BLAST/PSIBLAST alignment of GI: 254780376 and GI: 315121845 at iteration 1
>gi|315121845|ref|YP_004062334.1| flagellar basal body P-ring protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 369
>gi|313495247|gb|ADR51846.1| flagellar basal body P-ring protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 369
 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/369 (87%), Positives = 344/369 (93%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           MIFRIA  +FS I L+   AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP
Sbjct: 1   MIFRIALFVFSCIILNSTLAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTEQSMRSLLQNLGIST GG+LGSKN+AAVMVTANLPPFASPGSRIDVSINSLGDASSLR
Sbjct: 61  FTEQSMRSLLQNLGISTQGGKLGSKNIAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GGILVMTSL+GADGNIYAVAQGSVVVSG F+KG+ SS MEGI+TGGKIVNGAIVERELPK
Sbjct: 121 GGILVMTSLVGADGNIYAVAQGSVVVSGFFIKGELSSIMEGIATGGKIVNGAIVERELPK 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           KF+D+ DLILQLRNPDFST+IRIADQIN+YSL RF +PIAEA+DSRTVKVSKPTNIDLTR
Sbjct: 181 KFRDAIDLILQLRNPDFSTSIRIADQINTYSLGRFGKPIAEAHDSRTVKVSKPTNIDLTR 240

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           LMSE+EMLTVETDTPAR+IINERTGTIVIGDNVRISKVVVSYG+LTVQITEN QVVQPN 
Sbjct: 241 LMSEIEMLTVETDTPARIIINERTGTIVIGDNVRISKVVVSYGSLTVQITENRQVVQPNV 300

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            SS G T+ Q +TDL+  +NK  FSLIDAPDLNSLISGMNS+GLKTDGIISILQGIKAAG
Sbjct: 301 LSSGGKTLVQQSTDLQTFNNKSPFSLIDAPDLNSLISGMNSMGLKTDGIISILQGIKAAG 360

Query: 361 ALQSEIIIQ 369
           ALQSEIIIQ
Sbjct: 361 ALQSEIIIQ 369