_probs=9.8 Q ss_pred HHHHHHHHH--CCHHHHHHHHHHC Q ss_conf 999999951--9989999999637 Q gi|254780375|r 105 KNILDIYKK--MDSDSAALQLEQI 126 (175) Q Consensus 105 ~~lv~iy~~--M~p~~AA~il~~m 126 (175) +.+.++|.. ++|+.|-.+.+.+ T Consensus 83 ~el~~i~~~~Gl~~~~a~~i~~~~ 106 (210) T pfam01988 83 EELAQIYRARGLSEELARQVARIL 106 (210) T ss_pred HHHHHHHHHCCCCHHHHHHHHHHH T ss_conf 999999987499989999999998 No 86 >PRK13752 putative transcriptional regulator MerR; Provisional Probab=27.30 E-value=41 Score=13.79 Aligned_cols=29 Identities=14% Similarity=0.118 Sum_probs=22.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999999999 Q gi|254780375|r 67 VLEDLQKDIEQRVILLENHKKEYNLWFQK 95 (175) Q Consensus 67 eL~~le~~l~~r~~eLe~~~~ei~~~l~~ 95 (175) .++..-++|++++++|..++.++..|... T Consensus 88 l~~~kl~~Ie~kI~~L~~lr~~L~~L~~~ 116 (144) T PRK13752 88 LAEHKLKDVREKMADLARMEAVLSELVCA 116 (144) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999999999986 No 87 >cd01108 HTH_CueR Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators. Helix-turn-helix (HTH) transcription regulators CueR and ActP, copper efflux regulators. In Bacillus subtilis, copper induced CueR regulates the copZA operon, preventing copper toxicity. In Rhizobium leguminosarum, ActP controls copper homeostasis; it detects cytoplasmic copper stress and activates transcription in response to increasing copper concentrations. These proteins are comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain winged HTH motifs that mediate DNA binding, while the C-terminal domains have two conserved cysteines that define a monovalent copper ion binding site. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements Probab=26.94 E-value=42 Score=13.75 Aligned_cols=31 Identities=10% Similarity=0.200 Sum_probs=24.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999999999999999 Q gi|254780375|r 65 KKVLEDLQKDIEQRVILLENHKKEYNLWFQK 95 (175) Q Consensus 65 e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~ 95 (175) .+.+.....+|++++++|+..+..++.++.. T Consensus 81 ~~ll~~kl~~i~~qI~eL~~~r~~L~~l~~~ 111 (127) T cd01108 81 KALALEHIAELERKIAELQAMRRTLQQLADS 111 (127) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999999999984 No 88 >cd01111 HTH_MerD Helix-Turn-Helix DNA binding domain of the MerD transcription regulator. Helix-turn-helix (HTH) transcription regulator MerD. The putative secondary regulator of mercury resistance (mer) operons, MerD, has been shown to down-regulate the expression of this operon in gram-negative bacteria. It binds to the same operator DNA as MerR that activates transcription of the operon in the presence of mercury ions. The MerD protein shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily, which promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are conserved and contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules such as metal ions, drugs, Probab=26.78 E-value=42 Score=13.73 Aligned_cols=27 Identities=22% Similarity=0.240 Sum_probs=18.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999 Q gi|254780375|r 66 KVLEDLQKDIEQRVILLENHKKEYNLW 92 (175) Q Consensus 66 ~eL~~le~~l~~r~~eLe~~~~ei~~~ 92 (175) ..+.....+++.++++|+.++.++..+ T Consensus 80 ~~~~~~~~~Ie~riaeL~~l~~~L~~l 106 (107) T cd01111 80 ACLAQLRQKIEVRRAALNALTTQLAEM 106 (107) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999999999999999964 No 89 >cd04785 HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding domain of the CadR- and PbrR-like transcription regulators. Helix-turn-helix (HTH) CadR- and PbrR-like transcription regulators. CadR and PbrR regulate expression of the cadmium and lead resistance operons, respectively. These proteins are comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the C-terminal domains have three conserved cysteines which comprise a putative metal binding site. Some members in this group have a histidine-rich C-terminal extension. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Probab=26.28 E-value=43 Score=13.68 Aligned_cols=32 Identities=13% Similarity=0.141 Sum_probs=24.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999999999999 Q gi|254780375|r 64 QKKVLEDLQKDIEQRVILLENHKKEYNLWFQK 95 (175) Q Consensus 64 ~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~ 95 (175) ....+.....++++++++|+..+..+..++.. T Consensus 80 ~~~ll~~kl~~i~~~i~eL~~~~~~L~~l~~~ 111 (126) T cd04785 80 ADAIARAHLADVRARIADLRRLEAELKRMVAA 111 (126) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999999999999985 No 90 >cd04789 HTH_Cfa Helix-Turn-Helix DNA binding domain of the Cfa transcription regulator. Putative helix-turn-helix (HTH) MerR-like transcription regulator; the N-terminal domain of Cfa, a cyclopropane fatty acid synthase and other related methyltransferases. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates. Probab=25.88 E-value=44 Score=13.63 Aligned_cols=28 Identities=4% Similarity=0.102 Sum_probs=20.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999999999999 Q gi|254780375|r 66 KVLEDLQKDIEQRVILLENHKKEYNLWF 93 (175) Q Consensus 66 ~eL~~le~~l~~r~~eLe~~~~ei~~~l 93 (175) ..+....+++++++++|+..+..+..++ T Consensus 74 ~~l~~~~~~l~~~I~~L~~~r~~L~~ll 101 (102) T cd04789 74 SLLLERLSSLAEQIARKQQARDLLAALL 101 (102) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999999860 No 91 >pfam09726 Macoilin Transmembrane protein. This entry is a highly conserved protein present in eukaryotes. Probab=25.56 E-value=44 Score=13.59 Aligned_cols=24 Identities=17% Similarity=0.177 Sum_probs=9.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999 Q gi|254780375|r 67 VLEDLQKDIEQRVILLENHKKEYN 90 (175) Q Consensus 67 eL~~le~~l~~r~~eLe~~~~ei~ 90 (175) |+++|+.++..+-..+...+.|+. T Consensus 541 E~kkLr~eLk~kEe~~~~~E~E~~ 564 (680) T pfam09726 541 EIKKLEHDLKLKEEECRMLEKEAQ 564 (680) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999877999999999999 No 92 >PRK11877 psaI photosystem I reaction center subunit VIII; Reviewed Probab=25.36 E-value=18 Score=16.11 Aligned_cols=23 Identities=17% Similarity=0.212 Sum_probs=15.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 88999998999999999999841 Q gi|254780375|r 4 LPIIYYYKKRDMLSQLLFLLFFF 26 (175) Q Consensus 4 ip~if~~~~~~~l~~~~~~l~~~ 26 (175) +|.||+-..+.+.+++++++.|. T Consensus 10 LP~ifiP~vg~~~PaV~m~Ll~~ 32 (38) T PRK11877 10 LPAIFVPLVGWVMPAVFIVLLGR 32 (38) T ss_pred CCCEEEEEHHHHHHHHHHHHHHH T ss_conf 52201121202333778764342 No 93 >pfam11857 DUF3377 Domain of unknown function (DUF3377). This domain is functionally uncharacterized. This domain is found in eukaryotes. This presumed domain is about 70 amino acids in length. Probab=25.00 E-value=45 Score=13.53 Aligned_cols=21 Identities=14% Similarity=0.491 Sum_probs=12.0 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9378899999899999999999984 Q gi|254780375|r 1 MILLPIIYYYKKRDMLSQLLFLLFF 25 (175) Q Consensus 1 ~i~ip~if~~~~~~~l~~~~~~l~~ 25 (175) +|+||++..+ -+.++++++++ T Consensus 33 aVviPl~L~l----CiL~l~y~i~q 53 (74) T pfam11857 33 AVVIPLVLLL----CILVLLYTIVQ 53 (74) T ss_pred EEHHHHHHHH----HHHHHHHHHHH T ss_conf 8788999999----99999998621 No 94 >pfam06810 Phage_GP20 Phage minor structural protein GP20. This family consists of several phage minor structural protein GP20 sequences of around 180 residues in length. The function of this family is unknown. Probab=24.58 E-value=46 Score=13.48 Aligned_cols=26 Identities=19% Similarity=0.249 Sum_probs=11.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999999 Q gi|254780375|r 61 YLSQKKVLEDLQKDIEQRVILLENHK 86 (175) Q Consensus 61 l~~~e~eL~~le~~l~~r~~eLe~~~ 86 (175) +..-+.++..+..+|..|-..|+.++ T Consensus 22 ~~~~~~e~~~lk~Ql~~rd~ql~~Lk 47 (156) T pfam06810 22 LDKANEERDSLKKQLKNRDKQIEDLK 47 (156) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999998899988 No 95 >cd04784 HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain of the CadR and PbrR transcription regulators. Helix-turn-helix (HTH) CadR and PbrR transcription regulators including Pseudomonas aeruginosa CadR and Ralstonia metallidurans PbrR that regulate expression of the cadmium and lead resistance operons, respectively. These proteins are comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the C-terminal domains have three conserved cysteines which form a putative metal binding site. Some members in this group have a histidine-rich C-terminal extension. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Probab=24.49 E-value=46 Score=13.47 Aligned_cols=32 Identities=9% Similarity=0.236 Sum_probs=23.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999999999999 Q gi|254780375|r 64 QKKVLEDLQKDIEQRVILLENHKKEYNLWFQK 95 (175) Q Consensus 64 ~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~ 95 (175) ....+....++|++++++|+.++.++..+... T Consensus 80 ~~~ll~~kl~~i~~~I~eL~~l~~~L~~L~~~ 111 (127) T cd04784 80 VNALIDEHLAHVRARIAELQALEKQLQALRER 111 (127) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999999999999986 No 96 >pfam01763 Herpes_UL6 Herpesvirus UL6 like. This family consists of various proteins from the herpesviridae that are similar to herpes simplex virus type I UL6 virion protein. UL6 is essential for cleavage and packaging of the viral genome. Probab=24.48 E-value=46 Score=13.47 Aligned_cols=42 Identities=17% Similarity=0.154 Sum_probs=34.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999999999999999999 Q gi|254780375|r 62 LSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSY 103 (175) Q Consensus 62 ~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~~~ 103 (175) .-..+-.+-|+.+|+.+..+++.++.+.+.|+++..+.+.+- T Consensus 353 ~V~n~V~kcLe~qIn~qF~tIe~Lk~~n~~~~~kl~~~e~~L 394 (551) T pfam01763 353 SVSNSVNKCLEGQINEQFDTIEDLKEENEDLLKKLRELESEL 394 (551) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999879998799999999999999999999999999999999 No 97 >PRK11677 cytochrome d ubiquinol oxidase subunit III; Provisional Probab=23.77 E-value=48 Score=13.38 Aligned_cols=18 Identities=17% Similarity=0.361 Sum_probs=6.5 Q ss_pred HHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999 Q gi|254780375|r 60 DYLSQKKVLEDLQKDIEQ 77 (175) Q Consensus 60 ~l~~~e~eL~~le~~l~~ 77 (175) ++..-+.+|+.-+++|++ T Consensus 37 eLe~~k~el~~Yr~ev~~ 54 (134) T PRK11677 37 ELEKNKAELEEYRQELVD 54 (134) T ss_pred HHHHHHHHHHHHHHHHHH T ss_conf 999999999999999999 No 98 >PRK04406 hypothetical protein; Provisional Probab=23.69 E-value=48 Score=13.37 Aligned_cols=42 Identities=17% Similarity=0.275 Sum_probs=28.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999999999999999999 Q gi|254780375|r 57 RERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDS 98 (175) Q Consensus 57 re~~l~~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~ 98 (175) -+-+++-|+..++.|...+-+...++..++..+.-+..+..+ T Consensus 16 LE~rlAFQE~tIeeLN~~v~~qq~~i~~lq~qlr~L~~klk~ 57 (75) T PRK04406 16 LECQLAFQEQTIEELNDALSQQQLLITKMQDQMKYVVGKVKN 57 (75) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999789999999999999999999999999999999986 No 99 >pfam08781 DP Transcription factor DP. DP forms a heterodimer with E2F and regulates genes involved in cell cycle progression. The transcriptional activity of E2F is inhibited by the retinoblastoma protein which binds to the E2F-DP heterodimer and negatively regulates the G1-S transition. Probab=23.42 E-value=48 Score=13.34 Aligned_cols=32 Identities=13% Similarity=0.303 Sum_probs=17.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999999999999 Q gi|254780375|r 67 VLEDLQKDIEQRVILLENHKKEYNLWFQKYDS 98 (175) Q Consensus 67 eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~ 98 (175) +.++++.+-..++..++++++.+..++.+... T Consensus 2 e~~~L~~e~~~~~~rI~~K~~~LqeL~~Q~va 33 (141) T pfam08781 2 EIEELEEERQKRIERIEQKQAQLQELIEQQVA 33 (141) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 28899999999999999999999999999999 No 100 >PRK12765 flagellar capping protein; Provisional Probab=23.37 E-value=49 Score=13.33 Aligned_cols=52 Identities=8% Similarity=0.072 Sum_probs=27.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 9999999999999999999999999999999999999999999999999519 Q gi|254780375|r 63 SQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKM 114 (175) Q Consensus 63 ~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~~~~~~~~~~~~lv~iy~~M 114 (175) ...-.|..++..++.++..|+..+..++..+..+.+...+++..+=.+..+| T Consensus 527 gs~G~L~~~~~~l~~~~~~L~~~~~~~~~rl~~~~~~m~~qfa~~d~~ia~~ 578 (597) T PRK12765 527 GKDGSITKYDESLTNEIKSLTTSKESTQKLIDTKYDTMANQWLQYESIIAKL 578 (597) T ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 6897589988777788888887899999999999999999999999999999 No 101 >PRK09921 permease DsdX; Provisional Probab=23.32 E-value=49 Score=13.32 Aligned_cols=39 Identities=18% Similarity=0.243 Sum_probs=27.7 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHCCCCCCCC Q ss_conf 937889999989999999999998413022101466778 Q gi|254780375|r 1 MILLPIIYYYKKRDMLSQLLFLLFFFLQGFANQSYGDPT 39 (175) Q Consensus 1 ~i~ip~if~~~~~~~l~~~~~~l~~~~~~~a~~~~~~~~ 39 (175) +|++|++|.+.+|.=.+.+.+.+....+.++.+..-.|. T Consensus 123 viL~Pl~~~lak~t~~s~~~~~~~l~~Gl~~tH~lvPPt 161 (445) T PRK09921 123 VLLIPLAFSIAKKTNTSLLKLAIPLCTALMAVHCVVPPH 161 (445) T ss_pred HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCC T ss_conf 999999999999969994999999999998710047999 No 102 >cd04781 HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 6) with at least two conserved cysteines present in the C-terminal portion of the protein. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, an Probab=23.14 E-value=49 Score=13.30 Aligned_cols=29 Identities=10% Similarity=0.212 Sum_probs=21.7 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999999999 Q gi|254780375|r 65 KKVLEDLQKDIEQRVILLENHKKEYNLWF 93 (175) Q Consensus 65 e~eL~~le~~l~~r~~eLe~~~~ei~~~l 93 (175) .+.++....+|++++++|+..++.++.+. T Consensus 76 ~~~l~~~~~~i~~~I~~L~~~r~~L~~~~ 104 (120) T cd04781 76 RQLLKAKAAELDQQIQRLQAMRELLRHVA 104 (120) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999999999986 No 103 >pfam09851 DUF2078 Predicted membrane protein (DUF2078). This domain, found in various hypothetical prokaryotic proteins, has no known function. Probab=22.78 E-value=50 Score=13.26 Aligned_cols=12 Identities=42% Similarity=0.592 Sum_probs=6.2 Q ss_pred HHHHHHHHHHHH Q ss_conf 999999999999 Q gi|254780375|r 58 ERDYLSQKKVLE 69 (175) Q Consensus 58 e~~l~~~e~eL~ 69 (175) +.+|..+++.|+ T Consensus 61 eeEy~~rk~~L~ 72 (73) T pfam09851 61 EEEYEERKKDLR 72 (73) T ss_pred HHHHHHHHHHHC T ss_conf 999999998863 No 104 >cd01107 HTH_BmrR Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator. Helix-turn-helix (HTH) multidrug-efflux transporter transcription regulator, BmrR and YdfL of Bacillus subtilis, and related proteins; N-terminal domain. Bmr is a membrane protein which causes the efflux of a variety of toxic substances and antibiotics. BmrR is comprised of two distinct domains that harbor a regulatory (effector-binding) site and an active (DNA-binding) site. The conserved N-terminal domain contains a winged HTH motif that mediates DNA binding, while the C-terminal domain binds coactivating, toxic compounds. BmrR shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Probab=22.56 E-value=50 Score=13.23 Aligned_cols=33 Identities=12% Similarity=0.185 Sum_probs=23.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999999999999999999999 Q gi|254780375|r 63 SQKKVLEDLQKDIEQRVILLENHKKEYNLWFQK 95 (175) Q Consensus 63 ~~e~eL~~le~~l~~r~~eLe~~~~ei~~~l~~ 95 (175) .....|..-.+++++++.+|+...+.++.++++ T Consensus 75 ~~~~~l~~~~~~l~~~i~~L~~~~~~l~~~l~~ 107 (108) T cd01107 75 ELRKLLREKLAELEAEIEELQRILRLLEDRLKQ 107 (108) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999999999999999999999973 No 105 >cd04775 HTH_Cfa-like Helix-Turn-Helix DNA binding domain of Cfa-like transcription regulators. Putative helix-turn-helix (HTH) MerR-like transcription regulators; the HTH domain of Cfa, a cyclopropane fatty acid synthase, and other related methyltransferases, as well as, the N-terminal domain of a conserved, uncharacterized ~172 a.a. protein. Based on sequence similarity of the N-terminal domain, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimil Probab=21.14 E-value=54 Score=13.05 Aligned_cols=28 Identities=11% Similarity=0.262 Sum_probs=20.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999999999999 Q gi|254780375|r 66 KVLEDLQKDIEQRVILLENHKKEYNLWF 93 (175) Q Consensus 66 ~eL~~le~~l~~r~~eLe~~~~ei~~~l 93 (175) ..|+..-+++++++++|.+.++.++.++ T Consensus 74 ~~l~~~~~~i~~~I~~L~~~r~~L~~ll 101 (102) T cd04775 74 AILEERLQSLNREIQRLRQQQQVLAAIL 101 (102) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999999873 No 106 >pfam09403 FadA Adhesion protein FadA. FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices. Probab=20.66 E-value=55 Score=12.99 Aligned_cols=36 Identities=25% Similarity=0.422 Sum_probs=15.9 Q ss_pred HHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999------99999999999999999 Q gi|254780375|r 67 VLEDLQKDIEQRVILLENH------KKEYNLWFQKYDSFIMS 102 (175) Q Consensus 67 eL~~le~~l~~r~~eLe~~------~~ei~~~l~~~~~~~~~ 102 (175) +|..+...+++++..|..- +.+|+.+++++++..++ T Consensus 63 ~l~~l~~~~ee~~~kL~~~~~~rfykdeY~~LlKkY~~~lk~ 104 (126) T pfam09403 63 ELKERQLGREELYAKLKEESKTRFHKDEYKKLLKRYDEYLNK 104 (126) T ss_pred HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH T ss_conf 999998769999999888624004898899999999999999 Done!