BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780376|ref|YP_003064789.1| flagellar basal body P-ring
protein [Candidatus Liberibacter asiaticus str. psy62]
         (369 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780376|ref|YP_003064789.1| flagellar basal body P-ring protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040053|gb|ACT56849.1| flagellar basal body P-ring protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 369

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/369 (100%), Positives = 369/369 (100%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP
Sbjct: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR
Sbjct: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK
Sbjct: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR
Sbjct: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA
Sbjct: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG
Sbjct: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360

Query: 361 ALQSEIIIQ 369
           ALQSEIIIQ
Sbjct: 361 ALQSEIIIQ 369


>gi|315121845|ref|YP_004062334.1| flagellar basal body P-ring protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495247|gb|ADR51846.1| flagellar basal body P-ring protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 369

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/369 (87%), Positives = 344/369 (93%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           MIFRIA  +FS I L+   AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP
Sbjct: 1   MIFRIALFVFSCIILNSTLAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTEQSMRSLLQNLGIST GG+LGSKN+AAVMVTANLPPFASPGSRIDVSINSLGDASSLR
Sbjct: 61  FTEQSMRSLLQNLGISTQGGKLGSKNIAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GGILVMTSL+GADGNIYAVAQGSVVVSG F+KG+ SS MEGI+TGGKIVNGAIVERELPK
Sbjct: 121 GGILVMTSLVGADGNIYAVAQGSVVVSGFFIKGELSSIMEGIATGGKIVNGAIVERELPK 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           KF+D+ DLILQLRNPDFST+IRIADQIN+YSL RF +PIAEA+DSRTVKVSKPTNIDLTR
Sbjct: 181 KFRDAIDLILQLRNPDFSTSIRIADQINTYSLGRFGKPIAEAHDSRTVKVSKPTNIDLTR 240

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           LMSE+EMLTVETDTPAR+IINERTGTIVIGDNVRISKVVVSYG+LTVQITEN QVVQPN 
Sbjct: 241 LMSEIEMLTVETDTPARIIINERTGTIVIGDNVRISKVVVSYGSLTVQITENRQVVQPNV 300

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            SS G T+ Q +TDL+  +NK  FSLIDAPDLNSLISGMNS+GLKTDGIISILQGIKAAG
Sbjct: 301 LSSGGKTLVQQSTDLQTFNNKSPFSLIDAPDLNSLISGMNSMGLKTDGIISILQGIKAAG 360

Query: 361 ALQSEIIIQ 369
           ALQSEIIIQ
Sbjct: 361 ALQSEIIIQ 369


>gi|190890365|ref|YP_001976907.1| flagellar basal body P-ring protein [Rhizobium etli CIAT 652]
 gi|226701953|sp|B3PPM2|FLGI_RHIE6 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|190695644|gb|ACE89729.1| flagellar basal body P-ring protein [Rhizobium etli CIAT 652]
          Length = 373

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 238/373 (63%), Positives = 297/373 (79%), Gaps = 6/373 (1%)

Query: 1   MIFR----IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSL 56
           ++FR    +A L  SL  +    A + SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  
Sbjct: 3   LLFRFLTLVAVLAMSLADVAPAWA-LTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGF 61

Query: 57  RSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDA 116
           RSSPFTEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSRIDV+++SLGDA
Sbjct: 62  RSSPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPFASPGSRIDVTVSSLGDA 121

Query: 117 SSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVER 176
           +SLRGG LVMTSL GADG IYAVAQG+V+VSG   +GQ+++  EG++T G++  GAI+ER
Sbjct: 122 TSLRGGTLVMTSLSGADGQIYAVAQGAVIVSGFQAQGQAATVTEGVTTAGRVPGGAIIER 181

Query: 177 ELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI 236
           ELP +FKDS +L+LQLRNPDFSTAIRIAD +N Y+  RF  P+AEA DS+ V + KP   
Sbjct: 182 ELPSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRTA 241

Query: 237 DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
           DLTRLM++VE L VETDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++
Sbjct: 242 DLTRLMADVENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQII 301

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QP  F S G T  Q  TD+      G  ++ID PDL +L++G+N+IG+K DGII+ILQGI
Sbjct: 302 QPEPF-SRGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGI 360

Query: 357 KAAGALQSEIIIQ 369
           K+AGALQ+E+++Q
Sbjct: 361 KSAGALQAELVLQ 373


>gi|86356314|ref|YP_468206.1| flagellar basal body P-ring protein [Rhizobium etli CFN 42]
 gi|123513034|sp|Q2KCF7|FLGI_RHIEC RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|86280416|gb|ABC89479.1| flagellar basal-body P-ring protein [Rhizobium etli CFN 42]
          Length = 373

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 238/373 (63%), Positives = 295/373 (79%), Gaps = 6/373 (1%)

Query: 1   MIFRIAFLI----FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSL 56
           + FRI  L+     SL  +    A + SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  
Sbjct: 3   LFFRIVTLVAVVAMSLADMAPAWA-LTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGF 61

Query: 57  RSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDA 116
           RSSPFTEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSR+DV+++SLGDA
Sbjct: 62  RSSPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPFASPGSRLDVTVSSLGDA 121

Query: 117 SSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVER 176
           +SLRGG LVMTSL GADG IYAVAQGSV+VSG   +GQ+++  EG++T G++  GAI+ER
Sbjct: 122 TSLRGGTLVMTSLSGADGQIYAVAQGSVIVSGFQAQGQAATVTEGVTTAGRVPGGAIIER 181

Query: 177 ELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI 236
           ELP  FKDS +L+LQLRNPDFSTAIRIAD +N Y+  RF  P+AEA DS+ V + KP   
Sbjct: 182 ELPSHFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRTA 241

Query: 237 DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
           DLTRLM++VE L VETDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++
Sbjct: 242 DLTRLMADVENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQII 301

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QP  F S G T  Q  TD+      G  ++ID PDL +L++G+N+IG+K DGII+ILQGI
Sbjct: 302 QPEPF-SRGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGI 360

Query: 357 KAAGALQSEIIIQ 369
           K+AGALQ+E+++Q
Sbjct: 361 KSAGALQAELVLQ 373


>gi|327193037|gb|EGE59949.1| flagellar basal body P-ring protein [Rhizobium etli CNPAF512]
          Length = 522

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 238/373 (63%), Positives = 296/373 (79%), Gaps = 6/373 (1%)

Query: 1   MIFRI----AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSL 56
           ++FR     A L  SL  +    A + SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  
Sbjct: 152 LLFRFLTLAAVLAMSLADVAPAWA-LTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGF 210

Query: 57  RSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDA 116
           RSSPFTEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSRIDV+++SLGDA
Sbjct: 211 RSSPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPFASPGSRIDVTVSSLGDA 270

Query: 117 SSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVER 176
           +SLRGG LVMTSL GADG IYAVAQG+V+VSG   +GQ+++  EG++T G++  GAI+ER
Sbjct: 271 TSLRGGTLVMTSLSGADGQIYAVAQGAVIVSGFQAQGQAATVTEGVTTAGRVPGGAIIER 330

Query: 177 ELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI 236
           ELP +FKDS +L+LQLRNPDFSTAIRIAD +N Y+  RF  P+AEA DS+ V + KP   
Sbjct: 331 ELPSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRTA 390

Query: 237 DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
           DLTRLM++VE L VETDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++
Sbjct: 391 DLTRLMADVENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQII 450

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QP  F S G T  Q  TD+      G  ++ID PDL +L++G+N+IG+K DGII+ILQGI
Sbjct: 451 QPEPF-SRGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGI 509

Query: 357 KAAGALQSEIIIQ 369
           K+AGALQ+E+++Q
Sbjct: 510 KSAGALQAELVLQ 522


>gi|218672799|ref|ZP_03522468.1| flagellar basal body P-ring protein [Rhizobium etli GR56]
          Length = 370

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/348 (66%), Positives = 286/348 (82%), Gaps = 1/348 (0%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR 81
           + SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  RSSPFTEQSMR++LQNLGIST GG+
Sbjct: 24  LTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGFRSSPFTEQSMRAMLQNLGISTQGGQ 83

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
             +KN AAVMVTANLPPFASPGSRIDV+++SLGDA+SLRGG LVMTSL GADG IYAVAQ
Sbjct: 84  SSAKNTAAVMVTANLPPFASPGSRIDVTVSSLGDATSLRGGTLVMTSLSGADGQIYAVAQ 143

Query: 142 GSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           GSV+VSG   +GQ+++  EG++T G++  GAI+ERELP +FKDS +L+LQLRNPDFSTAI
Sbjct: 144 GSVIVSGFQAQGQAATVTEGVTTAGRVPGGAIIERELPSRFKDSVNLVLQLRNPDFSTAI 203

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIIN 261
           RIAD +N Y+  RF  P+AEA DS+ V + KP   DLTRLM++VE L VETDTPA+V+IN
Sbjct: 204 RIADIVNGYASARFGGPVAEAKDSQEVVIQKPRQADLTRLMADVENLIVETDTPAKVVIN 263

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           ERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++QP  F S G T  Q  TD+      
Sbjct: 264 ERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQIIQPEPF-SRGRTAVQPQTDIAAEQTG 322

Query: 322 GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           G  ++ID PDL +L++G+N+IG+K DGII+ILQGIK+AGALQ+E+++Q
Sbjct: 323 GRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGIKSAGALQAELVLQ 370


>gi|116250484|ref|YP_766322.1| flagellar basal body P-ring protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|123082046|sp|Q1MLE7|FLGI_RHIL3 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|115255132|emb|CAK06206.1| putative flagellar P-ring protein precursor (basal body p-ring
           protein) [Rhizobium leguminosarum bv. viciae 3841]
          Length = 373

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 237/373 (63%), Positives = 296/373 (79%), Gaps = 6/373 (1%)

Query: 1   MIFR----IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSL 56
           + FR    +A L  SL  +    A + SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  
Sbjct: 3   LFFRFVTLVAVLAMSLANVAPAWA-LTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGF 61

Query: 57  RSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDA 116
           R+SPFTEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSRIDV+++SLGDA
Sbjct: 62  RASPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPFASPGSRIDVTVSSLGDA 121

Query: 117 SSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVER 176
           +SLRGG LVMTSL GADG IYAVAQG+V+VSG   +GQ+++  EG++T G++  GAI+ER
Sbjct: 122 TSLRGGTLVMTSLSGADGQIYAVAQGAVIVSGFQAQGQAATVTEGVTTAGRVPGGAIIER 181

Query: 177 ELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI 236
           ELP +FKDS +L+LQLRNPDFSTAIRIAD +N Y+  RF  P+AEA DS+ V + KP   
Sbjct: 182 ELPSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRAA 241

Query: 237 DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
           DLTRLM++VE L VETDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++
Sbjct: 242 DLTRLMADVENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQII 301

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QP  F S G T  Q  TD+      G  ++ID PDL +L++G+N+IG+K DGII+ILQGI
Sbjct: 302 QPEPF-SRGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGI 360

Query: 357 KAAGALQSEIIIQ 369
           K+AGALQ+E+++Q
Sbjct: 361 KSAGALQAELVLQ 373


>gi|222084867|ref|YP_002543396.1| flagellar basal-body P-ring protein [Agrobacterium radiobacter K84]
 gi|221722315|gb|ACM25471.1| flagellar basal-body P-ring protein [Agrobacterium radiobacter K84]
          Length = 372

 Score =  481 bits (1239), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 227/346 (65%), Positives = 290/346 (83%), Gaps = 1/346 (0%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SRIKD+ SLQ+GRDNQLIGYGL+VGLQG+GD LRSSPFTEQSMR++LQNLGIST GG+  
Sbjct: 28  SRIKDIASLQAGRDNQLIGYGLIVGLQGSGDGLRSSPFTEQSMRAMLQNLGISTQGGQSA 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KN AAVMVTANLPPFASPGSRIDV+++SLGDA+SLRGG L+MTSL GADG IYAVAQGS
Sbjct: 88  AKNTAAVMVTANLPPFASPGSRIDVTVSSLGDATSLRGGTLIMTSLSGADGQIYAVAQGS 147

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+VSG   +G ++S  EG +T G++  GAI+ERELP +FKDS +L+LQLRNPDFST++RI
Sbjct: 148 VIVSGFQAQGAAASVTEGTTTAGRVPGGAIIERELPSRFKDSVNLVLQLRNPDFSTSVRI 207

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
            D +N+++ +RF  PIAEA DS+ V +SKP   DLTRLM+++E L V+TDTPA+V+INER
Sbjct: 208 TDTVNAWATSRFGAPIAEAKDSQEVAISKPKMADLTRLMADIENLAVQTDTPAKVVINER 267

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TGTIVIG +VR+S V VSYG LTVQ++EN QV+QP  F S+G T  Q+ TD+  + + G 
Sbjct: 268 TGTIVIGADVRVSPVAVSYGTLTVQVSENPQVIQPEPF-SDGQTAIQDQTDITATKSGGG 326

Query: 324 FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            +++  PDL +L+SG+N+IG+K DGII+ILQGIK+AGALQ+E+++Q
Sbjct: 327 VAMLQGPDLKTLVSGLNNIGVKPDGIIAILQGIKSAGALQAELVLQ 372


>gi|241203108|ref|YP_002974204.1| flagellar basal body P-ring protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856998|gb|ACS54665.1| flagellar P-ring protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 373

 Score =  481 bits (1238), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 234/372 (62%), Positives = 296/372 (79%), Gaps = 4/372 (1%)

Query: 1   MIFRIAFLIFSL-IGLHEI--SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLR 57
           + FR   L+  L + L ++  +  + SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  R
Sbjct: 3   LFFRFVTLVAVLAMSLADVVPAWALTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGFR 62

Query: 58  SSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           SSPFTEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSRIDV+++SLGDA+
Sbjct: 63  SSPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPFASPGSRIDVTVSSLGDAT 122

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SLRGG LVMTSL GADG IYAVAQG+ +VSG   +GQ+++  EG++T G++  GAI+ERE
Sbjct: 123 SLRGGTLVMTSLSGADGQIYAVAQGAAIVSGFQAQGQAATVTEGVTTAGRVPGGAIIERE 182

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           LP +FKDS +L+LQLRNPDFSTAIRIAD +N Y+  RF  P+AEA DS+ V + KP   D
Sbjct: 183 LPSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRTAD 242

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           LTRLM+++E L VETDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++Q
Sbjct: 243 LTRLMADIENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQIIQ 302

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           P  F S G T  Q  TD+      G  ++ID PDL +L++G+N+IG+K DGII+ILQGIK
Sbjct: 303 PEPF-SQGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGIK 361

Query: 358 AAGALQSEIIIQ 369
           +AGALQ+E+++Q
Sbjct: 362 SAGALQAELVLQ 373


>gi|209547930|ref|YP_002279847.1| flagellar basal body P-ring protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226701954|sp|B5ZQE0|FLGI_RHILW RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|209533686|gb|ACI53621.1| flagellar P-ring protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 373

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/373 (62%), Positives = 295/373 (79%), Gaps = 6/373 (1%)

Query: 1   MIFR----IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSL 56
           + FR    +A L  SL  +    A + SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  
Sbjct: 3   LFFRFLTLVAVLAMSLADVAPAWA-LTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGF 61

Query: 57  RSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDA 116
           R+SPFTEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSRIDV+++SLGDA
Sbjct: 62  RASPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPFASPGSRIDVTVSSLGDA 121

Query: 117 SSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVER 176
           +SLRGG LVMTSL GADG IYAVAQG+ +V+G   +GQ+++  EG++T G++  GAI+ER
Sbjct: 122 TSLRGGTLVMTSLSGADGQIYAVAQGAAIVTGFQAQGQAATVTEGVTTAGRVPGGAIIER 181

Query: 177 ELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI 236
           ELP +FKDS +L+LQLRNPDFSTAIRIAD +N Y+  RF  P+AEA DS+ V + KP   
Sbjct: 182 ELPSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRTA 241

Query: 237 DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
           DLTRLM+++E L VETDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++
Sbjct: 242 DLTRLMADIENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQII 301

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QP  F S G T  Q  TD+      G  ++ID PDL +L++G+N+IG+K DGII+ILQGI
Sbjct: 302 QPEPF-SQGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGI 360

Query: 357 KAAGALQSEIIIQ 369
           K+AGALQ+E+++Q
Sbjct: 361 KSAGALQAELVLQ 373


>gi|15887896|ref|NP_353577.1| flagellar basal body P-ring protein [Agrobacterium tumefaciens str.
           C58]
 gi|2494539|sp|Q44340|FLGI_AGRT5 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|1086563|gb|AAB68970.1| FlgI [Agrobacterium tumefaciens]
 gi|2459716|gb|AAB71792.1| FlgI [Agrobacterium tumefaciens]
 gi|15155488|gb|AAK86362.1| flagellar P-ring protein precursor [Agrobacterium tumefaciens str.
           C58]
          Length = 373

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 236/372 (63%), Positives = 301/372 (80%), Gaps = 5/372 (1%)

Query: 2   IFRI--AFLIFS-LIGLHEISAQV-VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLR 57
           + RI  A L+FS L  L    AQ   SRIKD+ SLQ+GRDNQLIGYGLVVGLQGTGDSLR
Sbjct: 3   VLRIIAAALVFSALPFLSTPPAQADTSRIKDIASLQAGRDNQLIGYGLVVGLQGTGDSLR 62

Query: 58  SSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           SSPFTEQSMR++LQNLGI+T GG+  +KN+AAVMVTANLPPFASPGSR+DV+++SLGDA+
Sbjct: 63  SSPFTEQSMRAMLQNLGITTQGGQSNAKNIAAVMVTANLPPFASPGSRVDVTVSSLGDAT 122

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SLRGG L+MTSL GADG IYAVAQG+++V+G   +G +++  +G++T  ++ NGAI+ERE
Sbjct: 123 SLRGGNLIMTSLSGADGQIYAVAQGALIVNGFSAQGDAATLTQGVTTSARVPNGAIIERE 182

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           LP KFKDS +L+LQLRNPDFSTA+R+AD +N+++  R+  PIAE  DS+ + V KP   D
Sbjct: 183 LPSKFKDSVNLVLQLRNPDFSTAVRVADVVNAFARARYGDPIAEPRDSQEIAVQKPRVAD 242

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           LTRLM+E+E LTVETDTPA+V+INERTGTIVIG +VRIS+V VSYG LTVQ+TE+ QV+Q
Sbjct: 243 LTRLMAEIENLTVETDTPAKVVINERTGTIVIGADVRISRVAVSYGTLTVQVTESPQVIQ 302

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           P  F S G T  Q  TD+         ++++ PDL +L++G+NSIGLK DGII+ILQGIK
Sbjct: 303 PAPF-SRGQTAVQPQTDIMAMQEGSKVAIVEGPDLRTLVAGLNSIGLKADGIIAILQGIK 361

Query: 358 AAGALQSEIIIQ 369
           +AGALQ+E+++Q
Sbjct: 362 SAGALQAELVLQ 373


>gi|325291937|ref|YP_004277801.1| flagellar basal body P-ring protein [Agrobacterium sp. H13-3]
 gi|325059790|gb|ADY63481.1| flagellar basal body P-ring protein [Agrobacterium sp. H13-3]
          Length = 373

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 232/369 (62%), Positives = 297/369 (80%), Gaps = 2/369 (0%)

Query: 2   IFRIAFLIFSLIGLHEISAQV-VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           I   A +I +L  L    AQ   SRIKD+ SLQ+GRDNQLIGYGLVVGLQGTGDSLRSSP
Sbjct: 6   ILCAALVISALPFLSTPPAQADTSRIKDIASLQAGRDNQLIGYGLVVGLQGTGDSLRSSP 65

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTEQSMR++LQNLGI+T GG+  +KN+AAVMVTANLPPFASPGSR+DV+++SLGDASSLR
Sbjct: 66  FTEQSMRAMLQNLGITTQGGQSNAKNIAAVMVTANLPPFASPGSRVDVTVSSLGDASSLR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MTSL GADG IYAVAQG+++V+G   +G +++  +G++T  ++ NGAI+ERELP 
Sbjct: 126 GGNLIMTSLSGADGQIYAVAQGALIVNGFSAQGDAATLTQGVTTSARVPNGAIIERELPS 185

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           KFKDS +L+LQLRNPDFSTA+R+AD +N+++  R+   IAE  DS+ + V KP   DLTR
Sbjct: 186 KFKDSVNLVLQLRNPDFSTAVRVADVVNAFARARYGDGIAEPRDSQEISVQKPRTADLTR 245

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           LM+E+E LTV+TDTPA+V+INERTGTIVIG +VRIS+V VSYG LTVQ+TE+ QV+QP  
Sbjct: 246 LMAEIENLTVQTDTPAKVVINERTGTIVIGADVRISRVAVSYGTLTVQVTESPQVIQPAP 305

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           F S G T  Q  TD+         ++++ PDL +L++G+NSIGLK DGII+ILQGIK+AG
Sbjct: 306 F-SRGETAVQPQTDIMALQEGSKVAIVEGPDLRTLVAGLNSIGLKADGIIAILQGIKSAG 364

Query: 361 ALQSEIIIQ 369
           ALQ+E+++Q
Sbjct: 365 ALQAELVLQ 373


>gi|222147573|ref|YP_002548530.1| flagellar basal body P-ring protein [Agrobacterium vitis S4]
 gi|254789288|sp|B9JRP8|FLGI_AGRVS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|221734561|gb|ACM35524.1| flagellar P-ring protein precursor [Agrobacterium vitis S4]
          Length = 371

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/346 (65%), Positives = 285/346 (82%), Gaps = 1/346 (0%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SRIKDV SLQ+GRDNQLIGYGLVVGLQ TGDSLRSSPFT+QSMR++LQNLGIST GG+  
Sbjct: 27  SRIKDVASLQAGRDNQLIGYGLVVGLQSTGDSLRSSPFTDQSMRAMLQNLGISTQGGQSS 86

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KNVAAVMVTA LPPF SPGSRID +++SLGDA+SLRGG L+MTSL GADG IYAVAQGS
Sbjct: 87  AKNVAAVMVTATLPPFGSPGSRIDATVSSLGDATSLRGGTLIMTSLSGADGQIYAVAQGS 146

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           VVVSG   +GQ+++  EG++T G++ NGAI+ERELP KFKDS +L+LQLRNPDFST++ +
Sbjct: 147 VVVSGFTAQGQAATVTEGVTTSGRVPNGAIIERELPSKFKDSVNLVLQLRNPDFSTSLGM 206

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
           A +IN+Y+   +  PIAEA DS+ V + KP   DL +LM+++E L VETDTPA+V+INER
Sbjct: 207 ARRINNYATATYGAPIAEARDSQEVVIQKPRTADLAQLMADIENLVVETDTPAKVVINER 266

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TGTIVIG +VR+SKV VSYG LTVQ+ E  QV+QP  FSS G+T TQ  TD+        
Sbjct: 267 TGTIVIGADVRVSKVAVSYGTLTVQVNETPQVIQPQPFSS-GTTATQPQTDISAQKTGDK 325

Query: 324 FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            +++D PDL +L++G+N+IG+K DGII+ILQGIK+AGALQ+E+++Q
Sbjct: 326 VAIVDGPDLRTLVAGLNNIGVKPDGIIAILQGIKSAGALQAELVLQ 371


>gi|227820860|ref|YP_002824830.1| flagellar basal body P-ring protein [Sinorhizobium fredii NGR234]
 gi|254789295|sp|C3MG26|FLGI_RHISN RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|227339859|gb|ACP24077.1| flagellar P-ring protein precursor [Sinorhizobium fredii NGR234]
          Length = 371

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 225/372 (60%), Positives = 290/372 (77%), Gaps = 4/372 (1%)

Query: 1   MIFRIA--FLIFSLIGLHEIS-AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLR 57
           M  R+    L F+L+    ++ A   SRIKDV SLQ+GRDNQLIGYGLVVGLQGTGDSLR
Sbjct: 1   MTMRVCKWLLTFALLFAATLTPAHSASRIKDVASLQAGRDNQLIGYGLVVGLQGTGDSLR 60

Query: 58  SSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           SSPFT+QS+R++LQNLGIST GG   ++NVAAV+VTA LPPFASPGSR+DV++ SLGDA+
Sbjct: 61  SSPFTDQSIRAMLQNLGISTQGGESRTRNVAAVLVTATLPPFASPGSRVDVTVGSLGDAT 120

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SLRGG LVMTSL GADG IYAVAQGS+VV+G   +G ++S  +G++T G++ NGAI+ERE
Sbjct: 121 SLRGGTLVMTSLSGADGQIYAVAQGSIVVTGFSAQGDAASLSQGVTTAGRVPNGAIIERE 180

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           LP KFKD  +L+LQLRNPDFSTA+ +A  IN ++  +F   IAEA DS++V V KP   D
Sbjct: 181 LPSKFKDGFNLVLQLRNPDFSTAVGMAAAINKFASAQFGGRIAEALDSQSVLVQKPKMAD 240

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           L RLM+++E L VETD PARV++NERTGTIVIG +VR+++V VSYG LTVQ+TE   VVQ
Sbjct: 241 LARLMADIENLVVETDVPARVVVNERTGTIVIGQDVRVNEVAVSYGTLTVQVTETPTVVQ 300

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           P  F S G T  + NT ++   + G+ ++++   L SL++G+NSIG+K DGII+ILQ IK
Sbjct: 301 PAPF-SRGETAVEPNTTIEAQSDGGTVAILNGSSLRSLVAGLNSIGVKPDGIIAILQSIK 359

Query: 358 AAGALQSEIIIQ 369
            AGALQ+E+++Q
Sbjct: 360 TAGALQAELVLQ 371


>gi|163758017|ref|ZP_02165105.1| flagellar basal-body P-ring protein [Hoeflea phototrophica DFL-43]
 gi|162284306|gb|EDQ34589.1| flagellar basal-body P-ring protein [Hoeflea phototrophica DFL-43]
          Length = 363

 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 220/346 (63%), Positives = 277/346 (80%), Gaps = 1/346 (0%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SRIKD+ SLQ+ RDNQLIGYGLVVGLQGTGD LR+SPFTEQS+R++LQNLGIST GG   
Sbjct: 19  SRIKDIASLQAARDNQLIGYGLVVGLQGTGDGLRNSPFTEQSLRAMLQNLGISTEGGATR 78

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           + NVAAV+VTANLPPFAS GSR+DV+++SLGDA+SLRGG LVMTSL GADG IYAVAQGS
Sbjct: 79  ANNVAAVIVTANLPPFASIGSRVDVTVSSLGDATSLRGGTLVMTSLSGADGQIYAVAQGS 138

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+VSG+  +G +++  +GI+T G++  GAI+ERE+P  FK    L+ QLRNPDFSTA+ +
Sbjct: 139 VIVSGIQAQGDAATLQQGIATSGRLPGGAIIEREIPTSFKSVGGLVYQLRNPDFSTAVGM 198

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
           AD IN+Y+  R+  PIAEA DS TV V KP   DL RL +E+E L VETDTPARV++NER
Sbjct: 199 ADVINAYAEARYDGPIAEARDSTTVAVRKPERADLARLTAELENLVVETDTPARVVVNER 258

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TGTIVIG++VR+S+V VS+G LTVQI E   VVQP+ F S+G T  +  TD+    + G 
Sbjct: 259 TGTIVIGNDVRVSRVAVSHGTLTVQINETPTVVQPSPF-SDGVTAIEPLTDITAGVDGGQ 317

Query: 324 FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            ++ID PDL SL++G+NSIG+  DGII+ILQGIK+AGAL +E+++Q
Sbjct: 318 VAIIDGPDLRSLVAGLNSIGVTPDGIIAILQGIKSAGALHAELVLQ 363


>gi|2275163|gb|AAB81415.1| FlgI [Sinorhizobium meliloti]
          Length = 372

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 224/352 (63%), Positives = 284/352 (80%), Gaps = 2/352 (0%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           SA   SRIKDV SLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT+QS+R++LQNLGIST 
Sbjct: 22  SAYAASRIKDVASLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTDQSIRAMLQNLGISTQ 81

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           GG   ++NVAAV+VTA LPPFASPGSR+DV++ SLGDA+SLRGG LVMTSL GADG IYA
Sbjct: 82  GGDSRTRNVAAVLVTATLPPFASPGSRLDVTVGSLGDATSLRGGTLVMTSLSGADGQIYA 141

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           VAQGSVVVSG   +G+++   +G++T G++ NGAI+ERELP KFKD  +L+LQLRNPDFS
Sbjct: 142 VAQGSVVVSGFNAQGEAAQLSQGVTTAGRVPNGAIIERELPSKFKDGFNLVLQLRNPDFS 201

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARV 258
           TA+ +A  IN Y+  +F   IAEA DS++V V KP   DL RLM++VE L +ETD PARV
Sbjct: 202 TAVGMAAAINRYAAAQFGGRIAEALDSQSVLVQKPKMADLARLMADVENLVIETDAPARV 261

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV- 317
           +INERTGTIVIG +VR+++V VSYG LTVQ++E   +VQP  F S G T  + NT ++  
Sbjct: 262 VINERTGTIVIGQDVRVAEVAVSYGTLTVQVSETPTIVQPEPF-SRGETAYEPNTTIEAQ 320

Query: 318 SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +D +G+ ++++   L SL++G+NSIG+K DGII+ILQ IK+AGALQ+E+++Q
Sbjct: 321 ADGRGTVAILNGSSLRSLVAGLNSIGVKPDGIIAILQSIKSAGALQAELVLQ 372


>gi|15964417|ref|NP_384770.1| flagellar basal body P-ring protein [Sinorhizobium meliloti 1021]
 gi|307311559|ref|ZP_07591200.1| flagellar P-ring protein [Sinorhizobium meliloti BL225C]
 gi|307318914|ref|ZP_07598345.1| flagellar P-ring protein [Sinorhizobium meliloti AK83]
 gi|17380482|sp|Q52948|FLGI_RHIME RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|15073594|emb|CAC45236.1| Flagellar P-ring precursor transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|306895328|gb|EFN26083.1| flagellar P-ring protein [Sinorhizobium meliloti AK83]
 gi|306899576|gb|EFN30205.1| flagellar P-ring protein [Sinorhizobium meliloti BL225C]
          Length = 371

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 223/351 (63%), Positives = 282/351 (80%), Gaps = 1/351 (0%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           SA   SRIKDV SLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT+QS+R++LQNLGIST 
Sbjct: 22  SAYAASRIKDVASLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTDQSIRAMLQNLGISTQ 81

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           GG   ++NVAAV+VTA LPPFASPGSR+DV++ SLGDA+SLRGG LVMTSL GADG IYA
Sbjct: 82  GGDSRTRNVAAVLVTATLPPFASPGSRLDVTVGSLGDATSLRGGTLVMTSLSGADGQIYA 141

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           VAQGSVVVSG   +G+++   +G++T G++ NGAI+ERELP KFKD  +L+LQLRNPDFS
Sbjct: 142 VAQGSVVVSGFNAQGEAAQLSQGVTTAGRVPNGAIIERELPSKFKDGFNLVLQLRNPDFS 201

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARV 258
           TA+ +A  IN Y+  +F   IAEA DS++V V KP   DL RLM++VE L +ETD PARV
Sbjct: 202 TAVGMAAAINRYAAAQFGGRIAEALDSQSVLVQKPKMADLARLMADVENLVIETDAPARV 261

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           +INERTGTIVIG +VR+++V VSYG LTVQ++E   +VQP  F S G T  + NT ++  
Sbjct: 262 VINERTGTIVIGQDVRVAEVAVSYGTLTVQVSETPTIVQPEPF-SRGETAYEPNTTIEAQ 320

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            + G+ ++++   L SL++G+NSIG+K DGII+ILQ IK+AGALQ+E+++Q
Sbjct: 321 ADGGTVAILNGSSLRSLVAGLNSIGVKPDGIIAILQSIKSAGALQAELVLQ 371


>gi|150395487|ref|YP_001325954.1| flagellar basal body P-ring protein [Sinorhizobium medicae WSM419]
 gi|166214841|sp|A6U639|FLGI_SINMW RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|150027002|gb|ABR59119.1| flagellar P-ring protein [Sinorhizobium medicae WSM419]
          Length = 371

 Score =  441 bits (1134), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 222/351 (63%), Positives = 282/351 (80%), Gaps = 1/351 (0%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           SA   SRIKDV SLQ+GRDNQLIGYGLVVGLQGTGDSLRSSPFT+QS+R++LQNLGIST 
Sbjct: 22  SAYAASRIKDVASLQAGRDNQLIGYGLVVGLQGTGDSLRSSPFTDQSIRAMLQNLGISTQ 81

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           GG   ++NVAAV+VTA LPPFASPGSR+DV++ SLGDA+SLRGG LVMTSL GADG IYA
Sbjct: 82  GGDSRTRNVAAVLVTATLPPFASPGSRLDVTVGSLGDATSLRGGTLVMTSLSGADGQIYA 141

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           VAQGSVVVSG   +G+++   +G++T G++ NGAI+ERELP KFKD  +L+LQLRNPDFS
Sbjct: 142 VAQGSVVVSGFNAQGEAAQLNQGVTTAGRVPNGAIIERELPSKFKDGFNLVLQLRNPDFS 201

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARV 258
           TA+ +A  IN Y+  +F   IAEA DS++V V KP   DL RLM++VE L +ETD PARV
Sbjct: 202 TAVGMAAAINRYAAAQFGGRIAEALDSQSVLVQKPKMADLARLMADVENLVIETDAPARV 261

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           +INERTGTIVIG +VR+++V VSYG LTVQ++E   +VQP  F S G T  + NT ++  
Sbjct: 262 VINERTGTIVIGQDVRVAQVAVSYGTLTVQVSETPTIVQPEPF-SRGQTAYEPNTTIEAQ 320

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            + G+ ++++   L SL++G+NSIG+K DGII+ILQ IK+AGALQ+E+++Q
Sbjct: 321 SDGGTVAILNGSSLRSLVAGLNSIGVKPDGIIAILQSIKSAGALQAELVLQ 371


>gi|260466617|ref|ZP_05812805.1| flagellar P-ring protein [Mesorhizobium opportunistum WSM2075]
 gi|259029623|gb|EEW30911.1| flagellar P-ring protein [Mesorhizobium opportunistum WSM2075]
          Length = 413

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/349 (57%), Positives = 267/349 (76%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
           QV SRIKD+  LQS RDNQL+GYGLV+GL G+GDSLR+SPFTEQS+R++L+NLGI+T GG
Sbjct: 66  QVASRIKDIAQLQSSRDNQLVGYGLVIGLAGSGDSLRNSPFTEQSIRAMLENLGIATEGG 125

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              +KNVAAV+VTAN+PP+   G+RID+ ++S+GDA+SL GG L+MT L  ADG IYAV 
Sbjct: 126 SARAKNVAAVIVTANMPPYVQSGARIDIDVSSMGDATSLAGGTLIMTPLKAADGEIYAVG 185

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+V+VSG   +GQ+    +G+ T G++ NGAIVER +  +F D A L LQLRNPDFSTA
Sbjct: 186 QGAVIVSGFTAQGQAEQLTQGVPTAGRVPNGAIVERSVKAEFDDQAILTLQLRNPDFSTA 245

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           IRIAD IN Y+  RF   +A   DSRTV++ +P N+   R  +E+E L VE+DTPARV+I
Sbjct: 246 IRIADAINDYTSQRFGMRVAGERDSRTVQIRRPKNVSAARFYAEIENLVVESDTPARVVI 305

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGTIVIG++V+IS+V +S+G LTV+ITE  +VVQP  F S G T  +  T +  S  
Sbjct: 306 DERTGTIVIGNDVKISRVAISHGTLTVRITEAPRVVQPEPF-SKGETAVEPFTAIDASRP 364

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
               +++D PDL +L+SG+N +G+K DGII+ILQGIK+AGALQ+++++Q
Sbjct: 365 DARVAVLDGPDLQTLVSGLNRLGVKPDGIIAILQGIKSAGALQADLVLQ 413


>gi|319781679|ref|YP_004141155.1| flagellar P-ring protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167567|gb|ADV11105.1| flagellar P-ring protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 413

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/349 (57%), Positives = 266/349 (76%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
           QV SRIKD+  LQS RDNQL+GYGLV+GL G+GDSLR+SPFTEQS+R++L+NLGI+T GG
Sbjct: 66  QVASRIKDIAQLQSSRDNQLVGYGLVIGLAGSGDSLRNSPFTEQSIRAMLENLGIATEGG 125

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              +KNVAAV+VTAN+PP+   G+RID+ ++S+GDA+SL GG L+MT L  ADG IYAV 
Sbjct: 126 SARAKNVAAVIVTANMPPYVQSGARIDIDVSSMGDATSLSGGTLIMTPLKAADGEIYAVG 185

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QGSV+VSG   +GQ+    +G+ T G++ NGAIVER +  +F D A L LQLRNPDFSTA
Sbjct: 186 QGSVIVSGFTAQGQAEQLTQGVPTAGRVPNGAIVERAVQAEFDDQAILTLQLRNPDFSTA 245

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           IRIAD IN Y+  RF   +A   DSRTV++ +P  +   R  +E+E L VE+DTPARV+I
Sbjct: 246 IRIADAINDYTGQRFGMRVAAERDSRTVQIRRPKGVSAARFYAEIENLVVESDTPARVVI 305

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGTIVIG++V+IS+V +S+G LTV+ITE  +VVQP  F S G T  +  T +  S  
Sbjct: 306 DERTGTIVIGNDVKISRVAISHGTLTVRITEAPRVVQPEPF-SKGETAIEPFTAIDASRP 364

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
               +++D PDL +L+SG+N +G+K DGII+ILQGIK+AGALQ+++++Q
Sbjct: 365 DARVAVLDGPDLQTLVSGLNRLGVKPDGIIAILQGIKSAGALQADLVLQ 413


>gi|13472578|ref|NP_104145.1| flagellar basal body P-ring protein [Mesorhizobium loti MAFF303099]
 gi|14023324|dbj|BAB49931.1| flagellar P-ring protein; FlgI [Mesorhizobium loti MAFF303099]
          Length = 362

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/349 (56%), Positives = 266/349 (76%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
           QV SRIKD+  LQS RDNQL+GYGLV+GL G+GDSLR+SPFTEQS+R++L+NLGI+T GG
Sbjct: 15  QVASRIKDIAQLQSSRDNQLVGYGLVIGLAGSGDSLRNSPFTEQSIRAMLENLGIATEGG 74

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              +KNVAAV+VTAN+PP+   G+RID+ ++S+GDA+SL GG L+MT L  ADG IYAV 
Sbjct: 75  SARAKNVAAVIVTANMPPYVQSGARIDIDVSSMGDATSLAGGTLIMTPLKAADGEIYAVG 134

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+V+VSG   KGQ+    +G+ T G++ NGAIVER +  +F D + L LQLRNPDFSTA
Sbjct: 135 QGAVIVSGFTAKGQAEQLTQGVPTAGRVPNGAIVERSVKAEFDDQSTLTLQLRNPDFSTA 194

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           IRIAD IN Y+  RF   +A   DSRTV++ +P  +   R  +E+E L VE+DTPARV+I
Sbjct: 195 IRIADAINDYTSQRFGMRVAGERDSRTVQIRRPKGVSAARFYAEIENLVVESDTPARVVI 254

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGTIVIG++V+IS+V +S+G LTV+ITE  +VVQP  F S G T  +  T +  +  
Sbjct: 255 DERTGTIVIGNDVKISRVAISHGTLTVRITEAPRVVQPEPF-SKGETAVEPFTAIDATRP 313

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
               +++D PDL +L+SG+N +G+K DGII+ILQGIK+AGALQ+++++Q
Sbjct: 314 DARVAVLDGPDLQTLVSGLNRLGVKPDGIIAILQGIKSAGALQADLVLQ 362


>gi|110632654|ref|YP_672862.1| flagellar basal body P-ring protein [Mesorhizobium sp. BNC1]
 gi|110283638|gb|ABG61697.1| flagellar P-ring protein [Chelativorans sp. BNC1]
          Length = 369

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/371 (54%), Positives = 270/371 (72%), Gaps = 4/371 (1%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSR--IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS 58
           MI R AFL   ++ L    A   S+  IK +  LQ+ RDNQL+GYGLV+GL  TGDSLR+
Sbjct: 1   MILR-AFLWGLMLFLAAAPAGAASKTQIKHIAQLQAARDNQLVGYGLVIGLNRTGDSLRN 59

Query: 59  SPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           +PFTEQSMR++LQNLGI++  GR  ++NVAAV+VTANLPPF   G+RIDV+++SLGDASS
Sbjct: 60  APFTEQSMRAMLQNLGIASEDGRSRAENVAAVIVTANLPPFVQSGARIDVTVSSLGDASS 119

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           L GG LVMT L  ADG IYAVAQGSV+VSG   +GQ+ +  +G+ T G++ NGAI+ER +
Sbjct: 120 LAGGTLVMTPLRAADGEIYAVAQGSVIVSGFNAQGQAETLTQGVPTSGRVPNGAIIERSV 179

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL 238
              F +   L LQLRNPDFSTA+R+AD +N+Y+   F  P+A   DSRTV + KP  +  
Sbjct: 180 TASFDELLALTLQLRNPDFSTAVRVADVVNAYTSRHFGAPLASEQDSRTVIIKKPKGVSA 239

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
            R  +++E L VE D PARV+++ERTGT+VIG +VRIS+V +S+G LTV++TE  +VVQP
Sbjct: 240 ARFYAQIENLPVEVDAPARVVVDERTGTVVIGSDVRISRVAISHGALTVRVTEMPRVVQP 299

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
             F S G T  +  T +  +    S +++D PDL +L+SG+N +G+K DGII+ILQGIK+
Sbjct: 300 EPF-SRGETAVEPYTVIDATQPDASVAVLDGPDLQTLVSGLNRLGVKPDGIIAILQGIKS 358

Query: 359 AGALQSEIIIQ 369
           AGALQ E+++Q
Sbjct: 359 AGALQGELVLQ 369


>gi|254720608|ref|ZP_05182419.1| flagellar basal body P-ring protein [Brucella sp. 83/13]
 gi|265985648|ref|ZP_06098383.1| flagellar basal body P-ring protein [Brucella sp. 83/13]
 gi|306838570|ref|ZP_07471407.1| flagellar basal body P-ring protein [Brucella sp. NF 2653]
 gi|264664240|gb|EEZ34501.1| flagellar basal body P-ring protein [Brucella sp. 83/13]
 gi|306406356|gb|EFM62598.1| flagellar basal body P-ring protein [Brucella sp. NF 2653]
          Length = 409

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/347 (53%), Positives = 264/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 64  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 123

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 124 RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 183

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 184 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVR 243

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 244 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 303

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+GNLTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 304 RTGTVVIGEKVRISKVAISHGNLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQNA 362

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 363 KIGILTGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 409


>gi|163844348|ref|YP_001622003.1| flagellar basal body P-ring protein [Brucella suis ATCC 23445]
 gi|163675071|gb|ABY39181.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 444

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 264/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 99  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 158

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 159 RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 218

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 219 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVR 278

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 279 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 338

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 339 RTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQNA 397

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 398 KIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 444


>gi|161620238|ref|YP_001594124.1| flagellar basal body P-ring protein [Brucella canis ATCC 23365]
 gi|225686014|ref|YP_002733986.1| flagellar basal body P-ring protein [Brucella melitensis ATCC
           23457]
 gi|254702578|ref|ZP_05164406.1| flagellar basal body P-ring protein [Brucella suis bv. 3 str. 686]
 gi|254706290|ref|ZP_05168118.1| flagellar basal body P-ring protein [Brucella pinnipedialis
           M163/99/10]
 gi|254711416|ref|ZP_05173227.1| flagellar basal body P-ring protein [Brucella pinnipedialis B2/94]
 gi|254712015|ref|ZP_05173826.1| flagellar basal body P-ring protein [Brucella ceti M644/93/1]
 gi|254715084|ref|ZP_05176895.1| flagellar basal body P-ring protein [Brucella ceti M13/05/1]
 gi|256014944|ref|YP_003104953.1| flagellar P-ring protein precursor [Brucella microti CCM 4915]
 gi|256029954|ref|ZP_05443568.1| flagellar basal body P-ring protein [Brucella pinnipedialis
           M292/94/1]
 gi|256111941|ref|ZP_05452892.1| flagellar basal body P-ring protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158116|ref|ZP_05456034.1| flagellar basal body P-ring protein [Brucella ceti M490/95/1]
 gi|256252930|ref|ZP_05458466.1| flagellar basal body P-ring protein [Brucella ceti B1/94]
 gi|256262863|ref|ZP_05465395.1| flagellar basal body P-ring protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260568514|ref|ZP_05838983.1| flagellar basal body P-ring protein [Brucella suis bv. 4 str. 40]
 gi|261216794|ref|ZP_05931075.1| flagellar basal body P-ring protein [Brucella ceti M13/05/1]
 gi|261220021|ref|ZP_05934302.1| flagellar basal body P-ring protein [Brucella ceti B1/94]
 gi|261313734|ref|ZP_05952931.1| flagellar basal body P-ring protein [Brucella pinnipedialis
           M163/99/10]
 gi|261319024|ref|ZP_05958221.1| flagellar basal body P-ring protein [Brucella pinnipedialis B2/94]
 gi|261319661|ref|ZP_05958858.1| flagellar basal body P-ring protein [Brucella ceti M644/93/1]
 gi|261753158|ref|ZP_05996867.1| flagellar basal body P-ring protein [Brucella suis bv. 3 str. 686]
 gi|265986973|ref|ZP_06099530.1| flagellar basal body P-ring protein [Brucella pinnipedialis
           M292/94/1]
 gi|265993388|ref|ZP_06105945.1| flagellar basal body P-ring protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996633|ref|ZP_06109190.1| flagellar basal body P-ring protein [Brucella ceti M490/95/1]
 gi|161337049|gb|ABX63353.1| Flagellar P-ring protein 1 precursor [Brucella canis ATCC 23365]
 gi|225642119|gb|ACO02032.1| Flagellar P-ring protein 1 precursor [Brucella melitensis ATCC
           23457]
 gi|255997604|gb|ACU49291.1| flagellar P-ring protein precursor [Brucella microti CCM 4915]
 gi|260155179|gb|EEW90260.1| flagellar basal body P-ring protein [Brucella suis bv. 4 str. 40]
 gi|260918605|gb|EEX85258.1| flagellar basal body P-ring protein [Brucella ceti B1/94]
 gi|260921883|gb|EEX88451.1| flagellar basal body P-ring protein [Brucella ceti M13/05/1]
 gi|261292351|gb|EEX95847.1| flagellar basal body P-ring protein [Brucella ceti M644/93/1]
 gi|261298247|gb|EEY01744.1| flagellar basal body P-ring protein [Brucella pinnipedialis B2/94]
 gi|261302760|gb|EEY06257.1| flagellar basal body P-ring protein [Brucella pinnipedialis
           M163/99/10]
 gi|261742911|gb|EEY30837.1| flagellar basal body P-ring protein [Brucella suis bv. 3 str. 686]
 gi|262550930|gb|EEZ07091.1| flagellar basal body P-ring protein [Brucella ceti M490/95/1]
 gi|262764258|gb|EEZ10290.1| flagellar basal body P-ring protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263092698|gb|EEZ16907.1| flagellar basal body P-ring protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264659170|gb|EEZ29431.1| flagellar basal body P-ring protein [Brucella pinnipedialis
           M292/94/1]
 gi|326410337|gb|ADZ67401.1| flagellar basal body P-ring protein [Brucella melitensis M28]
 gi|326553629|gb|ADZ88268.1| flagellar basal body P-ring protein [Brucella melitensis M5-90]
          Length = 444

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 264/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 99  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 158

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 159 RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 218

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 219 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVR 278

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 279 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 338

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 339 RTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQNA 397

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 398 KIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 444


>gi|254691410|ref|ZP_05154664.1| flagellar basal body P-ring protein [Brucella abortus bv. 6 str.
           870]
 gi|254695292|ref|ZP_05157120.1| flagellar basal body P-ring protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|256256596|ref|ZP_05462132.1| flagellar basal body P-ring protein [Brucella abortus bv. 9 str.
           C68]
 gi|260757024|ref|ZP_05869372.1| flagellar basal body P-ring protein [Brucella abortus bv. 6 str.
           870]
 gi|260882834|ref|ZP_05894448.1| flagellar basal body P-ring protein [Brucella abortus bv. 9 str.
           C68]
 gi|261215661|ref|ZP_05929942.1| flagellar basal body P-ring protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|297249952|ref|ZP_06933653.1| flagellar P-ring protein precursor FlgI [Brucella abortus bv. 5
           str. B3196]
 gi|260677132|gb|EEX63953.1| flagellar basal body P-ring protein [Brucella abortus bv. 6 str.
           870]
 gi|260872362|gb|EEX79431.1| flagellar basal body P-ring protein [Brucella abortus bv. 9 str.
           C68]
 gi|260917268|gb|EEX84129.1| flagellar basal body P-ring protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|297173821|gb|EFH33185.1| flagellar P-ring protein precursor FlgI [Brucella abortus bv. 5
           str. B3196]
          Length = 444

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 264/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 99  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 158

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 159 RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 218

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 219 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVR 278

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 279 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 338

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 339 RTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQNA 397

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 398 KIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 444


>gi|23463495|gb|AAN33363.1| flagellar P-ring protein FlgI [Brucella suis 1330]
          Length = 444

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 264/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 99  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 158

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 159 RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 218

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 219 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVR 278

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 279 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 338

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 339 RTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQNA 397

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 398 KIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 444


>gi|225628627|ref|ZP_03786661.1| Flagellar P-ring protein 1 precursor [Brucella ceti str. Cudo]
 gi|225616473|gb|EEH13521.1| Flagellar P-ring protein 1 precursor [Brucella ceti str. Cudo]
          Length = 457

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 264/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 112 VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 171

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 172 RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 231

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 232 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVR 291

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 292 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 351

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 352 RTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQNA 410

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 411 KIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 457


>gi|153011522|ref|YP_001372736.1| flagellar basal body P-ring protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151563410|gb|ABS16907.1| flagellar P-ring protein [Ochrobactrum anthropi ATCC 49188]
          Length = 413

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 264/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 68  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 127

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 128 RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 187

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 188 NMIVSGFAAEGEAASVTQGVPTSGRIPNGALVEREVAGNFGKETEMIVELRDPDFTTAVR 247

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 248 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 307

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 308 RTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGVTAVEPNTDIAVNQQNA 366

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 367 KIGILTGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 413


>gi|239834440|ref|ZP_04682768.1| Flagellar P-ring protein 1 precursor [Ochrobactrum intermedium LMG
           3301]
 gi|239822503|gb|EEQ94072.1| Flagellar P-ring protein 1 precursor [Ochrobactrum intermedium LMG
           3301]
          Length = 409

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 265/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 64  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 123

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 124 RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 183

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F   +++I++LR+PDF+TA+R
Sbjct: 184 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGNFGKESEMIVELRDPDFTTAVR 243

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 244 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 303

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 304 RTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGVTAVEPNTDIAVNQQNA 362

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 363 KIGILTGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 409


>gi|17989429|ref|NP_542062.1| flagellar basal body P-ring protein [Brucella melitensis bv. 1 str.
           16M]
 gi|161486704|ref|NP_699358.2| flagellar basal body P-ring protein [Brucella suis 1330]
 gi|17985306|gb|AAL54326.1| flagellar p-ring protein flgi [Brucella melitensis bv. 1 str. 16M]
          Length = 357

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 264/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 12  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 71

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 72  RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 131

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 132 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVR 191

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 192 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 251

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 252 RTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQNA 310

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 311 KIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 357


>gi|260564305|ref|ZP_05834790.1| flagellar basal body P-ring protein [Brucella melitensis bv. 1 str.
           16M]
 gi|260151948|gb|EEW87041.1| flagellar basal body P-ring protein [Brucella melitensis bv. 1 str.
           16M]
          Length = 413

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 264/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 68  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 127

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 128 RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 187

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 188 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVR 247

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 248 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 307

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 308 RTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQNA 366

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 367 KIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 413


>gi|294853178|ref|ZP_06793850.1| flagellar P-ring protein FlgI [Brucella sp. NVSL 07-0026]
 gi|294818833|gb|EFG35833.1| flagellar P-ring protein FlgI [Brucella sp. NVSL 07-0026]
          Length = 380

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 264/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 35  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 94

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 95  RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 154

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 155 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVR 214

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 215 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 274

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 275 RTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQNA 333

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 334 KIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 380


>gi|256043075|ref|ZP_05446019.1| flagellar basal body P-ring protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265989513|ref|ZP_06102070.1| flagellar basal body P-ring protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263000182|gb|EEZ12872.1| flagellar basal body P-ring protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 405

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 264/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 60  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 119

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 120 RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 179

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 180 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVR 239

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 240 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 299

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 300 RTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQNA 358

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 359 KIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 405


>gi|306846276|ref|ZP_07478837.1| flagellar basal body P-ring protein [Brucella sp. BO1]
 gi|306273271|gb|EFM55140.1| flagellar basal body P-ring protein [Brucella sp. BO1]
          Length = 409

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 264/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 64  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 123

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 124 RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 183

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 184 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVR 243

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 244 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 303

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 304 RTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAYEPNTDIAVNQQNA 362

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 363 KIGILTGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 409


>gi|306841047|ref|ZP_07473771.1| flagellar basal body P-ring protein [Brucella sp. BO2]
 gi|306288936|gb|EFM60236.1| flagellar basal body P-ring protein [Brucella sp. BO2]
          Length = 409

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/347 (52%), Positives = 264/347 (76%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 64  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 123

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP F+  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 124 RSKNTAAVIVTANLPAFSGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 183

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 184 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVR 243

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV+++E
Sbjct: 244 AADTINIFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVVDE 303

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+    
Sbjct: 304 RTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAYEPNTDIAVNQQNA 362

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 363 KIGILTGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 409


>gi|254473496|ref|ZP_05086893.1| flagellar P-ring protein FlgI [Pseudovibrio sp. JE062]
 gi|211957612|gb|EEA92815.1| flagellar P-ring protein FlgI [Pseudovibrio sp. JE062]
          Length = 374

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/363 (50%), Positives = 258/363 (71%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           +L F  + L   SA  + RIKD+  L+  R NQL+GYG+V+GL G+GD++R+SPFTEQS+
Sbjct: 12  YLAFLALFLSFDSASALVRIKDIADLRGMRSNQLVGYGIVIGLNGSGDTMRNSPFTEQSL 71

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           +S+L+ +G++     L S+NVAAV+VTA LPPF   G+RIDVS+ SLGDA SL+GG L++
Sbjct: 72  QSMLERMGVNVREANLSSRNVAAVVVTAELPPFIGNGARIDVSVGSLGDAKSLQGGTLLV 131

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L+GADGN+YAVAQGSV VSG   +G + S  +G+ T G + NGA++E+ LP  F    
Sbjct: 132 TPLMGADGNVYAVAQGSVSVSGFSAEGDAGSLTQGVPTAGNVPNGALIEKTLPDYFSSMP 191

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVE 246
            L+L+L+NPDF TA+R+ D IN++SLNR+   +A   D R+V+V +P  I   R +S++E
Sbjct: 192 QLVLELKNPDFKTAVRVTDAINAFSLNRYGLKLASELDYRSVQVQRPAGISSVRFISQIE 251

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            L V+ DTPARV+++ERTGT+VIG NVRIS V V++GNLTV+++E  +V QPN F+  G 
Sbjct: 252 GLMVQPDTPARVVVDERTGTVVIGQNVRISTVAVTHGNLTVRVSERPEVSQPNPFAQQGE 311

Query: 307 TVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           T     TD+ +    G   LI   DL +L+ G+N IGLK  GII+ILQ IK AGALQ+ +
Sbjct: 312 TTVVPRTDIDIQQEDGQLQLIGGTDLQTLVRGLNRIGLKPSGIIAILQAIKQAGALQATL 371

Query: 367 IIQ 369
           +++
Sbjct: 372 VVK 374


>gi|170741838|ref|YP_001770493.1| flagellar basal body P-ring protein [Methylobacterium sp. 4-46]
 gi|168196112|gb|ACA18059.1| flagellar P-ring protein [Methylobacterium sp. 4-46]
          Length = 370

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 256/346 (73%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+ +LQ  RDNQL+GYGLV GLQGTGD+LR++ FTEQS++S+L  +G++    RL 
Sbjct: 25  TRIKDIAALQGVRDNQLVGYGLVTGLQGTGDTLRNAQFTEQSLQSMLDRMGVNVRDSRLR 84

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           ++NVAAVMVTA+LPP+A+ GSRIDV++ SLGDA+SL+GG L+MT L G DG +YA AQG 
Sbjct: 85  TRNVAAVMVTADLPPYATVGSRIDVTVTSLGDATSLKGGTLLMTPLSGGDGQVYAAAQGP 144

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + VSG  V GQ+ +  +G+ T G+I NGA++ER++P   +D   L+L+L+NPDF TA  I
Sbjct: 145 MAVSGFSVGGQAETVTQGVPTAGRIPNGALIERQVPGSLQDLPQLVLELKNPDFKTATLI 204

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
            D +N+Y+L RF R +A   D R+V + KP  I  TR ++EV  LT++ DTPARV++++R
Sbjct: 205 VDAVNAYALQRFGRRVAIPRDQRSVVLHKPPAIAQTRFIAEVGDLTIQPDTPARVVVDQR 264

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TGT+VIG NV+IS V V++GNLTV++TE  +V QPN  S NG TV    T++   + +G 
Sbjct: 265 TGTVVIGRNVQISTVAVTHGNLTVRVTETPEVSQPNPSSRNGQTVVVPRTEVSAQEQQGR 324

Query: 324 FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            +++   DL +L+ G+N +GLK   II+ILQ +K AGALQ+E+++Q
Sbjct: 325 LAVLGGSDLQTLVKGLNQVGLKPSDIIAILQAVKTAGALQAELVVQ 370


>gi|118589979|ref|ZP_01547383.1| flagellar P-ring protein precursor I [Stappia aggregata IAM 12614]
 gi|118437476|gb|EAV44113.1| flagellar P-ring protein precursor I [Stappia aggregata IAM 12614]
          Length = 368

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/369 (51%), Positives = 268/369 (72%), Gaps = 1/369 (0%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           MI  + F++ +L+ L  +SA  + RIKD+ SLQ  RDNQL+GYGLV+GL+G+GD+LR+SP
Sbjct: 1   MIRVLVFVLAALLAL-PVSAMSMVRIKDIASLQGVRDNQLVGYGLVIGLKGSGDTLRNSP 59

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTEQS++S+L +LG++    RL ++NVAAV+VTA +P F   GS IDVS++SLGDA+SL 
Sbjct: 60  FTEQSLQSMLDSLGVNVRDARLRTRNVAAVVVTAEMPSFIGQGSTIDVSVSSLGDATSLA 119

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+ T LLGADG IYAVAQG V VSG    GQ+ S  +GI T G++ NG ++ER+LP 
Sbjct: 120 GGTLIATPLLGADGQIYAVAQGPVAVSGFAELGQAESLTQGIPTVGRVPNGGLIERDLPA 179

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           KF    +L+L+L NPDF TA+RIAD IN ++  R+   +A+  D RTV ++ P NI +TR
Sbjct: 180 KFSQIPNLVLELSNPDFRTAVRIADAINQFTRERYGIKVAKERDYRTVVLTPPQNISVTR 239

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
            ++E+E + V  D  A+V+I+ERTGT+VIG +V+IS V +++GNLTV+I+E  +V QP+ 
Sbjct: 240 FIAEIEAIRVTPDQTAKVVIDERTGTVVIGKDVQISTVAITHGNLTVRISEAPEVSQPSP 299

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           FS NG TV    T +   ++ G  +++   DL +L+ G+N IGL+  GII+ILQ IK AG
Sbjct: 300 FSQNGQTVVVPRTYVDAQESGGQLAVVGGTDLPTLVRGLNRIGLRPTGIIAILQAIKTAG 359

Query: 361 ALQSEIIIQ 369
           ALQ+E+++Q
Sbjct: 360 ALQAELVVQ 368


>gi|240137199|ref|YP_002961668.1| flagella basal body P-ring protein [Methylobacterium extorquens
           AM1]
 gi|240007165|gb|ACS38391.1| flagella basal body P-ring protein [Methylobacterium extorquens
           AM1]
          Length = 375

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/346 (52%), Positives = 255/346 (73%), Gaps = 1/346 (0%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+ +L+  RDNQL GYGLV GLQGTGD+LR++ FTEQS++SLL  LGI+    RL 
Sbjct: 31  TRIKDIATLKGVRDNQLFGYGLVTGLQGTGDTLRNAQFTEQSLQSLLDRLGINVRDARLR 90

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           ++N+AAVMVTA+LPP+   GSRIDV++ S+GDA+SLRGG L+MTSL G DG +YA AQG 
Sbjct: 91  TRNIAAVMVTADLPPYTGTGSRIDVTVTSMGDATSLRGGTLLMTSLTGGDGLVYAAAQGP 150

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + VSG  V+GQ+    +G+ T G+I NGA++ERE+P  F+D  +L+ +L+NPDF TA +I
Sbjct: 151 LAVSGFSVQGQAEQLTQGVPTAGRIPNGAMIEREVPGTFRDLPELVFELKNPDFKTATQI 210

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
           AD IN++SL  F R IA A D R V V +   +  TRL++++  LT++ DTPARV++++R
Sbjct: 211 ADAINAWSLGAFGRRIASARDQRAVVVMRGRQMAQTRLVAQIGDLTIQPDTPARVVVDQR 270

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TGT+VIG NV IS V V++GNLTV++TE  +V QP  F SNG TV    T++   + +G 
Sbjct: 271 TGTVVIGRNVTISTVAVTHGNLTVRVTEAPEVSQPEPF-SNGQTVVVPRTEVSAREERGK 329

Query: 324 FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            +++   DL +L+ G+N +GLK   II+ILQ +K AGALQ+E+++Q
Sbjct: 330 LAILGGSDLQTLVRGLNQVGLKPTDIIAILQAVKTAGALQAELVVQ 375


>gi|163850065|ref|YP_001638108.1| flagellar basal body P-ring protein [Methylobacterium extorquens
           PA1]
 gi|163661670|gb|ABY29037.1| flagellar P-ring protein [Methylobacterium extorquens PA1]
          Length = 375

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 255/346 (73%), Gaps = 1/346 (0%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+ +L+  RDNQL GYGLV GLQGTGD+LR++ FTEQS++SLL  LGI+    RL 
Sbjct: 31  TRIKDIATLKGVRDNQLFGYGLVTGLQGTGDTLRNAQFTEQSLQSLLDRLGINVRDARLR 90

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           ++N+AAVMVTA+LPP+   GSRIDV++ S+GDA+SLRGG L+MTSL G DG +YA AQG 
Sbjct: 91  TRNIAAVMVTADLPPYTGTGSRIDVTVTSMGDATSLRGGTLLMTSLTGGDGLVYAAAQGP 150

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + VSG  V+GQ+    +G+ T G+I NGA++ERE+P  F+D  +L+ +L+NPDF TA +I
Sbjct: 151 LAVSGFSVQGQAEQLTQGVPTAGRIPNGAMIEREVPGTFRDLPELVFELKNPDFKTATQI 210

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
           +D IN++SL  F R IA A D R V V +   +  TRL++++  LT++ DTPARV++++R
Sbjct: 211 SDAINAWSLGAFGRRIASARDQRAVVVMRGRQMAQTRLVAQIGDLTIQPDTPARVVVDQR 270

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TGT+VIG NV IS V V++GNLTV++TE  +V QP  F SNG TV    T++   + +G 
Sbjct: 271 TGTVVIGRNVTISTVAVTHGNLTVRVTEAPEVSQPEGF-SNGQTVVVPRTEVSAREERGK 329

Query: 324 FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            +++   DL +L+ G+N +GLK   II+ILQ +K AGALQ+E+++Q
Sbjct: 330 LAILGGSDLQTLVRGLNQVGLKPTDIIAILQAVKTAGALQAELVVQ 375


>gi|218528668|ref|YP_002419484.1| flagellar basal body P-ring protein [Methylobacterium
           chloromethanicum CM4]
 gi|254559211|ref|YP_003066306.1| flagella basal body P-ring protein [Methylobacterium extorquens
           DM4]
 gi|218520971|gb|ACK81556.1| flagellar P-ring protein [Methylobacterium chloromethanicum CM4]
 gi|254266489|emb|CAX22253.1| flagella basal body P-ring protein [Methylobacterium extorquens
           DM4]
          Length = 375

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 255/346 (73%), Gaps = 1/346 (0%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+ +L+  RDNQL GYGLV GLQGTGD+LR++ FTEQS++SLL  LGI+    RL 
Sbjct: 31  TRIKDIATLKGVRDNQLFGYGLVTGLQGTGDTLRNAQFTEQSLQSLLDRLGINVRDARLR 90

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           ++N+AAVMVTA+LPP+   GSRIDV++ S+GDA+SLRGG L+MTSL G DG +YA AQG 
Sbjct: 91  TRNIAAVMVTADLPPYTGTGSRIDVTVTSMGDATSLRGGTLLMTSLTGGDGLVYAAAQGP 150

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + VSG  V+GQ+    +G+ T G+I NGA++ERE+P  F+D  +L+ +L+NPDF TA +I
Sbjct: 151 LAVSGFSVQGQAEQLTQGVPTAGRIPNGAMIEREVPGTFRDLPELVFELKNPDFKTATQI 210

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
           +D IN++SL  F R IA A D R V V +   +  TRL++++  LT++ DTPARV++++R
Sbjct: 211 SDAINAWSLGAFGRRIASARDQRAVVVMRGRQMAQTRLVAQIGDLTIQPDTPARVVVDQR 270

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TGT+VIG NV IS V V++GNLTV++TE  +V QP  F SNG TV    T++   + +G 
Sbjct: 271 TGTVVIGRNVTISTVAVTHGNLTVRVTEAPEVSQPEPF-SNGQTVVVPRTEVSAREERGK 329

Query: 324 FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            +++   DL +L+ G+N +GLK   II+ILQ +K AGALQ+E+++Q
Sbjct: 330 LAILGGSDLQTLVRGLNQVGLKPTDIIAILQAVKTAGALQAELVVQ 375


>gi|188579869|ref|YP_001923314.1| flagellar basal body P-ring protein [Methylobacterium populi BJ001]
 gi|179343367|gb|ACB78779.1| flagellar P-ring protein [Methylobacterium populi BJ001]
          Length = 377

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/346 (51%), Positives = 254/346 (73%), Gaps = 1/346 (0%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+ +L+  RDNQ+ GYGLV GLQGTGD+LR++ FTEQS++SLL  LGI+    RL 
Sbjct: 33  TRIKDIATLKGVRDNQIFGYGLVTGLQGTGDTLRNAQFTEQSLQSLLDRLGINVRDARLR 92

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           ++N+AAVMVTA+LPP+   GSRIDV++ S+GDA+SLRGG L+MT L G DG +YA AQG 
Sbjct: 93  TRNIAAVMVTADLPPYTGTGSRIDVTVTSMGDATSLRGGTLLMTPLTGGDGLVYAAAQGP 152

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + VSG  V+GQ+    +G+ T G+I NGA++ERE+P  F+D  +L+ +L+NPDF TA +I
Sbjct: 153 LAVSGFTVQGQAEQLTQGVPTAGRIPNGALIEREVPGTFRDLPELVFELKNPDFKTATQI 212

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
           +D IN++SL  F R IA A D R V V +   +  TRL++++  LT++ DTPARV++++R
Sbjct: 213 SDAINAWSLGAFGRRIASARDQRAVVVMRSRQMAQTRLVAQIGDLTIQPDTPARVVVDQR 272

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TGT+VIG NV IS V V++GNLTV++TE  +V QP  F SNG TV    T++   + +G 
Sbjct: 273 TGTVVIGRNVTISTVAVTHGNLTVRVTEAPEVSQPEPF-SNGQTVVVPRTEVAAREERGK 331

Query: 324 FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            +++   DL +L+ G+N +GLK   II+ILQ +K AGALQ+E+++Q
Sbjct: 332 LAILGGSDLQTLVRGLNQVGLKPTDIIAILQAVKTAGALQAELVVQ 377


>gi|319898639|ref|YP_004158732.1| flagellar P-ring protein precursor (Basal body P-ring protein)
           [Bartonella clarridgeiae 73]
 gi|319402603|emb|CBI76148.1| Flagellar P-ring protein precursor (Basal body P-ring protein)
           [Bartonella clarridgeiae 73]
          Length = 414

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 260/347 (74%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+  +Q  R NQL+GYGLV+GL GTGDSLR++PFTEQSMR++L NLGIS P G  
Sbjct: 68  VARLKDIAVVQGVRSNQLVGYGLVIGLNGTGDSLRNAPFTEQSMRAMLDNLGISPPAGAS 127

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            + N+AAV+VTA + PFA+PGSRIDV+++SLGDA+SL+GG LVMT LLGADG  YAVAQG
Sbjct: 128 RANNIAAVIVTAEMMPFATPGSRIDVTVSSLGDATSLQGGTLVMTPLLGADGKTYAVAQG 187

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++V+SG   KG + S  +G+ T G+I NGA++ER++   F  S  +I++LRN DFSTA+R
Sbjct: 188 NMVISGFGAKGVAESVTQGVPTSGRIPNGALIERKVDGNFNHSNQIIMELRNSDFSTAVR 247

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           ++D IN ++  R+ + +A   D++T+ ++KP NI +TR ++E+E L + TD  ARV+++E
Sbjct: 248 VSDLINIFANKRYKQRVARERDAKTIILNKPRNISITRFIAEIEGLPIPTDEVARVVVDE 307

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VR+S+V +S+G+LTV++TE   V QPN FS  G T+    T + V  +  
Sbjct: 308 RTGTVVIGEKVRVSRVAISHGSLTVRVTEEPSVSQPNPFSETGDTIVVPRTSINVDQSPS 367

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +  +++  DL++L+ G+N IG+K   II++LQ IK +GAL +E+++Q
Sbjct: 368 NIGILNGVDLDNLVKGLNQIGVKPTAIIAVLQAIKTSGALHAELVVQ 414


>gi|319405403|emb|CBI79022.1| Flagellar P-ring protein 2 [Bartonella sp. AR 15-3]
          Length = 406

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/347 (51%), Positives = 258/347 (74%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+  +Q  R NQL+GYGLV+GL GTGDSLR++PFTEQSMR++L NLGIS P G  
Sbjct: 60  VARLKDIAVVQGVRSNQLVGYGLVIGLNGTGDSLRNAPFTEQSMRAMLDNLGISPPAGAS 119

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
              N+AAV+VTA + PFA+PGSRIDV+++SLGDA+SL+GG LVMT LLGADG  YAVAQG
Sbjct: 120 RVNNIAAVIVTAEMMPFATPGSRIDVTVSSLGDATSLQGGTLVMTPLLGADGKTYAVAQG 179

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++V+SG   KG + S  +G+ T G+I NGA+VER++   F  S ++I++LRN DFSTA+R
Sbjct: 180 NMVISGFAAKGAAESVTQGVPTSGRIPNGALVERKVDGNFNHSNEIIIELRNSDFSTAVR 239

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           ++D IN ++  R+ + +A   D++T+ ++KP NI + R ++E+E L + TD  ARV+++E
Sbjct: 240 MSDLINIFANKRYKQSVARERDAKTIVLNKPRNISVARFIAEIEGLPIPTDEIARVVVDE 299

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VR+S+V +S+G+LTV++TE   V QPN FS  G T+    T + V  +  
Sbjct: 300 RTGTVVIGEKVRVSRVAISHGSLTVRVTEEPSVSQPNPFSETGDTIVVPRTSIDVDQSLS 359

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +  ++   DL+SL+ G+N IG+K   II++LQ IK +GAL +E+++Q
Sbjct: 360 NIGILSGVDLDSLVKGLNQIGVKPTAIIAVLQAIKTSGALHAELVVQ 406


>gi|170748105|ref|YP_001754365.1| flagellar basal body P-ring protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654627|gb|ACB23682.1| flagellar P-ring protein [Methylobacterium radiotolerans JCM 2831]
          Length = 366

 Score =  374 bits (961), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 255/346 (73%), Gaps = 1/346 (0%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+ +LQ  RDNQ++GYGLV GLQ TGD+LR++ FTEQS++S+L  LG++    RL 
Sbjct: 22  TRIKDIATLQGVRDNQIVGYGLVTGLQSTGDTLRNAQFTEQSLQSMLDRLGVNVRDQRLR 81

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           ++NVAAVMVTANLP +  PGSR+DVS+NS+GDA+SLRGG L+MT L G DG +YAVAQG+
Sbjct: 82  TRNVAAVMVTANLPAYVEPGSRVDVSVNSMGDATSLRGGTLLMTPLSGGDGQVYAVAQGA 141

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           +VVSG  V GQ+ S + G++T  +I NGA+VER +   F +   + L+L+NPDF TA+ I
Sbjct: 142 LVVSGFSVTGQAESLVSGVATAARIPNGALVERAVAGTFSELPGMALELKNPDFHTAVLI 201

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
           +D IN+Y+L ++ R  A   D RTV +S+P ++  TR M+E+  L V+ D PA+V+I++R
Sbjct: 202 SDAINAYTLQKYGRRAASPRDYRTVVLSRPGHVGRTRFMAEIGELQVQPDIPAKVVIDQR 261

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TGT+VIG NV++S V V++G+LTV+ITE  QV QP  F S+G T     TD++  +    
Sbjct: 262 TGTVVIGRNVQVSTVAVTHGDLTVRITETPQVSQPAPF-SDGQTTVVPRTDIEAGERTAR 320

Query: 324 FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            +++  PDL +LI G+N++G+K   +I+ILQ +K AGALQ+E++IQ
Sbjct: 321 LAIVAGPDLQTLIRGLNNVGMKPTDVIAILQAVKTAGALQAELVIQ 366


>gi|121602656|ref|YP_989398.1| flagellar basal body P-ring protein [Bartonella bacilliformis
           KC583]
 gi|120614833|gb|ABM45434.1| flagellar P-ring protein FlgI [Bartonella bacilliformis KC583]
          Length = 412

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 263/347 (75%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+  +Q  R NQL+GYGLV+GL  TGDSLR+SPFTEQSMR++L NLGIS P G  
Sbjct: 67  VARLKDIAEIQGVRSNQLVGYGLVIGLNRTGDSLRNSPFTEQSMRAMLDNLGISPPAGAS 126

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            + N+AAV+VTA + PFA+PGSRIDV+++SLGDA+SL+GG LVMT LLGADG  YAVAQG
Sbjct: 127 RANNIAAVIVTAEMVPFATPGSRIDVTVSSLGDATSLQGGTLVMTPLLGADGKTYAVAQG 186

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++V+SG   +G + S  +G+ T G+I NGA+VER++   F  S ++IL+LRN DFSTA+R
Sbjct: 187 NMVISGFGAQGVAESVTQGVPTSGRIPNGALVERKIEGNFNKSNEIILELRNSDFSTAVR 246

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           + D IN +S  R+ + +A+  DS+T+ +SKP NI +TR ++E+E L + TD  ARV+++E
Sbjct: 247 VTDLINIFSNQRYKQGVAKERDSKTIVLSKPRNISITRFIAEIERLPIPTDEVARVVVDE 306

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VR+S+V +S+G+LTV++TE+  V QPN F+  G+TV    T++ ++    
Sbjct: 307 RTGTVVIGEKVRVSRVAISHGSLTVRVTEDPLVSQPNPFAE-GNTVIVPRTNVDIAQPPS 365

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +  +++  DL++L+ G+N IG+K   II++LQ IK +GAL +E+I+Q
Sbjct: 366 NIGILNGVDLDNLVKGLNQIGVKPTAIIAVLQAIKTSGALHAELIVQ 412


>gi|319409185|emb|CBI82829.1| Flagellar P-ring protein [Bartonella schoenbuchensis R1]
          Length = 412

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/347 (51%), Positives = 261/347 (75%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+  +Q  R NQL+GYGLV+GL GTGDSLR++PFTEQ+MR++L NLG+S P G  
Sbjct: 67  VARLKDIAEIQGVRSNQLVGYGLVIGLNGTGDSLRNAPFTEQAMRAMLDNLGMSPPAGAS 126

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            + N+AAV+VTA + PFA+PGSRIDV++++LGDA+SL+GG LVMT LLGADG  YAVAQG
Sbjct: 127 RANNIAAVIVTAEMVPFATPGSRIDVTVSALGDATSLQGGTLVMTPLLGADGKTYAVAQG 186

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++V+SG   +G + S  +G+ T G+I NGA+VE+++   F    ++IL+LRN DFSTA+R
Sbjct: 187 NMVISGFGAQGVAESVTQGVPTSGRIPNGALVEQKIEGNFNQGNEVILELRNSDFSTAVR 246

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           ++D IN ++  R+   +A+  D++TV ++KP NI + R ++E+EML + TD  ARV+++E
Sbjct: 247 VSDLINIFANKRYKHNVAKERDAKTVVLNKPRNISMARFIAEIEMLPIPTDEVARVVVDE 306

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VR+S+V +S+G+LTV++TE  +V QPN F S+G TV    T + V     
Sbjct: 307 RTGTVVIGEKVRVSRVAISHGSLTVRVTEEPEVSQPNPF-SDGDTVVVPRTSVDVDQPVS 365

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +  ++D  DL++LI G+N IG+K   II++LQ IK AGAL +E+++Q
Sbjct: 366 NIGILDGVDLDNLIKGLNQIGVKPTAIIAVLQAIKTAGALHAELVVQ 412


>gi|319403963|emb|CBI77551.1| Flagellar P-ring protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 408

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 258/347 (74%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+  +Q  R NQL+GYGLV+GL GTGDSLR++PFTEQSMR++L NLGIS P G  
Sbjct: 62  VARLKDIAIIQGVRSNQLVGYGLVIGLNGTGDSLRNAPFTEQSMRAMLDNLGISPPAGAS 121

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
              N+AAV+VTA + PFA+PGSRIDV+++SLGDA+SL+GG LVMT LLGADG  YAVAQG
Sbjct: 122 RVNNIAAVIVTAEMMPFATPGSRIDVTVSSLGDATSLQGGTLVMTPLLGADGKTYAVAQG 181

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++V+SG   KG + S  +G+ T G+I NGA+VER++   F  S ++I++LRN DFSTA+R
Sbjct: 182 NMVISGFGAKGAAESVTQGVPTSGRIPNGALVERKIDGNFNHSNEIIIELRNSDFSTAVR 241

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           ++D IN ++  R+ + +A   D++T+ ++KP NI + R ++++E L + TD  ARV+++E
Sbjct: 242 MSDLINIFANKRYKQSVARERDAKTIVLNKPRNISIARFIADIEGLPIPTDEVARVVVDE 301

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VR+S+V +S+G+LTV++TE   V QPN FS  G T+    T + V     
Sbjct: 302 RTGTVVIGEKVRVSRVAISHGSLTVRVTEEPSVSQPNPFSETGDTIVVPRTSIDVDQPLS 361

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +  +++  DL+SL+ G+N IG+K   II++LQ IK +GAL +E+++Q
Sbjct: 362 NIGILNGVDLDSLVKGLNQIGVKPTAIIAVLQAIKTSGALHAELVVQ 408


>gi|328545503|ref|YP_004305612.1| flagellar P-ring protein I [polymorphum gilvum SL003B-26A1]
 gi|326415244|gb|ADZ72307.1| Flagellar P-ring protein I [Polymorphum gilvum SL003B-26A1]
          Length = 366

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/350 (51%), Positives = 254/350 (72%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           A  + RIKD+ SLQ  RDNQL+GYGLV+GLQG+GD+LR+SPFTEQS++S+L ++G++  G
Sbjct: 17  AAAMVRIKDIASLQGVRDNQLVGYGLVIGLQGSGDTLRNSPFTEQSLQSMLDSMGVNVRG 76

Query: 80  GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
            RL ++NVAAV+VTA+LP F   GSRIDVS++SLGDA SL GG L+ T L+GADG++YAV
Sbjct: 77  ARLRTRNVAAVVVTADLPAFTGKGSRIDVSVSSLGDAGSLAGGTLIATPLMGADGSVYAV 136

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQG+V VSG    GQ+    +GI T G+I NGA++ER++P +F +   L+L+L NPDF T
Sbjct: 137 AQGAVAVSGFSEAGQAERLKQGIPTVGRIPNGALIERDIPDRFANIPALVLELSNPDFRT 196

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVI 259
           A+R+AD IN ++  ++    A   D R++ +  P N+ +TR ++E+E L V+ D  ARV+
Sbjct: 197 AVRVADAINRHTKAQYGMTAARERDYRSIDLKAPANVGVTRFIAEIEGLLVQPDQAARVV 256

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           I+ERTGT+VIG +V++S V V++GNLTV+ITE  ++ QP  FS  G T     T +    
Sbjct: 257 IDERTGTVVIGRDVQVSTVAVTHGNLTVRITEAPEISQPAPFSYQGQTAVAPRTFIDAQQ 316

Query: 320 NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           + G  +++   DL +L+ G+N IGLK  GII+ILQ IK AGALQ++++IQ
Sbjct: 317 DGGQLAIVGGSDLQTLVRGLNRIGLKPTGIIAILQAIKTAGALQADLVIQ 366


>gi|319406978|emb|CBI80615.1| Flagellar P-ring protein 2 [Bartonella sp. 1-1C]
          Length = 408

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/347 (50%), Positives = 259/347 (74%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+  +Q  R NQL+GYGLV+GL GTGDSLR++PFTEQSMR++L NLGI+ P G  
Sbjct: 62  VARLKDIAIVQGVRSNQLVGYGLVIGLNGTGDSLRNAPFTEQSMRAMLDNLGINPPAGAS 121

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
              N+AAV+VTA + PFA+PGSRIDV+++SLGDA+SL+GG LVMT LLGADG  YAVAQG
Sbjct: 122 RVNNIAAVIVTAEMMPFATPGSRIDVTVSSLGDATSLQGGTLVMTPLLGADGKTYAVAQG 181

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++V+SG   KG + S  +G+ T G+I NGA+VER++   F  S ++I++LRN DFSTA+R
Sbjct: 182 NMVISGFGAKGTAESVTQGVPTSGRIPNGALVERKVDGNFNHSNEIIIELRNSDFSTAVR 241

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           ++D IN ++  R+ + +A   D++T+ ++KP NI ++R ++++E L + TD  ARV+++E
Sbjct: 242 MSDLINIFANKRYKQSVARERDAKTIVLNKPRNISVSRFIADIEGLPIPTDEVARVVVDE 301

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG+ VR+S+V +S+G+LTV++TE   V QPN FS  G T+    T + V  +  
Sbjct: 302 RTGTVVIGEKVRVSRVAISHGSLTVRVTEEPSVSQPNPFSETGDTIVVPRTSIDVDQSLS 361

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +  ++   DL+SL+ G+N IG+K   II++LQ IK +GAL +E+++Q
Sbjct: 362 NIGILSGVDLDSLVKGLNQIGVKPTAIIAVLQAIKTSGALHAELVVQ 408


>gi|182680546|ref|YP_001834692.1| flagellar basal body P-ring protein [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182636429|gb|ACB97203.1| flagellar P-ring protein [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 370

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/367 (49%), Positives = 266/367 (72%), Gaps = 7/367 (1%)

Query: 9   IFSLIGLHEISAQVVS------RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           IFSL+    ++   V+      RIKD+ +LQ  RDNQ++GYGLVVGLQGTGD++R+S FT
Sbjct: 5   IFSLLACCCLACFSVAPAFASVRIKDIAALQGVRDNQIMGYGLVVGLQGTGDTMRNSVFT 64

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           EQS++S+L  LG++  G  L ++NVAAV+VTA+LPPF  PGSRIDV+++SLGDASSL GG
Sbjct: 65  EQSIQSMLDRLGVNVRGINLRTRNVAAVLVTADLPPFVQPGSRIDVTVSSLGDASSLLGG 124

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L++TSLLG DG  YA+AQG V V+G    G ++S ++ + T G+I NGA++ERE+P + 
Sbjct: 125 TLILTSLLGVDGQTYAMAQGQVAVTGFAETGPAASVVQNVPTAGRIANGALIEREVPGQL 184

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLM 242
           +    L+LQLRNPDF TA++I D IN++ ++++   +A   D R+V ++KP N+  TR +
Sbjct: 185 RSIGPLVLQLRNPDFGTAVKITDAINAFGVHKYGHELAHEIDQRSVALNKPANLGTTRFI 244

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +++  L++E DTPARV+I+ R+GT+VIG +V+IS V V+ GNLTV+I+    + QP  F 
Sbjct: 245 AQIGDLSIEPDTPARVVIDSRSGTVVIGQDVQISTVAVTQGNLTVRISNAPVISQPAPF- 303

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           S G TV    T++  +   G  S++   +L SL++G+N IGLK DGIISILQ IK+AGAL
Sbjct: 304 SQGKTVVAPITEIDANQGGGPISIVRGSNLRSLVAGLNQIGLKPDGIISILQAIKSAGAL 363

Query: 363 QSEIIIQ 369
           Q+++++Q
Sbjct: 364 QADLVVQ 370


>gi|158422256|ref|YP_001523548.1| flagellar basal body P-ring protein [Azorhizobium caulinodans ORS
           571]
 gi|158329145|dbj|BAF86630.1| flagellar P-ring protein precursor [Azorhizobium caulinodans ORS
           571]
          Length = 366

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/369 (49%), Positives = 267/369 (72%), Gaps = 3/369 (0%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           MI R  FLI +L+ L    A  ++RIKD+ S+Q  RDNQLIGYGLV+GLQGTGD+LR+SP
Sbjct: 1   MISR--FLIAALVVLLAGPALALTRIKDISSVQGVRDNQLIGYGLVMGLQGTGDTLRNSP 58

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTEQ+++++L  +GI+  G  L ++N AAVMVTANLP FA+ GSR+DV+++S+GDA+SL+
Sbjct: 59  FTEQALQAMLDRMGINVVGSPLRARNTAAVMVTANLPAFAAIGSRVDVTVSSIGDATSLK 118

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L++T L   DG  YAVAQG + VSG  V+GQ+ +  +G+ T G+I NGA+VER++P 
Sbjct: 119 GGTLLITQLNNTDGLTYAVAQGQLAVSGFSVQGQAETLTQGVPTSGRIPNGALVERQIPG 178

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           + +D  + ++ L NPDF TA  +AD IN+Y+  R+ RP+A   D RTV V +P   +  R
Sbjct: 179 QLRDLNEYLIDLTNPDFKTASLMADAINAYTQARYGRPLARERDLRTVVVQRPPQANPAR 238

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
            ++E+  L +E DTPA+V++++RTGT+VIG NV++S V V+ G++TV++TE   V QPN 
Sbjct: 239 FLAEIGELGIEVDTPAKVVVDQRTGTVVIGRNVQVSTVAVTQGSVTVRVTETPVVSQPNP 298

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           F+S GSTV    TD++  +  G  +++   DL +L+ G+N +GLK   II+ILQ IK +G
Sbjct: 299 FAS-GSTVVVPRTDIQADEAGGHLAVVRGTDLQTLVRGLNRLGLKPSDIIAILQAIKTSG 357

Query: 361 ALQSEIIIQ 369
           ALQ+E+++Q
Sbjct: 358 ALQAELVVQ 366


>gi|90418390|ref|ZP_01226302.1| flagellar P-ring protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90338062|gb|EAS51713.1| flagellar P-ring protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 363

 Score =  364 bits (935), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 181/351 (51%), Positives = 252/351 (71%), Gaps = 1/351 (0%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           SA+   RIKD+V ++  R NQL+GYGLV+GLQGTGDS+R+SPFTEQSM+S+L  +G++  
Sbjct: 14  SARGSVRIKDIVDIRGVRANQLVGYGLVIGLQGTGDSMRNSPFTEQSMQSMLDRMGVNIR 73

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
                SKNVAAV VT+ LP F   GSRIDV+++SLGDA+SL GG L+MT L GADG IYA
Sbjct: 74  SQNSRSKNVAAVTVTSELPAFIGTGSRIDVTVSSLGDATSLMGGTLMMTPLYGADGEIYA 133

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           VAQGS+ VSG   +G S    +G+ T G++ NGA+VERE+P  F D   L ++LRNPDF 
Sbjct: 134 VAQGSLAVSGFASEGDSEKLTQGVPTTGRVPNGALVEREVPGGFNDDGKLAIELRNPDFR 193

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARV 258
           T+IR+ D IN Y+ +R+ +P+A   D RTV + +P+ +  TR ++E+  L +  D PARV
Sbjct: 194 TSIRVVDVINDYARSRWGQPVAREEDFRTVHLKRPSEVSSTRFIAEIGELRIAPDQPARV 253

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           +I+ERTGT++IG +V+IS V V++GNLTV+I+E   V QP    S+G TV  + T +   
Sbjct: 254 VIDERTGTVIIGKDVQISLVAVTHGNLTVRISEMPSVSQPAPL-SDGQTVVTSETIIDAR 312

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           ++ G+F+ +   DL +++ G+N IGLK  GII+ILQ IK AGALQ+E+++Q
Sbjct: 313 EDGGNFAFVGGADLETVVRGLNRIGLKPTGIIAILQAIKTAGALQAELVVQ 363


>gi|114706773|ref|ZP_01439673.1| flagellar P-ring protein precursor I [Fulvimarina pelagi HTCC2506]
 gi|114537721|gb|EAU40845.1| flagellar P-ring protein precursor I [Fulvimarina pelagi HTCC2506]
          Length = 399

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 179/345 (51%), Positives = 245/345 (71%), Gaps = 1/345 (0%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+ +++  R NQL+GYGLV+GLQGTGDS+R+SP+TEQS++S+L  +G++    R G 
Sbjct: 56  RIKDITNVRGVRGNQLVGYGLVIGLQGTGDSMRNSPYTEQSLQSMLDRMGVNIRSDRAGG 115

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAV VTA LP F   GSRIDV++ SLGDA+SL GG LVMT L GADG IYAVAQG V
Sbjct: 116 KNVAAVTVTAELPAFIGTGSRIDVNVASLGDATSLMGGTLVMTPLYGADGEIYAVAQGPV 175

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
            VSG   +G S    +G+ T G++ NGA VERE+P  F D   L ++L NPDF T +R  
Sbjct: 176 AVSGFTSEGASERLTQGVPTAGRVPNGAFVEREVPGHFYDDGQLSMELSNPDFKTMVRTV 235

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERT 264
           D IN+Y+ NR+ RP+A   D RT+ + +P N+   R ++E+  L V+ D  A+V+I+ERT
Sbjct: 236 DLINAYARNRWGRPVAREEDFRTLHLDRPANVSAVRFLAEIGDLRVDPDQVAKVVIDERT 295

Query: 265 GTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSF 324
           GTIVIG NV+IS V +++GNLTV+++E   V QP  F S+G TV  + T +  ++  G+F
Sbjct: 296 GTIVIGQNVQISTVALTHGNLTVRVSELPAVSQPAPF-SDGETVVTSETIVDTNETGGNF 354

Query: 325 SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           + +   DL +++ G+N IGLK  GII+ILQ IK AGALQ+E+++Q
Sbjct: 355 AFVGGTDLETVVRGLNRIGLKPSGIIAILQAIKTAGALQAELVVQ 399


>gi|254501956|ref|ZP_05114107.1| flagellar P-ring protein FlgI [Labrenzia alexandrii DFL-11]
 gi|222438027|gb|EEE44706.1| flagellar P-ring protein FlgI [Labrenzia alexandrii DFL-11]
          Length = 362

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 183/363 (50%), Positives = 253/363 (69%), Gaps = 1/363 (0%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
             I  L  L  + A  + RIKD+ +LQ  RDNQL+GYGLV+GL+G+GD+LR+SPFTEQS+
Sbjct: 1   MFICLLAVLTAVPATAMVRIKDIATLQGVRDNQLVGYGLVIGLKGSGDTLRNSPFTEQSL 60

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           +S+L +LG++    RL ++NVAAV+VTA +P F   GS ID+S++SLGDA+SL GG LV 
Sbjct: 61  QSMLDSLGVNVRDTRLRTRNVAAVVVTAEMPSFIGKGSSIDISVSSLGDATSLAGGTLVA 120

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T LLGADG IYAVAQG V VSG    G + S  +GI T G+I NG ++ER LP KF    
Sbjct: 121 TPLLGADGQIYAVAQGPVAVSGFAELGAAESLTQGIPTVGRIPNGGLIERNLPAKFSQIP 180

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVE 246
           DL+L+L NPDF TA+RI D IN Y+  R+   +A+  D R+V ++ P  + LTR ++E+E
Sbjct: 181 DLVLELSNPDFKTAVRITDAINRYTRERYGVRVAKERDYRSVDLTPPPKVSLTRFIAEIE 240

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            + V  D  A+V+I+ERTGT+VIG +V+IS V +++GNLTV+I+E  +V QP  F S G 
Sbjct: 241 SIRVRPDQSAKVVIDERTGTVVIGKDVQISTVAITHGNLTVRISEAPEVSQPAPF-SQGE 299

Query: 307 TVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           TV    T +   +  G  +++   DL +L+ G+N IGL+  GII+ILQ IK AGALQ+E+
Sbjct: 300 TVVVPRTYVDAQETGGRLAVVGGTDLPTLVRGLNRIGLRPTGIIAILQAIKTAGALQAEL 359

Query: 367 IIQ 369
           ++Q
Sbjct: 360 VVQ 362


>gi|296447436|ref|ZP_06889361.1| flagellar P-ring protein [Methylosinus trichosporium OB3b]
 gi|296255056|gb|EFH02158.1| flagellar P-ring protein [Methylosinus trichosporium OB3b]
          Length = 366

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 251/345 (72%), Gaps = 1/345 (0%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+VS++  R+ QL+GYGLVVGLQGTGD+LR++PFTEQS+ S+L  +G++ P  +L +
Sbjct: 23  RIKDIVSVRGLREYQLVGYGLVVGLQGTGDTLRNTPFTEQSVASMLSRMGVNVPNTQLRT 82

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           +N+AAVMVTA+LPPF   GS ID++++++GDASSL GG L++T+L G DGN+YA+AQG +
Sbjct: 83  RNLAAVMVTASLPPFVGWGSSIDITVSAMGDASSLMGGTLILTTLTGVDGNVYALAQGPI 142

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
            VSG  V GQ+ S   G++T G++ NGA +ERE P+   DS  L+L+LRNPDF TA+R+A
Sbjct: 143 AVSGFAVSGQNESLTHGVATVGRVPNGATIEREAPRPSGDSGALVLELRNPDFQTAVRVA 202

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERT 264
           D IN+++  R+ + +A   D+R+V V    N+  TRL++E+  L V+  TPARV+I+ERT
Sbjct: 203 DAINAFTRERYGQRLARERDNRSVAVRGAPNMGATRLLAEIGELRVDPTTPARVVIDERT 262

Query: 265 GTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSF 324
           GT+VIG +V+I  V V+ G LTV+I E  +V QP  F SNG T   + T +  ++  G  
Sbjct: 263 GTVVIGQDVQILPVAVTQGGLTVRINETPEVSQPGPF-SNGQTTVTSQTRITATEQVGQV 321

Query: 325 SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
             ++   L +L+ G+N IGLK  GIISILQ IK AGALQ++++IQ
Sbjct: 322 GTLEGATLKTLVRGLNQIGLKPTGIISILQAIKTAGALQADLVIQ 366


>gi|115523181|ref|YP_780092.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           BisA53]
 gi|115517128|gb|ABJ05112.1| flagellar P-ring protein [Rhodopseudomonas palustris BisA53]
          Length = 367

 Score =  361 bits (927), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 192/369 (52%), Positives = 268/369 (72%), Gaps = 2/369 (0%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M++R+ + I  ++ L   +A    RIKD+ +L+  R+NQL GYGLV+GL+GTGD+LR+SP
Sbjct: 1   MMWRLFWGI--VVALSVTTASAAVRIKDIANLKGVRENQLFGYGLVIGLKGTGDTLRNSP 58

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTEQS++S+L N+GI+  G  L ++NVAAV+VTA+LPPF++ G+RIDVSI+SLGD+SSL 
Sbjct: 59  FTEQSLQSMLDNMGINIRGTALRTRNVAAVVVTADLPPFSAGGTRIDVSISSLGDSSSLM 118

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG LVMTSL GADG IYAVAQG+V V G  ++G + S  +G++T G+I NGA++ERE+  
Sbjct: 119 GGTLVMTSLRGADGEIYAVAQGAVAVGGYNIEGAAQSLSQGVATAGRIPNGALIEREVRG 178

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           +F D   L+L+L+NPDF TA RI D IN +S  R+   +A   D RTV +++P  +   R
Sbjct: 179 RFSDMESLVLELKNPDFVTATRILDVINQHSRGRYQVGVAVEQDYRTVILTRPRAVSPVR 238

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
            ++E+E L VE DTPARV+++ERTGT+VIG NV+IS V V++GNLTV+ITE   V QP  
Sbjct: 239 FIAEIEELLVEPDTPARVVVDERTGTVVIGRNVQISTVAVTHGNLTVRITEAPIVSQPAP 298

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           FS  G TV    T +  ++     +++   DL  L+ G+N IGLK  GII+ILQ IK+AG
Sbjct: 299 FSPRGETVVVPQTFIDANEPGAKIAILRGTDLQRLVRGLNQIGLKPSGIIAILQAIKSAG 358

Query: 361 ALQSEIIIQ 369
           ALQ++++IQ
Sbjct: 359 ALQADLVIQ 367


>gi|217976227|ref|YP_002360374.1| flagellar basal body P-ring protein [Methylocella silvestris BL2]
 gi|217501603|gb|ACK49012.1| flagellar P-ring protein [Methylocella silvestris BL2]
          Length = 367

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 183/370 (49%), Positives = 258/370 (69%), Gaps = 4/370 (1%)

Query: 1   MIFRIAFLI-FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           M+ R   ++ FS I     +A V  RIKD+ SLQ  RDNQL+GYGLVVGLQG+GD+LR+S
Sbjct: 1   MMLRAGLIVVFSAIFCCAATASV--RIKDITSLQDVRDNQLVGYGLVVGLQGSGDTLRNS 58

Query: 60  PFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
            FTEQ+M+S+L  +GI+     L ++NVAAV+VTA+LPPF  PG+R+DV+++SLGDA+SL
Sbjct: 59  TFTEQTMQSMLDRMGINVRSFALRTRNVAAVLVTADLPPFIQPGTRMDVTVSSLGDATSL 118

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
            GG L++TSL G DG  YA+AQG V V+G  V+GQ+ +  + ++T G+I NGA+VERE P
Sbjct: 119 YGGTLILTSLTGVDGQTYAIAQGQVAVAGFAVQGQAETITQNVATAGRIANGALVEREAP 178

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT 239
              +D   L L L+NPDF+TA++IA+ IN +S+ RF   +A+  D  +V + +P  I   
Sbjct: 179 GHLRDIGPLALVLKNPDFNTAVQIAEVINKFSMRRFRLRVAQDRDLNSVALVRPPGISTA 238

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
           R M+E+  L V+ D PARV+I+ R+GTIVIG +V+IS V V++GNL V+I E  +V QP 
Sbjct: 239 RFMAEIGDLMVDPDAPARVVIDARSGTIVIGQDVQISTVAVTHGNLNVRIVETPEVSQPA 298

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
            F SNG TV    T++  +   G   ++    L  L++G+N IGLK  G+I+ILQ IK+A
Sbjct: 299 PF-SNGRTVVVPRTEIDTNQQGGHIGIVKGASLRELVAGLNRIGLKPMGVIAILQAIKSA 357

Query: 360 GALQSEIIIQ 369
           GAL ++I+IQ
Sbjct: 358 GALHADIVIQ 367


>gi|304392504|ref|ZP_07374444.1| flagellar P-ring protein FlgI [Ahrensia sp. R2A130]
 gi|303295134|gb|EFL89494.1| flagellar P-ring protein FlgI [Ahrensia sp. R2A130]
          Length = 390

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 175/346 (50%), Positives = 248/346 (71%), Gaps = 1/346 (0%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SRIKD+  LQ  RDNQL+GYGLVVGLQGTGD LRS+PFT QS++++L  LGI++   R+ 
Sbjct: 46  SRIKDIAKLQVTRDNQLVGYGLVVGLQGTGDGLRSAPFTRQSLQAMLTRLGIASGDDRVS 105

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KNVAAV+VT NLP F   G+R+D +++S+GDA+SLRGG LVMT +   DG +YA AQG+
Sbjct: 106 AKNVAAVIVTTNLPAFVETGTRLDTTVSSIGDATSLRGGTLVMTMMQAGDGEVYAAAQGN 165

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+VSG   +G +    +G+ T G++ NGAIVE+ LP  F +  + ILQLRNPDFSTA+ +
Sbjct: 166 VIVSGFQAEGDAQKVTQGVPTTGRVPNGAIVEKALPASFSNETNYILQLRNPDFSTAVAM 225

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
           AD IN+++ + +    A   D+RT+++S+P ++   R ++ +E L V   + ARV+++ER
Sbjct: 226 ADTINAHTASLYGYKTARERDARTIQLSRPKSVSSARFIASIENLPVAAQSAARVVLDER 285

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TGT+VIG  VRIS+V VS+G LTV+ITE   VVQP AF S+G T  +  TD++V+   G+
Sbjct: 286 TGTVVIGAEVRISRVAVSHGALTVRITERPVVVQPEAF-SDGVTAVEPATDIEVASRDGT 344

Query: 324 FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            S I+   L+ LI G+N +G+     I+I+Q IK AGALQ+E++IQ
Sbjct: 345 LSKIEGTSLDVLIQGLNELGVDPQQTIAIIQAIKTAGALQAELVIQ 390


>gi|90422612|ref|YP_530982.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           BisB18]
 gi|90104626|gb|ABD86663.1| flagellar P-ring protein [Rhodopseudomonas palustris BisB18]
          Length = 367

 Score =  358 bits (919), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 191/366 (52%), Positives = 267/366 (72%), Gaps = 1/366 (0%)

Query: 5   IAFLIFS-LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           IA L++  +I L   +A    RIKD+ +L+  R+NQ++GYGLV+GL+GTGD+LR+SPFTE
Sbjct: 2   IARLLWGVIIALSITAADAAVRIKDIANLKGVRENQILGYGLVIGLKGTGDTLRNSPFTE 61

Query: 64  QSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           QS++S+L N+GI+  G  L ++NVAAV+VTA+LPPF + GSRIDV+I+SLGD+SSL GG 
Sbjct: 62  QSLQSMLDNMGINIRGTSLRTRNVAAVVVTADLPPFIAGGSRIDVAISSLGDSSSLLGGT 121

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           LVMT L GADG +YAVAQG++ V G  V+G + S  +G++TGG+I NGA++ERE+  +F 
Sbjct: 122 LVMTQLRGADGEVYAVAQGAIAVGGYAVEGAAQSLSQGVATGGRIPNGALIEREVRGRFS 181

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMS 243
           D   L+L+L+NPDF TA R+ D IN +S  R+   +A   D RT+ +S+P ++   R ++
Sbjct: 182 DMETLLLELKNPDFVTATRVLDTINQHSRGRYQAGVASERDYRTIILSRPRSVSPVRFIA 241

Query: 244 EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           E+E L VE DTPARV+I+ER GT+VIG NV+IS V V++GNLTV+ITE   V QP+ FS 
Sbjct: 242 EIEELLVEPDTPARVVIDERNGTVVIGRNVQISTVAVTHGNLTVRITEAPIVSQPSPFSP 301

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
            G TV    T +  ++     +++   DL  L+ G+N IGLK  GII+ILQ IKAAGALQ
Sbjct: 302 RGETVVVPQTFIDANEPGAKIAILRGTDLQRLVRGLNQIGLKPSGIIAILQAIKAAGALQ 361

Query: 364 SEIIIQ 369
           ++++IQ
Sbjct: 362 ADLVIQ 367


>gi|323139656|ref|ZP_08074698.1| flagellar P-ring protein [Methylocystis sp. ATCC 49242]
 gi|322395088|gb|EFX97647.1| flagellar P-ring protein [Methylocystis sp. ATCC 49242]
          Length = 366

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 171/363 (47%), Positives = 253/363 (69%), Gaps = 2/363 (0%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L+ + + L    A  + RIKD+   Q  R+ QL+GYG+VVGLQGTGD++R+SPFTEQ+  
Sbjct: 5   LVIAAVFLVVTPASALVRIKDITYPQGPREYQLVGYGVVVGLQGTGDTMRNSPFTEQATS 64

Query: 68  SLLQNLGIST-PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L  +GI+  P   + ++N+AAVMVTA+LPPF + G+ +DV+++S+GDA+SL GG LV+
Sbjct: 65  AMLDRMGINVRPNNTMRTRNIAAVMVTASLPPFMNWGTTLDVTVSSMGDATSLMGGTLVL 124

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           TSL G DG +YA+AQG + VSG   +GQS +   G++T G+I NGA +ERE P+      
Sbjct: 125 TSLSGVDGQVYAIAQGPIAVSGFAAQGQSETLTHGVATVGRIPNGATIEREPPRATTSDG 184

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVE 246
            LILQLRNPD++T++ IAD +N+Y+  R+    A   D  +V ++ P +   TR ++E+ 
Sbjct: 185 GLILQLRNPDYATSVHIADAVNNYTRKRYRMTTARERDDHSVALALPRDCHATRFLAEIG 244

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            L +  +TPARV+++ERTGT+VIG +V+I  V V++G LTV++TE  +V QP  F SNG 
Sbjct: 245 ELKIAVETPARVVMDERTGTVVIGQDVQILPVAVTHGALTVRVTETPEVSQPAPF-SNGR 303

Query: 307 TVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           TV  + T++  S+ +   ++I  P L  L+ G+N +GLK  GIISILQ IK+AGALQ+++
Sbjct: 304 TVVTSQTNIAASETEAKVAIIAGPTLKQLVKGLNQVGLKPTGIISILQAIKSAGALQADL 363

Query: 367 IIQ 369
           IIQ
Sbjct: 364 IIQ 366


>gi|300024604|ref|YP_003757215.1| flagellar P-ring protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526425|gb|ADJ24894.1| flagellar P-ring protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 367

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 184/371 (49%), Positives = 258/371 (69%), Gaps = 6/371 (1%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M   +A L+F ++G    SA   +RIKD+  ++  R NQL+GYGLVVGL GTGD+LR+SP
Sbjct: 1   MRICVALLLF-ILGAG--SAAAATRIKDITDVKGIRTNQLVGYGLVVGLNGTGDTLRNSP 57

Query: 61  FTEQSMRSLLQNLGISTPGGRLG--SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           FT+QS++++L  +G++  G +    ++NVAAVMVTA LPPFAS GSR DV+++S+GDA S
Sbjct: 58  FTQQSVQAMLDRMGVNIRGSQYEPRTRNVAAVMVTAELPPFASKGSRFDVTVSSMGDAKS 117

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           L GG L++TSL GAD  IYA AQG + +SG   KG + S   GI T G+I NGAIVE+  
Sbjct: 118 LAGGSLILTSLSGADQVIYAAAQGQITISGYLAKGAAESITSGIPTRGRIPNGAIVEQNA 177

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL 238
           P    +   L+L+LRNPDF+TAIRI D INS++  R+   +A A D +++ +S+P  +  
Sbjct: 178 PGMPVEGMPLVLELRNPDFTTAIRIQDAINSFAGQRYGMKVARAEDFQSITLSRPRGLSA 237

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           TRL +E+  +TV+ D  ARV+I+ERTGTIVIG  VRIS V V++GN+TV++ E  +V QP
Sbjct: 238 TRLFAEIGEITVDPDQTARVVIDERTGTIVIGSEVRISTVAVAHGNITVRVKEQPRVSQP 297

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
             F SNG TVT  +T++ V +  GS   +    L  L+S +N +GLK  GII+ILQ +K 
Sbjct: 298 LPF-SNGETVTVPDTEVDVHEAGGSIETLRGASLRELVSALNRMGLKPIGIIAILQAMKT 356

Query: 359 AGALQSEIIIQ 369
           +GALQ+E+++Q
Sbjct: 357 SGALQAELVVQ 367


>gi|27381982|ref|NP_773511.1| flagellar basal body P-ring protein [Bradyrhizobium japonicum USDA
           110]
 gi|81735146|sp|Q89F30|FLGI2_BRAJA RecName: Full=Flagellar P-ring protein 2; AltName: Full=Basal body
           P-ring protein 2; Flags: Precursor
 gi|27355152|dbj|BAC52136.1| flagellar P-ring protein precursor [Bradyrhizobium japonicum USDA
           110]
          Length = 376

 Score =  342 bits (877), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 183/356 (51%), Positives = 250/356 (70%), Gaps = 12/356 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI--------S 76
           RIKD+  ++  R+NQ++GYGLV+GL GTGD+LR++PFTEQS++S+L+N+GI        +
Sbjct: 22  RIKDIADIKGLRENQIVGYGLVIGLNGTGDTLRNAPFTEQSLQSMLENMGINVRNETTST 81

Query: 77  TPGGR---LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
           T   R   L ++NVAAVMVTA+L P    G R+DV+++SLGDA+SL GG LVMTSL  AD
Sbjct: 82  TNPARPTTLRTRNVAAVMVTADLQPSIGAGERMDVTVSSLGDATSLLGGTLVMTSLRAAD 141

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLR 193
           G +YAVAQG+V V+G  V GQ+ +  +G  T G+I+NGA+VERE+     +   L+L+L+
Sbjct: 142 GAVYAVAQGAVTVAGYSVGGQAQNVSQGTPTAGRILNGALVEREVQGSLHEMEFLVLELK 201

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETD 253
           NPDF TA RI D IN Y+  R+   IA   D RT+ +SKP +I   R ++E+  LTVE D
Sbjct: 202 NPDFVTATRILDAINRYAGGRYRAQIAFERDYRTIVLSKPRHIGPVRFLAEIGELTVEPD 261

Query: 254 TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
           TPARV+INERTGT+VIG +VRIS V V++GNLTV++TE   V QP  F S G TV    T
Sbjct: 262 TPARVVINERTGTVVIGRDVRISTVAVTHGNLTVRVTEMPVVSQPAPF-SRGQTVVVPQT 320

Query: 314 DLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            ++ ++     +++   DL  L+ G+N IGLK  GII+ILQ IK AGALQ+++I+Q
Sbjct: 321 VVEANEAGSQVAILSGVDLQRLVRGLNQIGLKPSGIIAILQAIKTAGALQADVIVQ 376


>gi|23008125|ref|ZP_00049701.1| COG1706: Flagellar basal-body P-ring protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 392

 Score =  339 bits (869), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 163/314 (51%), Positives = 228/314 (72%), Gaps = 1/314 (0%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+ +L+  RDNQ+ GYGLV GLQGTGD+LR++ FTEQS++SLL  LGI+    RL 
Sbjct: 69  TRIKDIATLKGVRDNQIFGYGLVTGLQGTGDTLRNAQFTEQSLQSLLDRLGINVRDARLR 128

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           ++N+AAVMVTA+LPP+   GSRIDV++ S+GDA+SLRGG L+MT L G DG +YA AQG 
Sbjct: 129 TRNIAAVMVTADLPPYTGTGSRIDVTVTSMGDATSLRGGTLLMTPLTGGDGLVYAAAQGP 188

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + VSG  V+GQ+    +G+ T G+I NGA++ERE+P  F+D  +L+ +L+NPDF TAI+I
Sbjct: 189 LAVSGFSVQGQAEQLTQGVPTAGRIPNGALIEREVPGTFRDLPELVFELKNPDFKTAIQI 248

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
           AD IN++SL  F R IA A D R V V +   +  TRL++++  LT+E D PARV++++R
Sbjct: 249 ADAINAWSLRAFGRRIASARDQRAVVVMRGRQMAQTRLVAQIGDLTIEPDMPARVVVDQR 308

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TGT+VIG NV IS V V++GNLTV++TE  +V QP  F SNG TV    T++   + +G 
Sbjct: 309 TGTVVIGRNVTISTVAVTHGNLTVRVTETPEVSQPAPF-SNGETVVVPRTEVAAEEGRGK 367

Query: 324 FSLIDAPDLNSLIS 337
            +++   DL +L +
Sbjct: 368 LAILRGSDLQTLCA 381


>gi|312115247|ref|YP_004012843.1| flagellar P-ring protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311220376|gb|ADP71744.1| flagellar P-ring protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 367

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 169/355 (47%), Positives = 245/355 (69%), Gaps = 6/355 (1%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           A   +RIKD+  +Q+ R NQL+GYG+VVGL GTGD+LRSSPFT QS++S+L  +G++   
Sbjct: 14  AHATTRIKDIAVIQNVRPNQLVGYGIVVGLNGTGDNLRSSPFTSQSIQSMLDRMGVNIRN 73

Query: 80  G-----RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
                 ++ +KN AAV+VT  LP FA  G RIDV+++SLG+A+SL GG L+MT L  AD 
Sbjct: 74  NLMNNSQVQTKNAAAVIVTGELPAFAREGGRIDVTVSSLGNATSLEGGTLLMTPLSAADS 133

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRN 194
            IYA AQG V VSG    G++    +G+ T G+I NGA+VER LP + +      L+L N
Sbjct: 134 VIYAAAQGQVSVSGFTAGGRAEKLTQGVPTAGRIANGALVERRLPIELERFKSFTLELLN 193

Query: 195 PDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDT 254
           PDFSTA R AD INSY+ + +    A A D R++++ +P  +D  R +SE+  L ++ DT
Sbjct: 194 PDFSTATRAADVINSYTTSTYGGRSARAKDLRSIELLRPPRLDAARFISEISELPIQPDT 253

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
           PAR++I+ERTGT+VIG +V++S V V++GN+TV++TE  +VVQP  F S G T  ++ T 
Sbjct: 254 PARIVIDERTGTVVIGRDVKVSTVAVAHGNITVRVTEMPKVVQPAPF-SRGETAIEDRTA 312

Query: 315 LKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +      G+  +++  +L SL++G+N +GLK  GII+ILQ IK+AGALQ+E+++Q
Sbjct: 313 VNAEQPDGTLFVLNGANLQSLVTGLNRMGLKPQGIIAILQAIKSAGALQAELVVQ 367


>gi|209963555|ref|YP_002296470.1| flagellar P-ring protein FlgI [Rhodospirillum centenum SW]
 gi|209957021|gb|ACI97657.1| flagellar P-ring protein FlgI [Rhodospirillum centenum SW]
          Length = 377

 Score =  325 bits (833), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 182/366 (49%), Positives = 249/366 (68%), Gaps = 10/366 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +AFL+  L       AQ+  RIKD+V ++  R NQLIGYGLVVGL GTGD L++SPFT+Q
Sbjct: 15  LAFLLSVLPSAGPAFAQM--RIKDLVEVEGVRSNQLIGYGLVVGLDGTGDRLQNSPFTQQ 72

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           S+  +L+ +G++  G  + ++NVAAVMVTA LPPFA  GSR+DVSI+++GDA+SL GG L
Sbjct: 73  SLEGMLERMGVNITGLNVKTRNVAAVMVTAELPPFARQGSRLDVSISTMGDATSLLGGSL 132

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           + T L+GADG++YAVAQGSV V G   +G+++S  +G+ T G+I NG IVERE+     D
Sbjct: 133 LATPLIGADGSVYAVAQGSVAVGGFSARGEAASVTKGVPTAGRIPNGGIVEREVEFALND 192

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLM 242
            A + L LRNPDFSTA RIA  +N   L  +S   A A D  TV+++ P     ++  L+
Sbjct: 193 LARVRLTLRNPDFSTATRIAQAVN-RQLGAYS---ARATDPTTVELTVPGAYAGNVADLI 248

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           S VE L V  D PARV+I+E++GTIV+GD+VRIS V ++ GNLTV++TE  QV QP  F+
Sbjct: 249 SRVETLPVTPDQPARVVIDEQSGTIVMGDSVRISTVAIAQGNLTVRVTETPQVSQPGPFA 308

Query: 303 SNGSTVTQNNTDLKVSDNKGS-FSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAG 360
             G TV    TD++V D  G+  +++     L  L+ G+N +G     IISILQ IKAAG
Sbjct: 309 QQGQTVVVPRTDIEVEDGSGNRLNIVQGSVSLRELVDGLNRLGAGPRDIISILQAIKAAG 368

Query: 361 ALQSEI 366
           AL +++
Sbjct: 369 ALHADL 374


>gi|163852458|ref|YP_001640501.1| flagellar basal body P-ring protein [Methylobacterium extorquens
           PA1]
 gi|163664063|gb|ABY31430.1| flagellar P-ring protein [Methylobacterium extorquens PA1]
          Length = 380

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 175/366 (47%), Positives = 246/366 (67%), Gaps = 9/366 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +A L    + L    A  +SR+KD+ +++  R NQL+GYG+VVGL GTGD+L + PFT+Q
Sbjct: 17  VAVLACLAVLLPPAPASALSRVKDLAAVEGVRSNQLVGYGIVVGLNGTGDTLNNIPFTKQ 76

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           S++++L+ LGI+T G  + ++N+AAVMVTANLPPFA+ G+ IDV+++SLGDA SL+GG L
Sbjct: 77  SLQAMLERLGINTRGATMRTQNLAAVMVTANLPPFATQGTHIDVTVSSLGDAKSLQGGTL 136

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           V TSLLGADG IYA+AQGSV ++G   +G++S    G+ T G+I NGA+VERE+  K  +
Sbjct: 137 VATSLLGADGEIYALAQGSVAIAGFSAEGEASKITRGVPTNGRISNGALVEREMAFKLNE 196

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLM 242
           +  L L LRNPDF+TA RIA  IN +         AE  D  T+ +  P     ++ RL+
Sbjct: 197 ARSLRLSLRNPDFTTAKRIASAINDF----MGADTAEPTDPATITLQIPAKYRGNMIRLI 252

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +EVE L VE D  ARV+++ER+G IV+G +VR+S V ++ GNLTV ITE   V QP    
Sbjct: 253 TEVEQLKVEPDQTARVVVDERSGIIVMGRDVRVSTVAIAQGNLTVTITEQPMVSQPAPL- 311

Query: 303 SNGSTVTQNNTDLKVSDNKGS-FSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           SNG T     T +KV    G+  +L+ +   L  L+ G+N++G+    +ISILQ IK AG
Sbjct: 312 SNGQTAVVPRTGVKVDTGDGNKLALVKEGVSLRELVDGLNALGVGPRDLISILQAIKTAG 371

Query: 361 ALQSEI 366
           ALQ++I
Sbjct: 372 ALQADI 377


>gi|254292900|ref|YP_003058923.1| flagellar P-ring protein [Hirschia baltica ATCC 49814]
 gi|254041431|gb|ACT58226.1| flagellar P-ring protein [Hirschia baltica ATCC 49814]
          Length = 369

 Score =  322 bits (826), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 175/368 (47%), Positives = 253/368 (68%), Gaps = 9/368 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
            AF +  L+ L+ + A   SR+KD+V ++  RDNQLIGYG+VVGL G+GDSLR+SP T Q
Sbjct: 6   CAFFLTLLLSLNSLGAAAGSRLKDIVDIEGVRDNQLIGYGIVVGLNGSGDSLRNSPMTRQ 65

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           S+ ++L+ LG++T    L +KNVAAVMVTA+LP F++ GSRID++++++GDA SL GG L
Sbjct: 66  SLEAMLERLGVNTREETLNTKNVAAVMVTASLPAFSTAGSRIDITVSAMGDAKSLEGGTL 125

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFK 183
           ++T L+GA+G +YAV QGSV V G    G S S+ +  + T G+I NGA+VE E+P    
Sbjct: 126 LVTPLMGANGEVYAVGQGSVAVGGFAAGGDSGSALVRNVPTNGRIPNGALVELEVPYALN 185

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRL 241
           +   L L LRNPDF+TA RI+  INSY        +A A D  TV +++P N    ++ L
Sbjct: 186 NQNKLRLSLRNPDFTTATRISSVINSY----MGTTVAFAMDPATVALNRPPNFQGGMSML 241

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           ++E+E L VE D PAR++INE TG IV+G+NVR+S+V ++ GNLT+ ++E   V QPNAF
Sbjct: 242 LAEIERLEVEPDQPARIVINETTGIIVMGENVRVSQVAIAQGNLTISVSEQPAVSQPNAF 301

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            + G TV    TD+  +++    +LI     LN L++G+N++G+    +ISILQ +KA+G
Sbjct: 302 GA-GETVVVPQTDIAANEDVADLALIGGSVPLNDLVNGLNALGVSPRDMISILQALKASG 360

Query: 361 ALQSEIII 368
           ALQ++I I
Sbjct: 361 ALQADIEI 368


>gi|218531214|ref|YP_002422030.1| flagellar basal body P-ring protein [Methylobacterium
           chloromethanicum CM4]
 gi|218523517|gb|ACK84102.1| flagellar P-ring protein [Methylobacterium chloromethanicum CM4]
          Length = 380

 Score =  322 bits (825), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 174/366 (47%), Positives = 246/366 (67%), Gaps = 9/366 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +A L    + L    A  +SR+KD+ +++  R NQL+GYG+VVGL GTGD+L + PFT+Q
Sbjct: 17  VAVLACLAVLLPPAPASALSRVKDLAAVEGVRSNQLVGYGIVVGLNGTGDTLNNIPFTKQ 76

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           S++++L+ LGI+T G  + ++N+AAVMVTANLPPFA+ G+ IDV+++SLGDA SL+GG L
Sbjct: 77  SLQAMLERLGINTRGATMRTQNLAAVMVTANLPPFATQGTHIDVTVSSLGDAKSLQGGTL 136

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           V TSLLGADG IYA+AQGSV ++G   +G+++    G+ T G+I NGA+VERE+  K  +
Sbjct: 137 VATSLLGADGEIYALAQGSVAIAGFSAEGEAAKITRGVPTNGRISNGALVEREMAFKLNE 196

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLM 242
           +  L L LRNPDF+TA RIA  IN +         AE  D  T+ +  P     ++ RL+
Sbjct: 197 ARSLRLSLRNPDFTTAKRIASAINDF----MGADTAEPTDPATITLQIPAKYRGNMIRLI 252

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +EVE L VE D  ARV+++ER+G IV+G +VR+S V ++ GNLTV ITE   V QP    
Sbjct: 253 TEVEQLKVEPDQTARVVVDERSGIIVMGRDVRVSTVAIAQGNLTVTITEQPMVSQPAPL- 311

Query: 303 SNGSTVTQNNTDLKVSDNKGS-FSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           SNG T     T +KV    G+  +L+ +   L  L+ G+N++G+    +ISILQ IK AG
Sbjct: 312 SNGQTAVVPRTGVKVDTGDGNKLALVKEGVSLRELVDGLNALGVGPRDLISILQAIKTAG 371

Query: 361 ALQSEI 366
           ALQ++I
Sbjct: 372 ALQADI 377


>gi|240139795|ref|YP_002964272.1| flagella basal body protein [Methylobacterium extorquens AM1]
 gi|254562210|ref|YP_003069305.1| flagella basal body protein [Methylobacterium extorquens DM4]
 gi|240009769|gb|ACS40995.1| flagella basal body protein [Methylobacterium extorquens AM1]
 gi|254269488|emb|CAX25454.1| flagella basal body protein [Methylobacterium extorquens DM4]
          Length = 380

 Score =  322 bits (825), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 174/366 (47%), Positives = 246/366 (67%), Gaps = 9/366 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +A L    + L    A  +SR+KD+ +++  R NQL+GYG+VVGL GTGD+L + PFT+Q
Sbjct: 17  VAVLACLAVLLPPAPASALSRVKDLAAVEGVRSNQLVGYGIVVGLNGTGDTLNNIPFTKQ 76

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           S++++L+ LGI+T G  + ++N+AAVMVTANLPPFA+ G+ IDV+++SLGDA SL+GG L
Sbjct: 77  SLQAMLERLGINTRGATMRTQNLAAVMVTANLPPFATQGTHIDVTVSSLGDAKSLQGGTL 136

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           V TSLLGADG IYA+AQGSV ++G   +G+++    G+ T G+I NGA+VERE+  K  +
Sbjct: 137 VATSLLGADGEIYALAQGSVAIAGFSAEGEAAKITRGVPTNGRISNGALVEREMAFKLNE 196

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLM 242
           +  L L LRNPDF+TA RIA  IN +         AE  D  T+ +  P     ++ RL+
Sbjct: 197 ARSLRLSLRNPDFTTAKRIASAINDF----MGADTAEPTDPATITLQIPAKYRGNMIRLI 252

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +EVE L VE D  ARV+++ER+G IV+G +VR+S V ++ GNLTV ITE   V QP    
Sbjct: 253 TEVEQLKVEPDQTARVVVDERSGIIVMGRDVRVSTVAIAQGNLTVTITEQPMVSQPAPL- 311

Query: 303 SNGSTVTQNNTDLKVSDNKGS-FSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           SNG T     T +KV    G+  +L+ +   L  L+ G+N++G+    +ISILQ IK AG
Sbjct: 312 SNGQTAVVPRTGVKVDTGDGNKLALVKEGVSLRELVDGLNALGVGPRDLISILQAIKTAG 371

Query: 361 ALQSEI 366
           ALQ++I
Sbjct: 372 ALQADI 377


>gi|254500860|ref|ZP_05113011.1| flagellar P-ring protein FlgI [Labrenzia alexandrii DFL-11]
 gi|222436931|gb|EEE43610.1| flagellar P-ring protein FlgI [Labrenzia alexandrii DFL-11]
          Length = 381

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 177/370 (47%), Positives = 248/370 (67%), Gaps = 12/370 (3%)

Query: 4   RIAFLIFSLIGLH-EISAQVV--SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           R+  +  +L+GL   I+ Q V  SRIKD+   +  R+NQLIGYGLVVGL GTGDSL ++P
Sbjct: 14  RVTLVAAALVGLQLAIAVQAVASSRIKDIADFEGIRENQLIGYGLVVGLNGTGDSLNNTP 73

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FT+QS++++L+ LG++T    L +  VAAVMVTANLPPF++ G+RIDVS+++LGDASSL+
Sbjct: 74  FTQQSLQAMLERLGVNTRNIPLNTDTVAAVMVTANLPPFSTQGTRIDVSVSALGDASSLQ 133

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L++T L+GADG +YA+AQGSV + G   +G ++S + G+ T G+I NG +VEREL  
Sbjct: 134 GGTLLVTPLVGADGEVYAIAQGSVAIGGFSAQGDAASIVRGVPTAGRIANGGLVERELDF 193

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--L 238
           K      + L LRNPD +TA R+A  IN         P AE  D  TV++  P   D  +
Sbjct: 194 KLASLTSVRLALRNPDLTTARRVALSINEL----IGMPTAEPVDPATVQLELPRQYDGNI 249

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             L++++E L VE D  ARVII+E +G IV+G +V++S V V+ GNLTV I E  +VVQP
Sbjct: 250 VDLLTDIEQLIVEPDLAARVIIDENSGIIVMGQDVKVSMVAVAQGNLTVTIAETPEVVQP 309

Query: 299 NAFSSNGSTVTQNNTDLKV-SDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGI 356
             F +NG T     TDL V +D     +++ +   L  L+ G+N++G+    +ISILQ I
Sbjct: 310 LPF-ANGQTAIAPRTDLNVNTDPDAKLAIVPNTVTLKQLVDGLNALGIGPRDMISILQAI 368

Query: 357 KAAGALQSEI 366
           KA+GALQ+EI
Sbjct: 369 KASGALQAEI 378


>gi|170751918|ref|YP_001758178.1| flagellar basal body P-ring protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170658440|gb|ACB27495.1| flagellar P-ring protein [Methylobacterium radiotolerans JCM 2831]
          Length = 378

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 171/347 (49%), Positives = 242/347 (69%), Gaps = 9/347 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SR+KD+ S++  R NQL+GYG+VVGL GTGD+L + PFT+QS++++L+ LG++T G  + 
Sbjct: 34  SRVKDLASIEGVRQNQLVGYGIVVGLNGTGDTLNNIPFTKQSLQAMLERLGVNTRGATMR 93

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           ++N+AAVMVTA+LPPFA+ G+RIDV+++SLGDA SL+GG L++T LLGADG +YA+AQGS
Sbjct: 94  TQNLAAVMVTASLPPFAAQGTRIDVTVSSLGDAKSLQGGTLLVTPLLGADGEVYALAQGS 153

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V ++G   +G ++    G+ T G+I NGA +ERE+  K  D+  L L LRNPDF+T+ RI
Sbjct: 154 VAIAGFAAEGDAAKITRGVPTNGRISNGANIEREIAFKLNDARSLRLSLRNPDFTTSKRI 213

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPT--NIDLTRLMSEVEMLTVETDTPARVIIN 261
           A  IN +         AE  D  TV +  P   N ++ RL++EVE L VE D  ARV+++
Sbjct: 214 AAAINDF----MGADTAEPTDPATVTIQIPARYNGNMIRLITEVEQLKVEPDQTARVVVD 269

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           ER+G IV+G +VR+S V ++ GNLTV ITE  QV QP    SNG TV    T +KV    
Sbjct: 270 ERSGIIVMGRDVRVSTVAIAQGNLTVTITEQPQVSQPAPL-SNGRTVVVPRTGVKVDTGD 328

Query: 322 GS-FSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           G+  +L+ +   L  L+ G+N++G+    +ISILQ IKAAGALQ++I
Sbjct: 329 GNKLALVKEGVSLRELVDGLNALGVGPRDLISILQAIKAAGALQADI 375


>gi|154252998|ref|YP_001413822.1| flagellar P-ring protein [Parvibaculum lavamentivorans DS-1]
 gi|154156948|gb|ABS64165.1| flagellar P-ring protein [Parvibaculum lavamentivorans DS-1]
          Length = 378

 Score =  318 bits (816), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 172/368 (46%), Positives = 249/368 (67%), Gaps = 12/368 (3%)

Query: 7   FLIFSLIGL----HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           FL   L GL    +   AQ  SRIKD+V ++  RDN L+GYGLVVGL GTGD+LR++PFT
Sbjct: 12  FLTLVLAGLLAAGNPGGAQASSRIKDIVDVEGIRDNMLVGYGLVVGLNGTGDTLRNAPFT 71

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           +QS+  +L+ LG++T G  L + NVAAVMV+ANLP FAS G+RIDV++++LGDA++L+GG
Sbjct: 72  QQSLIGMLERLGVNTRGTSLKTANVAAVMVSANLPAFASQGTRIDVTVSALGDATNLQGG 131

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
           +L++T L+GADG +YAVAQGS+   G   KG+ +S   G+ T G+I NGAIVEREL  + 
Sbjct: 132 VLLVTPLMGADGQVYAVAQGSLATGGFAAKGEGASVTRGVPTNGRIANGAIVERELDFQL 191

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTR 240
            D   L L LRNPD +TA R+A  IN++         A A +  TV+++ P      +  
Sbjct: 192 SDLRALRLSLRNPDLTTAQRVASAINAF----IGTQTATADNPTTVQLTVPPAYRGGVVA 247

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           L++++E L V+ D  ARV+I+E +G IV+G +VR+S V ++ GNLT+ ++E+ QV QP+ 
Sbjct: 248 LLTDIEQLRVQPDLTARVVIDESSGVIVMGQDVRVSMVAIAQGNLTISVSESPQVSQPSP 307

Query: 301 FSSNGSTVTQNNTDLKVSDNKGS-FSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKA 358
           FS+ G TV    TD+ V +  G    ++D    L  L+ G+N++G+    +I+ILQ IK+
Sbjct: 308 FSTQGDTVVVPRTDIDVDEETGKQLGILDGSISLKELVDGLNALGVSPRDMITILQAIKS 367

Query: 359 AGALQSEI 366
           +GALQ+EI
Sbjct: 368 SGALQAEI 375


>gi|299131793|ref|ZP_07024988.1| flagellar P-ring protein [Afipia sp. 1NLS2]
 gi|298591930|gb|EFI52130.1| flagellar P-ring protein [Afipia sp. 1NLS2]
          Length = 369

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 167/346 (48%), Positives = 243/346 (70%), Gaps = 8/346 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++  G  + 
Sbjct: 26  SRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNIRGATIR 85

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           + NVAAVMVT NLP FA+ G+R+DV+++++GDA SL+GG L++T LLGADGN+YAVAQGS
Sbjct: 86  TGNVAAVMVTGNLPAFATQGTRMDVTVSAMGDAKSLQGGTLLVTPLLGADGNVYAVAQGS 145

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + + G   +GQ++S  +G+ T G+I NGA+VERE+        ++ L LRN DF+TA RI
Sbjct: 146 LAIGGFQAEGQAASVTKGVPTNGRIANGALVEREIEFALNKLPNVRLALRNSDFTTAKRI 205

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIIN 261
           A  +N Y        IAE  D  TV++S P     ++  L++E+E L VE D  A+++I+
Sbjct: 206 AAAVNDY----LGDKIAEPVDPSTVQLSIPAEFKGNVVALLTEIEQLQVEPDMGAKIVID 261

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPNAF +NG TV   NT + V ++ 
Sbjct: 262 ERSGIIVMGRDVRVNTVAVAQGNLTVTISESPQVSQPNAF-ANGRTVVTPNTSVGVREDG 320

Query: 322 GSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              +L+ D   L  L+ G+N +G+    +ISILQ IKAAGA+Q++I
Sbjct: 321 KKLALVKDGVSLQQLVDGLNGLGIGPRDMISILQAIKAAGAIQADI 366


>gi|254470489|ref|ZP_05083893.1| flagellar P-ring protein FlgI [Pseudovibrio sp. JE062]
 gi|211960800|gb|EEA95996.1| flagellar P-ring protein FlgI [Pseudovibrio sp. JE062]
          Length = 358

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 164/352 (46%), Positives = 242/352 (68%), Gaps = 8/352 (2%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
           + A   SRIKD+   +  RDNQLIGYGLVVGLQGTGDSL +SPFT QS++++L+ LG++T
Sbjct: 9   LQANAASRIKDIADFEGIRDNQLIGYGLVVGLQGTGDSLNASPFTRQSLQAMLERLGVNT 68

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
               L +KN AAVMVTANLP F++ G+RIDV++++LGDA +L+GG L++T L+GADG  Y
Sbjct: 69  NEADLNTKNTAAVMVTANLPAFSTQGTRIDVTVSALGDAKNLQGGTLLVTPLMGADGEAY 128

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           A+AQG + ++G   +G+++S + G+ T G+I NGA+VERE+  K    + + L LRNPD 
Sbjct: 129 AIAQGPLAIAGFAAQGEAASVVRGVPTSGRIPNGALVEREVEFKLSSLSSIRLALRNPDL 188

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTP 255
           +T+ RIA  IN         P AE  D  TV+++ P   D  +  L++++E L VE D P
Sbjct: 189 TTSRRIAIAINEL----IGLPTAEPLDPATVRLTLPKQFDGNIVDLITDIEQLIVEPDLP 244

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+++I+E +G IV+G  V++S V V+ GNLTV I E+ ++VQP  F + G T     +D+
Sbjct: 245 AKIVIDESSGIIVMGQQVKVSTVAVAQGNLTVTIAESPEIVQPLPF-AQGDTAAVPRSDV 303

Query: 316 KVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +V+++    +L++    L  L+ G+N++G+    +ISILQ IKAAGALQ+EI
Sbjct: 304 QVTEDNRQLALVNETITLQQLVDGLNALGIGPRDLISILQAIKAAGALQAEI 355


>gi|209964695|ref|YP_002297610.1| flagellar P-ring protein FlgI [Rhodospirillum centenum SW]
 gi|209958161|gb|ACI98797.1| flagellar P-ring protein FlgI [Rhodospirillum centenum SW]
          Length = 395

 Score =  316 bits (810), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 174/352 (49%), Positives = 236/352 (67%), Gaps = 10/352 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           A+  SRIKDV  ++  RDN L+GYGLVVGL GTGDS+ +SPFTEQS+  +L+ LG++  G
Sbjct: 46  ARAQSRIKDVADVEGVRDNMLVGYGLVVGLNGTGDSINNSPFTEQSLIGMLERLGVNIRG 105

Query: 80  GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
             + ++NVAAVMVTA LPPF++ G+RIDV++ +LGDA +L+GG L++T LLGADG +YAV
Sbjct: 106 ETVRTRNVAAVMVTATLPPFSAQGTRIDVNVGTLGDAKNLQGGTLLVTPLLGADGEVYAV 165

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQG+V VSG   +G ++S   G+ T G+I  GAIVERE+     D   + L LRNPDF+T
Sbjct: 166 AQGAVAVSGFSAQGAAASVTRGVPTAGRIAGGAIVEREIAFDLTDLPYVRLSLRNPDFTT 225

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT--NIDLTRLMSEVEMLTVETDTPAR 257
           A RI++ IN+     F  P+A A D  +V V  P     D+   + ++E L V  D PAR
Sbjct: 226 AKRISESINAS----FGSPVAHATDPASVLVDVPPQRKADIVGFIRDMEQLRVTPDQPAR 281

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           V+I+E +G IV+G+NVRIS V ++ GNLT++ITE  QV QP   S  G T     TD++V
Sbjct: 282 VVIDEASGVIVMGENVRISTVAIAQGNLTIRITETPQVSQPGPLSQGGQTAVVPRTDIQV 341

Query: 318 ---SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              SD K +  L     L  L+  +N++G+    +ISILQ IKAAGALQ+EI
Sbjct: 342 DEQSDRKLAV-LRTGVSLQELVQSLNALGVGPRDMISILQSIKAAGALQAEI 392


>gi|328543151|ref|YP_004303260.1| flagellar P-ring protein I [polymorphum gilvum SL003B-26A1]
 gi|326412897|gb|ADZ69960.1| Flagellar P-ring protein I [Polymorphum gilvum SL003B-26A1]
          Length = 371

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 175/371 (47%), Positives = 251/371 (67%), Gaps = 12/371 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++FRI+  +F ++ L   +A   SRIKD+   +  RDNQLIGYGLVVGL GTGDSLR++P
Sbjct: 5   ILFRISA-VFVVLALLSSAALSASRIKDIADFEGIRDNQLIGYGLVVGLNGTGDSLRNAP 63

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FT QS++++L+ LG++T G  L +KNVAAVMVTANLP F++ G+R+DVS+++LGD+ SL+
Sbjct: 64  FTRQSLQAMLERLGVNTRGVDLNTKNVAAVMVTANLPAFSTQGTRLDVSVSALGDSESLQ 123

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L++T LLGADG +YA+AQGSV + G   +G ++S + G+ T G+I NGA++EREL  
Sbjct: 124 GGTLLVTPLLGADGEVYAIAQGSVAIGGFSAQGDAASIVRGVPTSGRIANGALIERELDF 183

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--L 238
           K      + L LRNPD +T+ RIA  IN         P AE  D  TV++  P   +  +
Sbjct: 184 KLASMTSVRLALRNPDLTTSRRIALSINEL----IGLPTAEPIDPATVRIDLPRQYEGNI 239

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             L++++E L +E D PARV+I+E +G IV+G NV++S V V+ GNLTV I E  +V QP
Sbjct: 240 VDLLTDIEQLIIEPDLPARVVIDENSGIIVMGQNVKVSTVAVAQGNLTVTIAETPEVSQP 299

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPD---LNSLISGMNSIGLKTDGIISILQG 355
             F +NG TV    +++ V++      L   P+   L  L+ G+N++G+    +ISILQ 
Sbjct: 300 LPF-ANGETVVVPRSEVTVTEQTDR-KLAVVPETITLQQLVDGLNALGIGPRDMISILQA 357

Query: 356 IKAAGALQSEI 366
           IKA+GALQ+EI
Sbjct: 358 IKASGALQAEI 368


>gi|220924572|ref|YP_002499874.1| flagellar basal body P-ring protein [Methylobacterium nodulans ORS
           2060]
 gi|219949179|gb|ACL59571.1| flagellar P-ring protein [Methylobacterium nodulans ORS 2060]
          Length = 377

 Score =  315 bits (807), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 168/351 (47%), Positives = 241/351 (68%), Gaps = 9/351 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           A  +SR+KD+ +++  R NQL+GYG+VVGL GTGD+L + PFT+QS++++L+ LG++T G
Sbjct: 29  ALALSRVKDLAAIEGVRPNQLVGYGIVVGLNGTGDTLNNVPFTKQSVQAMLERLGVNTRG 88

Query: 80  GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
             + + N+AAVMVTANLPPFA+ G+RIDV+++SLGDA SL+GG L++T LLGADG +YA+
Sbjct: 89  ATMRTANLAAVMVTANLPPFATQGTRIDVTVSSLGDAKSLQGGTLLVTPLLGADGEVYAL 148

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQGS+ ++G   +G ++    G+ T G+I NGA++ERE+  K      L L LRNPD +T
Sbjct: 149 AQGSLAIAGFQAEGDAAKITRGVPTNGRIANGAMIEREIEFKLNQQRMLRLSLRNPDLTT 208

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPAR 257
           + RIA  IN +         AE  D  TV +  P     ++ RL++E+E L VE D  AR
Sbjct: 209 SKRIAAAINDF----MGADTAEPTDPSTVTLQVPARYQGNMIRLLTEIEQLKVEPDQTAR 264

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           V+I+ER+G IV+G +VR+S V V+ GNLTV ITE  QV QP    S G+TV    T LKV
Sbjct: 265 VVIDERSGIIVMGRDVRVSTVAVAQGNLTVTITEQPQVSQPEPL-SQGTTVVVPRTALKV 323

Query: 318 -SDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            + ++   +L+ +   L  L+ G+N++G+    +ISILQ IKAAGALQ++I
Sbjct: 324 DTGDRNKLALVKEGVSLRELVDGLNALGVGPRDLISILQAIKAAGALQADI 374


>gi|148256802|ref|YP_001241387.1| flagellar basal body P-ring protein [Bradyrhizobium sp. BTAi1]
 gi|166214831|sp|A5EMT7|FLGI_BRASB RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|146408975|gb|ABQ37481.1| Flagellar P-ring protein (basal body P-ring protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 374

 Score =  312 bits (800), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 164/368 (44%), Positives = 251/368 (68%), Gaps = 8/368 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F++A      +    +SA   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PF
Sbjct: 9   LFQVACAAIVALASSAMSAHATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPF 68

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T+QS++++L+ +G++  G  + + NVAAVMVT NLPPFA+ G+R+DV++++LGDA +L+G
Sbjct: 69  TKQSLQAMLERMGVNIRGATIRTGNVAAVMVTGNLPPFATQGTRMDVTVSALGDAKNLQG 128

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L++T LLGADGN+YAVAQGS+ +SG   +G+++  + G+ T G+I NGAI+ERE+   
Sbjct: 129 GTLLVTPLLGADGNVYAVAQGSLAISGFQAEGEAAKIVRGVPTVGRIANGAIIEREIEFA 188

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLT 239
                ++ L LRN DF+TA RIA  IN +   + + PI    D  TV++S P     ++ 
Sbjct: 189 LNRLPNVRLALRNADFTTAKRIAAAINDFLGVKTAEPI----DPSTVQLSIPPEFKGNVV 244

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             ++E+E L V+ D  A+++I+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN
Sbjct: 245 AFLTEIEQLQVDPDLAAKIVIDERSGIIVMGRDVRVATVAVAQGNLTVTISESPQVSQPN 304

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
              S G TV    T + V+++   F+++ D   L  L+ G+N +G+    +ISILQ IKA
Sbjct: 305 PL-SQGRTVVTPRTSVGVTEDGKKFAVVKDGVSLQQLVDGLNGLGIGPRDLISILQAIKA 363

Query: 359 AGALQSEI 366
           AGA++++I
Sbjct: 364 AGAIEADI 371


>gi|170742318|ref|YP_001770973.1| flagellar basal body P-ring protein [Methylobacterium sp. 4-46]
 gi|168196592|gb|ACA18539.1| flagellar P-ring protein [Methylobacterium sp. 4-46]
          Length = 371

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/348 (47%), Positives = 239/348 (68%), Gaps = 9/348 (2%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           +SR+KD+ +++  R NQL+GYG+VVGL GTGD+L + PFT+QS++++L+ LG++T G  +
Sbjct: 26  LSRVKDLATIEGVRPNQLVGYGIVVGLNGTGDTLNNVPFTKQSVQAMLERLGVNTRGATM 85

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            + N+AAVMVTANLPPFA+ G+RIDV+++SLGDA SL+GG L++T LLGADG +YA+AQG
Sbjct: 86  RTANLAAVMVTANLPPFAAQGTRIDVTVSSLGDAKSLQGGTLLVTPLLGADGEVYALAQG 145

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           S+ ++G   +G ++    G+ T G+I NGA++ERE+  K      L L LRNPD +T+ R
Sbjct: 146 SLAIAGFQAEGDAAKVTRGVPTNGRIANGAMIEREIEFKLGQQRALRLSLRNPDLTTSKR 205

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVII 260
           IA  IN +         AE  D  TV +  P     ++ RL++E+E L VE D  ARV+I
Sbjct: 206 IAAAINDF----MGADTAEPTDPSTVTLQVPPRYQGNMIRLLTEIEQLKVEPDQTARVVI 261

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV-SD 319
           +ER+G IV+G +VR+S V V+ GNLTV ITE  QV QP    S G TV    T +KV + 
Sbjct: 262 DERSGIIVMGRDVRVSTVAVAQGNLTVTITEQPQVSQPEPL-SQGQTVVVPRTAIKVETG 320

Query: 320 NKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           ++   +L+ +   L  L+ G+N++G+    +ISILQ IKA+GALQ++I
Sbjct: 321 DRNKLALVKEGVSLRELVDGLNALGIGPRDLISILQAIKASGALQADI 368


>gi|197103393|ref|YP_002128771.1| flagellar basal-body P-ring protein [Phenylobacterium zucineum
           HLK1]
 gi|196480669|gb|ACG80196.1| flagellar basal-body P-ring protein [Phenylobacterium zucineum
           HLK1]
          Length = 377

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 178/366 (48%), Positives = 243/366 (66%), Gaps = 12/366 (3%)

Query: 6   AFL-IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           AF+ +F++  L   S+   SRIKD+V ++  R+N L+GYGLVVGL GTGD+LR++PFT+Q
Sbjct: 16  AFVSLFAVGLLAAPSSAATSRIKDIVQVEGVRENALVGYGLVVGLAGTGDALRNAPFTQQ 75

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           S+ ++L+ LG++T   RL +KNVAAVMVTA LPPFA+ GS++D +++++G A SL GG L
Sbjct: 76  SLEAMLERLGVNTRDARLNTKNVAAVMVTAKLPPFAAAGSQVDATVSAMGSAKSLMGGTL 135

Query: 125 VMTSLLGADGNIYAVAQGSV-VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           ++T LLGADG  YAVAQGSV   +        SS  +G+ T G+I +GAIVERE   +F 
Sbjct: 136 LVTPLLGADGQTYAVAQGSVQTGAVSASGASGSSVTKGVPTSGRIASGAIVERETGFQFN 195

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMS 243
               L L LRNPDF+TA+R+AD IN     RF    A A     V++S P     +  ++
Sbjct: 196 AMRQLRLNLRNPDFTTAVRVADAIN----RRFPD-AARAQSPTIVQLSVPATSTTSGFVT 250

Query: 244 EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
            VE L VETDTPARV+I+E  G IV+G +VRIS V +S GNLT+ + E   V QP+ F  
Sbjct: 251 AVEALPVETDTPARVVIDEVAGVIVMGADVRISTVAISQGNLTISVRETPAVSQPSPF-G 309

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAP---DLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            G TV    + ++V + KG   L+  P    L SL+SG+N++G+    +ISILQ IKAAG
Sbjct: 310 QGETVVTPQSSVEVDEEKGR-GLVRLPAGASLGSLVSGLNALGVTPRDMISILQAIKAAG 368

Query: 361 ALQSEI 366
           ALQ+EI
Sbjct: 369 ALQAEI 374


>gi|163794158|ref|ZP_02188131.1| Flagellar P-ring protein [alpha proteobacterium BAL199]
 gi|159180772|gb|EDP65291.1| Flagellar P-ring protein [alpha proteobacterium BAL199]
          Length = 361

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 173/365 (47%), Positives = 249/365 (68%), Gaps = 13/365 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           ++IF+ + L   SAQ  +RIKD+V  +  R+N LIGYGL VGL+GTGD + S+ FT +S+
Sbjct: 2   WVIFA-VSLGGASAQ--TRIKDIVDFEGVRENLLIGYGLAVGLKGTGDDIGSAIFTRESL 58

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
             +L+ LG++     L +KNVAAVMVTA LPPFA+ G+RID++++++GDA SL GG L++
Sbjct: 59  VGMLERLGVNARDDNLDTKNVAAVMVTAILPPFATQGTRIDITVSAIGDADSLLGGQLLV 118

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L+GADG +YAVAQG V VSG   +G ++S   G++TGG+I NGAIVERE+        
Sbjct: 119 TPLIGADGEVYAVAQGPVAVSGFSAQGAAASVSRGVTTGGRISNGAIVEREVSFALNQME 178

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSE 244
            + + LRNPDF+T+ RIA  IN++       PIA++ DS TV++  P     +   L+++
Sbjct: 179 TVRIALRNPDFTTSRRIAQAINAF----VGGPIAQSTDSGTVRMLVPDAYRNNAVALITD 234

Query: 245 VEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           VE L V  DT A+V+I+E+TG IV+G+NVRI+ V ++ GNLT++ITE  QV QP  F+  
Sbjct: 235 VEQLRVTPDTIAKVVIDEQTGVIVMGENVRINTVAIAQGNLTIRITETPQVSQPQPFAQT 294

Query: 305 GSTVTQNNTDLKVSDNKGSFSLIDAP---DLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           G TVT   T +++ D+K    L   P    L  L++G+N++G+    +ISILQ IKAAGA
Sbjct: 295 GETVTVPRTQIEIDDDKDK-KLTVLPRQVTLQELVNGLNALGVGPRDMISILQAIKAAGA 353

Query: 362 LQSEI 366
           LQ+E+
Sbjct: 354 LQAEL 358


>gi|75675304|ref|YP_317725.1| flagellar basal body P-ring protein [Nitrobacter winogradskyi
           Nb-255]
 gi|115311526|sp|Q3STL8|FLGI_NITWN RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|74420174|gb|ABA04373.1| Flagellar P-ring protein [Nitrobacter winogradskyi Nb-255]
          Length = 374

 Score =  308 bits (789), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 163/349 (46%), Positives = 241/349 (69%), Gaps = 8/349 (2%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
              SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++  G 
Sbjct: 28  HATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNIRGA 87

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
            + + NVAAVMVT NLP FA+ G+R+DV+++++GDA SL+GG L++T LLGADGN+YAVA
Sbjct: 88  TIRTGNVAAVMVTGNLPAFATQGTRMDVTVSAMGDARSLQGGTLLVTPLLGADGNVYAVA 147

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QGS+ + G   +G ++S  +G+ T G+I NGAIVERE+        ++ L LRN DF+TA
Sbjct: 148 QGSLAIGGFSAEGAAASVTKGVPTNGRIANGAIVEREIEFALNRMPNVRLALRNGDFTTA 207

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARV 258
            RIA  +N +   + + PI    D  TV++S P     ++  L++E+E L VE D  A++
Sbjct: 208 KRIAAAVNDFLGTKTAEPI----DPSTVQLSIPAEFRGNVVALLTEIEQLQVEPDITAKI 263

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   SNG TV    TD+ V+
Sbjct: 264 IIDERSGIIVMGRDVRVATVAVAQGNLTVSISESPQVSQPNPL-SNGRTVMTPRTDVGVT 322

Query: 319 DNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +N    +L+ +   L  L+ G+N +G+    +I ILQ IKAAGA++++I
Sbjct: 323 ENGNKLALVKNGVSLQELVDGLNGLGIGPRDLIGILQAIKAAGAIEADI 371


>gi|296531746|ref|ZP_06894571.1| flagellar P-ring protein FlgI [Roseomonas cervicalis ATCC 49957]
 gi|296267929|gb|EFH13731.1| flagellar P-ring protein FlgI [Roseomonas cervicalis ATCC 49957]
          Length = 371

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 158/346 (45%), Positives = 235/346 (67%), Gaps = 9/346 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KDVVS++  R NQL+GYGLV+GLQGTGD LR++PFT+QS+ ++L+ +G++    R+ +
Sbjct: 28  RLKDVVSIEGVRGNQLVGYGLVIGLQGTGDQLRNNPFTQQSLTAMLERMGVNVADARVQT 87

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KN AAV+VTA LPPF+  G+ IDV ++SLGD+ SL GG L++T LLGADG +YAVAQG V
Sbjct: 88  KNTAAVIVTATLPPFSRQGTTIDVQVSSLGDSRSLNGGTLIVTPLLGADGEVYAVAQGPV 147

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           VV G    GQ+ S   G++T G++  G +VERE+P   ++   + L LR+PDF+TA+R+ 
Sbjct: 148 VVGGFQAAGQAQSITSGVTTQGRVPGGGLVEREVPVDLRNLQSIRLSLRSPDFTTAVRVE 207

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTPARVIINE 262
           + +N     RF    A A D  TV++  P      L  L++++E LT+  +TPARV+++E
Sbjct: 208 EALN----QRFGAGSATALDLATVEMRVPPGFQERLPGLVAQMEALTIRPETPARVVVDE 263

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGTI++G  VRI  V +++GNL +++TE+  V QPN   + G TV    T ++V D +G
Sbjct: 264 RTGTIIVGAQVRIDPVAITHGNLVIRVTESPIVSQPNPL-AGGETVVVPRTQVEVDDQRG 322

Query: 323 S--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
               +L  A  L  L+ G+N++GL    +IS+L  +KA+GAL +E+
Sbjct: 323 RRLATLPPASTLKDLVDGLNALGLAPRDLISVLVALKASGALHAEL 368


>gi|288962670|ref|YP_003452964.1| flagellar P-ring protein precursor [Azospirillum sp. B510]
 gi|288914936|dbj|BAI76420.1| flagellar P-ring protein precursor [Azospirillum sp. B510]
          Length = 390

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 169/349 (48%), Positives = 237/349 (67%), Gaps = 9/349 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +R+KD+V+    R NQL+GYGLVVGL GTGD L ++PFTEQS++ +++ LGI+T G  L 
Sbjct: 46  TRVKDLVTFDGVRRNQLVGYGLVVGLNGTGDRLINTPFTEQSLKGMMERLGINTRGETLR 105

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           ++N AAVMVTA+LPPF   G+ +DV++++LGDA+SL GG LV+T LLGADG  YAVAQG 
Sbjct: 106 TRNAAAVMVTASLPPFPRQGTNVDVTVSALGDATSLLGGTLVVTPLLGADGEAYAVAQGP 165

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + VSG    G +++  +G+ T  +I NGA VEREL     D   + + LRNPDF+TAIRI
Sbjct: 166 LSVSGYTAGGAAATVTKGVPTTARIANGATVERELKFALNDVGAVRMALRNPDFTTAIRI 225

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIIN 261
           AD +NS    R     A   D  TV V    +   +++RL+ E+E L V  D  ARV+++
Sbjct: 226 ADAVNS----RLGAGNARVVDLTTVDVRITGSYVGNVSRLIGEIEQLPVRPDAIARVVVD 281

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           ER+GTIVIGD+VR+S+V ++ GNLTV++ E  QV QP  F SNGSTV    TD++V +  
Sbjct: 282 ERSGTIVIGDDVRVSRVAITQGNLTVRVVETPQVSQPQPF-SNGSTVVVPRTDVQVQEGN 340

Query: 322 G-SFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           G  F  +     L  L++G+N++G+    +++ILQ IKAAGAL +++ I
Sbjct: 341 GRQFVTVGGNVSLQQLVNGLNALGVGPRDMVAILQAIKAAGALHADLEI 389


>gi|146341915|ref|YP_001206963.1| flagellar basal body P-ring protein [Bradyrhizobium sp. ORS278]
 gi|146194721|emb|CAL78746.1| Flagellar P-ring protein (basal body P-ring protein)
           [Bradyrhizobium sp. ORS278]
          Length = 385

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 161/352 (45%), Positives = 243/352 (69%), Gaps = 8/352 (2%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
           + A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++ 
Sbjct: 36  MPAHATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNI 95

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
            G  + + NVAAVMVT NLPPFA+ G+R+DV++++LGDA +L+GG L++T LLGADGN+Y
Sbjct: 96  RGATIRTGNVAAVMVTGNLPPFATQGTRMDVTVSALGDAKNLQGGTLLVTPLLGADGNVY 155

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           AVAQGS+ +SG   +G+++  + G+ T G+I NGAI+ERE+        ++ L LRN DF
Sbjct: 156 AVAQGSLAISGFQAEGEAAKIVRGVPTVGRIANGAIIEREIEFALNRLPNVRLALRNADF 215

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTP 255
           +TA RIA  IN +   + + PI    D  TV++S P     ++   ++E+E L V+ D  
Sbjct: 216 TTAKRIAAAINDFLGVKTAEPI----DPSTVQLSVPPEFKGNVVAFLTEIEQLQVDPDLA 271

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+++I+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   S G TV    T +
Sbjct: 272 AKIVIDERSGIIVMGRDVRVATVAVAQGNLTVTISESPQVSQPNPL-SQGRTVVTPRTSV 330

Query: 316 KVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            V ++   F+++ D   L  L+ G+N +G+    +ISILQ IKAAGA++++I
Sbjct: 331 GVQEDGKKFAVVKDGVSLQQLVDGLNGLGIGPRDLISILQAIKAAGAIEADI 382


>gi|118588720|ref|ZP_01546128.1| flagellar P-ring protein precursor I [Stappia aggregata IAM 12614]
 gi|118438706|gb|EAV45339.1| flagellar P-ring protein precursor I [Stappia aggregata IAM 12614]
          Length = 380

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 163/349 (46%), Positives = 233/349 (66%), Gaps = 8/349 (2%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
           Q  SRIKD+   +  R+NQLIGYGLVVGL GTGDSL +SPFT+QS++++L+ LG++T   
Sbjct: 34  QAASRIKDIADFEGIRENQLIGYGLVVGLNGTGDSLNNSPFTQQSLQAMLERLGVNTRNI 93

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
            L +  VAAVMVTANLPPF++ G+RIDV++++LGD+ SL+GG L++T L+GADG +YA+A
Sbjct: 94  DLNTNTVAAVMVTANLPPFSTQGTRIDVNVSALGDSDSLQGGTLLVTPLVGADGEVYAIA 153

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QGS+ + G   +  ++S + G+ T G+I NG +VEREL  K      L L LRNPD +TA
Sbjct: 154 QGSIAIGGFSAQADAASVVRGVPTAGRIANGGLVERELDFKLASLTTLRLALRNPDLTTA 213

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTPARV 258
            RIA  +N         P AE  D  TV++  P   D  +  L++++E L VE D  AR+
Sbjct: 214 RRIALSVNEL----IGMPTAEPLDPATVRIDLPQQYDGNIVDLLTDIEQLIVEPDLAARI 269

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           +I+E +G IV+G +V++S V V+ GNLTV I E+ QV QP  F +NG T     +D+ V 
Sbjct: 270 VIDENSGIIVMGQDVKVSMVAVAQGNLTVTIAESPQVSQPLPF-ANGQTAVVPRSDVSVD 328

Query: 319 DNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +     +++     L  L+ G+N++G+    +ISILQ IKAAGALQ++I
Sbjct: 329 EEGSKLAIVPQTVTLKQLVDGLNALGIGPRDMISILQAIKAAGALQADI 377


>gi|83312923|ref|YP_423187.1| flagellar basal body P-ring protein [Magnetospirillum magneticum
           AMB-1]
 gi|115311523|sp|Q2W0J7|FLGI_MAGMM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|82947764|dbj|BAE52628.1| Flagellar basal-body P-ring protein [Magnetospirillum magneticum
           AMB-1]
          Length = 392

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 167/355 (47%), Positives = 236/355 (66%), Gaps = 17/355 (4%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP----- 78
           SRIKD+   +  RDN L+GYGLVVGL  TGDSL ++PFT++S+  +L+ LG++       
Sbjct: 40  SRIKDIADFEGVRDNMLVGYGLVVGLNSTGDSLTNAPFTKESLTGMLERLGVNIRDKTGA 99

Query: 79  -GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
              +L  KNVAAVM+TA LPPF+  G+RID++++++GDA  LRGG L++T L+GADG +Y
Sbjct: 100 ISSQLTPKNVAAVMITATLPPFSRQGTRIDINVSAMGDAKDLRGGTLLVTPLIGADGEVY 159

Query: 138 AVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           AV QG V   G    G S SS  +G+ T G+I NGAIVERELP +      + + LRNPD
Sbjct: 160 AVGQGQVATGGFTASGASGSSVTKGVPTAGRIANGAIVERELPFEMSHLESVKVSLRNPD 219

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDT 254
           F+T+ RIA  INS+     +RP+    D  TV+++ P     ++  L+++VE L VE D 
Sbjct: 220 FTTSRRIAQAINSFLGGDMARPV----DPGTVQIAVPPGYRGNVVGLLTDVEQLRVEPDQ 275

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            ARV+++E +GTIV+G+NVRIS V ++ G LT++ITE  QV QP+ FS  G+T T   TD
Sbjct: 276 MARVVVDEVSGTIVMGENVRISTVAIAQGQLTIRITETPQVSQPSPFSDAGTTTTVQRTD 335

Query: 315 LKVSDNKGSFSLIDAPD---LNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           ++V +  G+  L   P    L  L+ G+NS+G+    +I+ILQ IKAAGALQ+E+
Sbjct: 336 IQVDEGAGN-KLAVVPHKVTLQELVEGLNSLGIGPRDLITILQAIKAAGALQAEL 389


>gi|167647651|ref|YP_001685314.1| flagellar basal body P-ring protein [Caulobacter sp. K31]
 gi|189044483|sp|B0T853|FLGI_CAUSK RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|167350081|gb|ABZ72816.1| flagellar P-ring protein [Caulobacter sp. K31]
          Length = 371

 Score =  306 bits (785), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 169/362 (46%), Positives = 236/362 (65%), Gaps = 8/362 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L  + + +    A   SRIKD+V+ +  RDNQLIGYG+VVGL G+GDSLR++P T+QS+ 
Sbjct: 12  LALAAMTVMAAPADAKSRIKDIVAFEGVRDNQLIGYGIVVGLNGSGDSLRNAPMTKQSLE 71

Query: 68  SLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           ++L+  G++   G L +KN AAVMVTANLPPF++ G+R+DV++++LGDA SL GG L++T
Sbjct: 72  AMLERQGVNVRDGNLNTKNTAAVMVTANLPPFSAAGARMDVTVSTLGDAKSLLGGTLLVT 131

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           +L GADG  YAVAQGSV    +   G S SS  +G+ T G+I  G I+E+E   +     
Sbjct: 132 ALQGADGQTYAVAQGSVQTGSVSAGGASGSSVTKGVPTAGRIAAGGIIEKETGFQMVSMD 191

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVE 246
            L + LRNPDF+T+ RIAD IN     RF    A+A +   V V  P  +D+   ++ +E
Sbjct: 192 VLRMTLRNPDFTTSRRIADVIN----GRFPG-CAQAQNPTIVAVRPPAGMDMISFVTAIE 246

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            L VE D PA+VII+E  G IV+GD+VRIS+V ++ GNLT+ + EN  V QP  FS  G 
Sbjct: 247 NLEVEPDAPAKVIIDEVAGVIVMGDDVRISQVAIAQGNLTISVQENPAVSQPTPFSRGGQ 306

Query: 307 TVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
           TV    + + + + KG    +L     L SLI G+N++G+    +ISILQ IKA+GALQ+
Sbjct: 307 TVVVPQSAVSIEEEKGKKLLTLGGGASLKSLIGGLNALGVTPRDMISILQAIKASGALQA 366

Query: 365 EI 366
           EI
Sbjct: 367 EI 368


>gi|209884520|ref|YP_002288377.1| flagellar P-ring protein FlgI [Oligotropha carboxidovorans OM5]
 gi|209872716|gb|ACI92512.1| flagellar P-ring protein FlgI [Oligotropha carboxidovorans OM5]
          Length = 369

 Score =  306 bits (785), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 162/350 (46%), Positives = 236/350 (67%), Gaps = 8/350 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++  G
Sbjct: 22  AHATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNIRG 81

Query: 80  GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
             + + NVAAVMVT NLP FA+ G+R+DV+++++GDA SL+GG L++T LLGADGN+YAV
Sbjct: 82  ATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSAMGDAKSLQGGTLLVTPLLGADGNVYAV 141

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQGS+ + G   +G ++    G+ T G+I NGA+VERE+        ++ L LRN DF+T
Sbjct: 142 AQGSLAIGGFQAEGDAAKITRGVPTNGRIANGALVEREIEFALNRLPNVRLALRNSDFTT 201

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPAR 257
           A RIA  +N Y        +AE  D  TV++S P     +   L++E+E L VE D  A+
Sbjct: 202 AKRIAAAVNDY----LGTKVAEPVDPSTVQLSIPPEFKGNAVALLTEIEQLQVEPDAGAK 257

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           ++I+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QP  F  NG TV   NT + V
Sbjct: 258 IVIDERSGIIVMGRDVRVNTVAVAQGNLTVTISESPQVSQPAPF-GNGQTVVTPNTRVGV 316

Query: 318 SDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            ++    +L+ D   L  L+ G+N +G+    +I ILQ IKAAGA+Q++I
Sbjct: 317 QEDGKKLALVKDGVSLQQLVDGLNGLGIGPRDMIGILQAIKAAGAIQADI 366


>gi|23016699|ref|ZP_00056452.1| COG1706: Flagellar basal-body P-ring protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 391

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 172/354 (48%), Positives = 235/354 (66%), Gaps = 16/354 (4%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLG--ISTPGGR 81
           SRIKD+   +  RDN L+GYGLVVGL GTGDSL ++PFT++S+  +L+ LG  I    G 
Sbjct: 40  SRIKDIADFEGVRDNMLVGYGLVVGLNGTGDSLTNAPFTKESLTGMLERLGVNIRDKTGA 99

Query: 82  LGS---KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           + S   KNVAAVMVTA LPPFA  G+RID +++++GDA  LRGG L++T L+GADG +YA
Sbjct: 100 ITSVSPKNVAAVMVTAVLPPFARQGTRIDTNVSAMGDAKDLRGGTLLVTPLIGADGEVYA 159

Query: 139 VAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           V QG V   G    G S SS  +G+ T G+I NGAIVERELP +      + + LRNPDF
Sbjct: 160 VGQGQVATGGFTASGASGSSVTKGVPTAGRIANGAIVERELPFEMSHLESVKVSLRNPDF 219

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTP 255
           +T+ RIA  +NS+     +RP+    D  TV+++ P     ++  L+++VE L VE D  
Sbjct: 220 TTSRRIAQAVNSFLGGDMARPV----DPGTVQITVPPGYRGNVVGLLTDVEQLRVEPDQM 275

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           ARV+I+E +GTIV+G+NVRIS V ++ G LT++ITE  QV QP+ FS  G+T T   TD+
Sbjct: 276 ARVVIDEVSGTIVMGENVRISTVAIAQGQLTIRITETPQVSQPSPFSDAGTTTTVQRTDI 335

Query: 316 KVSDNKGSFSLIDAPD---LNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +V +  G+  L   P    L  L+ G+NS+G+    +I ILQ IKAAGALQ+E+
Sbjct: 336 QVDEGAGN-KLAVVPHKVTLQELVEGLNSLGIGPRDLIVILQAIKAAGALQAEL 388


>gi|307945671|ref|ZP_07661007.1| flagellar P-ring protein FlgI [Roseibium sp. TrichSKD4]
 gi|307771544|gb|EFO30769.1| flagellar P-ring protein FlgI [Roseibium sp. TrichSKD4]
          Length = 390

 Score =  306 bits (783), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 166/352 (47%), Positives = 235/352 (66%), Gaps = 11/352 (3%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           A   SRIKD+   +  R+NQLIGYGLVVGL GTGD+LR++PFT QS++++L+ LG++T G
Sbjct: 42  AHSASRIKDIADFEGIRENQLIGYGLVVGLNGTGDTLRNAPFTRQSLQAMLERLGVNTRG 101

Query: 80  GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
             L +  VAAVMVTANLPPFA+ G+RIDV++++LG++ SL+GG L++T L+ ADG +YA+
Sbjct: 102 VDLNTNTVAAVMVTANLPPFATQGTRIDVNVSALGNSGSLQGGTLLVTPLVAADGEVYAI 161

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQGSV + G   +  ++S   G+ T G+I NGA+VERE+  K      L L LRNPD +T
Sbjct: 162 AQGSVAIGGFAAQADAASVTRGVPTSGRIANGALVEREVEFKLASLTTLRLALRNPDLTT 221

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPAR 257
           A R+A  IN         P AE  D  TV++  P     ++  L++++E L V+ D  AR
Sbjct: 222 ARRVALSINEL----IGFPTAEPLDPGTVRIDLPREFSGNIVDLLTDIEQLIVQPDMIAR 277

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           V+I+E +G IV+G  V++S V V+ GNLTV I E  +VVQP  F +NG T     ++L V
Sbjct: 278 VVIDENSGIIVMGQEVKVSTVAVAQGNLTVTIAETPEVVQPLPF-ANGETAVVPRSELLV 336

Query: 318 SDNKGSFSLIDAPD---LNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +D+  +  L   PD   L  L+ G+N++G+    +ISILQ IKA+GALQ+EI
Sbjct: 337 NDDPDA-KLAIVPDTVTLKQLVDGLNALGIGPRDMISILQAIKASGALQAEI 387


>gi|163744343|ref|ZP_02151703.1| flagellar P-ring protein precursor I [Oceanibulbus indolifex
           HEL-45]
 gi|161381161|gb|EDQ05570.1| flagellar P-ring protein precursor I [Oceanibulbus indolifex
           HEL-45]
          Length = 366

 Score =  305 bits (781), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 169/346 (48%), Positives = 231/346 (66%), Gaps = 7/346 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST-PGGRLG 83
           RIKD+V+++  R NQL+GYGLVVGL GTGDSLR++PFTE+++  +L+ LGI      ++ 
Sbjct: 25  RIKDIVTVEGVRSNQLVGYGLVVGLNGTGDSLRNAPFTERAIEGMLERLGIGNLTEDQMR 84

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           + N AAVMVTA+LPPFA  GS IDV ++SLGDASSLRGG L++T L  ADG IYAVAQG 
Sbjct: 85  TANTAAVMVTASLPPFARMGSTIDVVVSSLGDASSLRGGTLIVTPLTAADGEIYAVAQGP 144

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + V+G   +G ++S +EG+ TG +I NGAIVERE+   F +   + L LRN DF TA R+
Sbjct: 145 IAVAGFAAQGLNASIVEGVPTGARIDNGAIVEREVDFDFSEMTSIKLALRNADFVTAQRV 204

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
                  ++N+   P+A A DSRT+ VS      L   M+ +E L V+ D  A+V+I+ R
Sbjct: 205 -----EAAINQAMGPVATAIDSRTITVSAYGKGSLMETMALIEPLQVQPDQIAKVVIDAR 259

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           +GTIVIG NVRI +V VS G LTV + ++  V QP + S  G+TV   N+ + V +    
Sbjct: 260 SGTIVIGANVRIDRVAVSQGGLTVTVRDDFNVSQPESLSIGGTTVVVPNSSVGVEEKDAK 319

Query: 324 FSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           F++ID    L  L+ G+N+IG+     ISILQ IKAAGAL +++ I
Sbjct: 320 FAVIDGSVSLQRLVDGLNAIGVGATETISILQAIKAAGALHADLEI 365


>gi|188582479|ref|YP_001925924.1| flagellar basal body P-ring protein [Methylobacterium populi BJ001]
 gi|179345977|gb|ACB81389.1| flagellar P-ring protein [Methylobacterium populi BJ001]
          Length = 376

 Score =  305 bits (781), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 168/346 (48%), Positives = 238/346 (68%), Gaps = 9/346 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KD+ +++  R NQL+GYG+VVGL GTGD+L + PFT+QS++++L+ LGI+T G  + +
Sbjct: 33  RVKDLAAVEGVRTNQLVGYGIVVGLNGTGDTLNNIPFTKQSLQAMLERLGINTRGATMRT 92

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           +N+AAVMVTANLPPFA+ G+ IDV+++SLGDA SL+GG LV TSLLGADG IYA+AQGSV
Sbjct: 93  QNLAAVMVTANLPPFATQGTHIDVTVSSLGDAKSLQGGTLVATSLLGADGEIYALAQGSV 152

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
            ++G   +G+++    G+ T G+I NGA++ERE+  K  ++  L L LRNPDF+TA RIA
Sbjct: 153 AIAGFAAEGEAAKITRGVPTNGRISNGALIEREMAFKLNEARSLRLSLRNPDFTTAKRIA 212

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIINE 262
             IN +         AE  D  T+ +  P     ++ RL++EVE L VE D  ARV+++E
Sbjct: 213 SAINDF----MGADTAEPTDPATITLQIPAKYRGNMIRLITEVEQLKVEPDQTARVVVDE 268

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           R+G IV+G +VR+S V ++ GNLTV ITE   V QP    SNG T     T +KV    G
Sbjct: 269 RSGIIVMGRDVRVSTVAIAQGNLTVTITEQPMVSQPAPL-SNGQTAIVPRTGVKVDTGDG 327

Query: 323 S-FSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +  +L+ +   L  L+ G+N++G+    +ISILQ IK AGALQ++I
Sbjct: 328 NKLALVKEGVSLRELVDGLNALGVGPRDLISILQAIKTAGALQADI 373


>gi|124021069|sp|Q2RQE9|FLGI_RHORT RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 379

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 168/366 (45%), Positives = 240/366 (65%), Gaps = 8/366 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           IA  + ++  L    A+  SRIKD+   +  RDN L+GYGLVVGL+GTGD L    FT++
Sbjct: 15  IAVALTAVFLLAPTGAEAASRIKDLADFEGVRDNILVGYGLVVGLKGTGDKLDDVTFTKE 74

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           S+  +L+ LG++T  G+L   NVAAVMVT  LPPFA  GSRIDV+I++LG A SL GG L
Sbjct: 75  SLIGMLERLGVNTREGKLDPDNVAAVMVTGTLPPFARQGSRIDVTISALGTAKSLAGGTL 134

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           ++T L+GADG +YAVAQG   + G  V+GQS+S  +G+ T G+I NGA+VE E+P     
Sbjct: 135 MVTPLIGADGEVYAVAQGQAQIGGYAVQGQSASVQKGVPTSGRIPNGALVEAEVPFNLSA 194

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLM 242
              + + LRNPDF+TA RIA  IN++     +RP+    D  TV V+     +     L+
Sbjct: 195 MESVKISLRNPDFTTARRIAQAINAFLGTELARPL----DPGTVLVAVTAGYEGNAVALL 250

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +++E L VE DT ARV+I+E TGTIVIG+ VRI+ V ++ GNLT+++TE  QV QP  FS
Sbjct: 251 TDIEQLLVEPDTVARVVIDEATGTIVIGEKVRINTVAIAQGNLTIRVTETPQVSQPAPFS 310

Query: 303 SNGSTVTQNNTDLKVSDNK-GSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAG 360
             G T     T+++V + K    ++++   +L  L++ +N++G+    +ISILQ IK+AG
Sbjct: 311 QGGQTAVVPRTNIQVDEGKDNKLTVVNGGVNLQDLVNSLNALGVGPRDMISILQAIKSAG 370

Query: 361 ALQSEI 366
           A+Q+EI
Sbjct: 371 AMQAEI 376


>gi|83594181|ref|YP_427933.1| flagellar basal body P-ring protein [Rhodospirillum rubrum ATCC
           11170]
 gi|83577095|gb|ABC23646.1| Flagellar P-ring protein [Rhodospirillum rubrum ATCC 11170]
          Length = 383

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 168/366 (45%), Positives = 240/366 (65%), Gaps = 8/366 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           IA  + ++  L    A+  SRIKD+   +  RDN L+GYGLVVGL+GTGD L    FT++
Sbjct: 19  IAVALTAVFLLAPTGAEAASRIKDLADFEGVRDNILVGYGLVVGLKGTGDKLDDVTFTKE 78

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           S+  +L+ LG++T  G+L   NVAAVMVT  LPPFA  GSRIDV+I++LG A SL GG L
Sbjct: 79  SLIGMLERLGVNTREGKLDPDNVAAVMVTGTLPPFARQGSRIDVTISALGTAKSLAGGTL 138

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           ++T L+GADG +YAVAQG   + G  V+GQS+S  +G+ T G+I NGA+VE E+P     
Sbjct: 139 MVTPLIGADGEVYAVAQGQAQIGGYAVQGQSASVQKGVPTSGRIPNGALVEAEVPFNLSA 198

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLM 242
              + + LRNPDF+TA RIA  IN++     +RP+    D  TV V+     +     L+
Sbjct: 199 MESVKISLRNPDFTTARRIAQAINAFLGTELARPL----DPGTVLVAVTAGYEGNAVALL 254

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +++E L VE DT ARV+I+E TGTIVIG+ VRI+ V ++ GNLT+++TE  QV QP  FS
Sbjct: 255 TDIEQLLVEPDTVARVVIDEATGTIVIGEKVRINTVAIAQGNLTIRVTETPQVSQPAPFS 314

Query: 303 SNGSTVTQNNTDLKVSDNK-GSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAG 360
             G T     T+++V + K    ++++   +L  L++ +N++G+    +ISILQ IK+AG
Sbjct: 315 QGGQTAVVPRTNIQVDEGKDNKLTVVNGGVNLQDLVNSLNALGVGPRDMISILQAIKSAG 374

Query: 361 ALQSEI 366
           A+Q+EI
Sbjct: 375 AMQAEI 380


>gi|39936970|ref|NP_949246.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           CGA009]
 gi|192292798|ref|YP_001993403.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           TIE-1]
 gi|81619642|sp|Q6N2Y8|FLGI_RHOPA RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|226701955|sp|B3QIX2|FLGI_RHOPT RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|39650827|emb|CAE29350.1| flagellar P-ring protein FlgI [Rhodopseudomonas palustris CGA009]
 gi|192286547|gb|ACF02928.1| flagellar P-ring protein [Rhodopseudomonas palustris TIE-1]
          Length = 373

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 159/346 (45%), Positives = 237/346 (68%), Gaps = 8/346 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++  G  + 
Sbjct: 30  SRIKDLANIEGIRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNIRGATIR 89

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           + NVAAVMVT NLPPFA+ G+R+DV++++LGDA +L+GG L++T LLGADGN+YAVAQGS
Sbjct: 90  TGNVAAVMVTGNLPPFATQGTRMDVTVSALGDAKNLQGGTLLVTPLLGADGNVYAVAQGS 149

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + + G   +G+++    G+ T G+I NGAI+ERE+        ++ L LRN DF+TA RI
Sbjct: 150 LAIGGFQAEGEAAKITRGVPTVGRIANGAIIEREIEFALNRLPNVRLALRNADFTTAKRI 209

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIIN 261
           A  +N Y         AE  D  TV++S P     +   L++E+E L VE D  A+++I+
Sbjct: 210 AAAVNDY----LGTKCAEPLDPSTVQLSIPGEFKGNAVALLTEIEQLQVEPDQAAKIVID 265

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN     G TV   N+ + V+++ 
Sbjct: 266 ERSGIIVMGRDVRVATVAVAQGNLTVSISESPQVSQPNPLGG-GRTVVTPNSRIGVTEDG 324

Query: 322 GSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              +++ D   L  L+ G+NS+G+    +I ILQ IKAAGA++++I
Sbjct: 325 KKLAVVKDGVSLQQLVDGLNSLGIGPRDLIGILQAIKAAGAIEADI 370


>gi|27380949|ref|NP_772478.1| flagellar basal body P-ring protein [Bradyrhizobium japonicum USDA
           110]
 gi|27354115|dbj|BAC51103.1| flagellar P-ring protein precursor [Bradyrhizobium japonicum USDA
           110]
          Length = 391

 Score =  303 bits (775), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 160/351 (45%), Positives = 242/351 (68%), Gaps = 8/351 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           SA   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++  
Sbjct: 43  SASATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNIR 102

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           G  + + NVAAVMVT NLP FA+ G+R+DV++++LGDA +L+GG L++T LLGADGN+YA
Sbjct: 103 GATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSALGDAKNLQGGTLLVTPLLGADGNVYA 162

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           VAQGS+ +SG   +G+++  + G+ T G+I NGAI+ERE+        ++ L LRN DF+
Sbjct: 163 VAQGSLAISGFQAEGEAAKIVRGVPTVGRIANGAIIEREIEFALNRLPNVRLALRNADFT 222

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPA 256
           TA RIA  +N Y   + + PI    D  TV++S P     ++   ++E+E L V+ D  A
Sbjct: 223 TAKRIAAAVNDYLGVKTAEPI----DPSTVQLSIPPEFKGNVVAFLTEIEQLQVDPDLAA 278

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +++I+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   S G TV    + + 
Sbjct: 279 KIVIDERSGIIVMGRDVRVATVAVAQGNLTVTISESPQVSQPNPL-SRGRTVVAPRSSVS 337

Query: 317 VSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           V+++    +L+ D   L  L+ G+N +G+    +ISILQ IKAAGA++++I
Sbjct: 338 VTEDGRKLALVKDGVSLQQLVDGLNGLGIGPRDMISILQAIKAAGAIEADI 388


>gi|16126820|ref|NP_421384.1| flagellar basal body P-ring protein [Caulobacter crescentus CB15]
 gi|221235601|ref|YP_002518038.1| flagellar basal body P-ring protein [Caulobacter crescentus NA1000]
 gi|462107|sp|P33979|FLGI_CAUCR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|144241|gb|AAB83950.1| flagellin [Caulobacter crescentus CB15]
 gi|13424152|gb|AAK24552.1| flagellar P-ring protein [Caulobacter crescentus CB15]
 gi|220964774|gb|ACL96130.1| flagellar P-ring protein flgI [Caulobacter crescentus NA1000]
          Length = 370

 Score =  302 bits (774), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 164/346 (47%), Positives = 232/346 (67%), Gaps = 9/346 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SRIKD+VS +  R+NQLIGYG+VVGL GTGDSLR++P T+QS+ ++L+  G++     L 
Sbjct: 28  SRIKDIVSFEGVRENQLIGYGIVVGLNGTGDSLRNAPMTKQSLEAMLERQGVNVRDNNLN 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KN AAVMVTANLPPF++ GS++DV++++LGDA SL GG L++TSL GADG  YAVAQG+
Sbjct: 88  TKNTAAVMVTANLPPFSASGSKVDVTVSTLGDAKSLLGGTLLVTSLQGADGQTYAVAQGT 147

Query: 144 VVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           V    +   G S SS  +G+ T G+I  G ++ERE   +  +   + L LRNPDF+TA R
Sbjct: 148 VQTGSVSAGGASGSSVTKGVPTAGRIAGGGVIERETGFQMVNMDIMRLTLRNPDFTTARR 207

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           +AD IN+    +F    A+A +   +    P  +D+   M+ +E L VE D PA+V+I+E
Sbjct: 208 VADAINA----KFPG-CAQAQNPTIIATRPPPGMDMISFMTNIENLMVEPDGPAKVVIDE 262

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
             G IV+GD+VRIS+V ++ GNLT+ + EN  V QP  FS   + V   +T + V + KG
Sbjct: 263 VAGVIVMGDDVRISQVAIAQGNLTITVQENPAVSQPAPFSQGQTAVVPQST-VNVEEEKG 321

Query: 323 S--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
               +L  AP L  LI G+N++G+    +ISILQ +KAAGALQ++I
Sbjct: 322 KQLLTLGGAPSLKGLIGGLNALGVTPRDMISILQAVKAAGALQADI 367


>gi|84028133|sp|Q89I01|FLGI1_BRAJA RecName: Full=Flagellar P-ring protein 1; AltName: Full=Basal body
           P-ring protein 1; Flags: Precursor
          Length = 374

 Score =  302 bits (774), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 160/351 (45%), Positives = 242/351 (68%), Gaps = 8/351 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           SA   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++  
Sbjct: 26  SASATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNIR 85

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           G  + + NVAAVMVT NLP FA+ G+R+DV++++LGDA +L+GG L++T LLGADGN+YA
Sbjct: 86  GATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSALGDAKNLQGGTLLVTPLLGADGNVYA 145

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           VAQGS+ +SG   +G+++  + G+ T G+I NGAI+ERE+        ++ L LRN DF+
Sbjct: 146 VAQGSLAISGFQAEGEAAKIVRGVPTVGRIANGAIIEREIEFALNRLPNVRLALRNADFT 205

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPA 256
           TA RIA  +N Y   + + PI    D  TV++S P     ++   ++E+E L V+ D  A
Sbjct: 206 TAKRIAAAVNDYLGVKTAEPI----DPSTVQLSIPPEFKGNVVAFLTEIEQLQVDPDLAA 261

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +++I+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   S G TV    + + 
Sbjct: 262 KIVIDERSGIIVMGRDVRVATVAVAQGNLTVTISESPQVSQPNPL-SRGRTVVAPRSSVS 320

Query: 317 VSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           V+++    +L+ D   L  L+ G+N +G+    +ISILQ IKAAGA++++I
Sbjct: 321 VTEDGRKLALVKDGVSLQQLVDGLNGLGIGPRDMISILQAIKAAGAIEADI 371


>gi|91976155|ref|YP_568814.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           BisB5]
 gi|123749198|sp|Q13AH6|FLGI_RHOPS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|91682611|gb|ABE38913.1| flagellar P-ring protein [Rhodopseudomonas palustris BisB5]
          Length = 373

 Score =  302 bits (773), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 159/352 (45%), Positives = 241/352 (68%), Gaps = 8/352 (2%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
           ++A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++ 
Sbjct: 24  VAASATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNI 83

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
            G  + + NVAAVMVT NLP FA+ G+R+DV++++LGDA +L+GG L++T LLGADGN+Y
Sbjct: 84  RGATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSALGDAKNLQGGTLLVTPLLGADGNVY 143

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           AVAQGS+ + G   +G+++    G+ T G+I NGAI+ERE+        ++ L LRN DF
Sbjct: 144 AVAQGSLAIGGFQAEGEAAKITRGVPTVGRIANGAIIEREIEFALNRLPNVRLALRNADF 203

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTP 255
           +TA RIA  +N +   + + PI    D  TV++S P     +    ++E+E L VE D  
Sbjct: 204 TTAKRIAAAVNDFLGTKSAEPI----DPSTVQLSIPAEFKGNAVAFLTEIEQLQVEPDQA 259

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A++II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN  S   +TVT  N+ +
Sbjct: 260 AKIIIDERSGIIVMGRDVRVATVAVAQGNLTVSISESPQVSQPNPLSRGRTTVTP-NSRI 318

Query: 316 KVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            V+++    +L+ D   L  L+ G+N +G+    +I ILQ IKAAGA++++I
Sbjct: 319 GVTEDGKKLALVKDGVSLQQLVDGLNGLGIGPRDLIGILQAIKAAGAIEADI 370


>gi|114570502|ref|YP_757182.1| flagellar basal body P-ring protein [Maricaulis maris MCS10]
 gi|114340964|gb|ABI66244.1| flagellar P-ring protein [Maricaulis maris MCS10]
          Length = 371

 Score =  301 bits (772), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 163/353 (46%), Positives = 235/353 (66%), Gaps = 15/353 (4%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SRIKD++ ++  RDN L+GYGLVVGL G+GDSLR++ FT QS+ ++L++  ++T    L 
Sbjct: 21  SRIKDMIDVEDVRDNHLVGYGLVVGLDGSGDSLRNAAFTNQSLNAMLEHFNVNTRDANLN 80

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           ++NVAAVMVTA+LP F+S GSRIDV+++++GDASSL+GG+L+ T L  +    +AVAQGS
Sbjct: 81  TRNVAAVMVTASLPAFSSQGSRIDVTVSAIGDASSLQGGVLIATPLFDSQSRAWAVAQGS 140

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP-------KKFKDSADLILQLRNPD 196
           + V G    G  +S   G+ T G+I NGA+VE            +  + A L L LRNPD
Sbjct: 141 LAVGGFEAAGDGASITRGVPTSGRIANGALVENPFEGSGIDPWAEIANRASLRLSLRNPD 200

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDT 254
           F+TA R+AD IN+Y         A A +  TV + +P++   D+  L+SEVE L VE D 
Sbjct: 201 FTTARRMADAINAY----VGPGSARATNPSTVTLQRPSHFDGDMIDLLSEVEQLRVEADI 256

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
           PAR+II+E TGTIV+G+NVR+S V ++ GNLT+ +TE+    QP  F S G TV    TD
Sbjct: 257 PARIIIDENTGTIVMGENVRVSTVAIAQGNLTITVTESPIASQPAPF-SEGETVVLPRTD 315

Query: 315 LKVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           + V+++     +++    L+ L+ G+N++G+    +I+ILQ IKAAGALQ+EI
Sbjct: 316 VSVTEDNMQLGVLEESVSLSQLVDGLNAMGVTPRDMITILQAIKAAGALQAEI 368


>gi|197105398|ref|YP_002130775.1| flagellar P-ring protein [Phenylobacterium zucineum HLK1]
 gi|196478818|gb|ACG78346.1| flagellar P-ring protein [Phenylobacterium zucineum HLK1]
          Length = 371

 Score =  301 bits (772), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 164/346 (47%), Positives = 233/346 (67%), Gaps = 9/346 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SRIKD+V  +  R+N L+GYG+VVGL GTGD+LR++PFT+QS+ ++L+ LG++T   +L 
Sbjct: 29  SRIKDIVEFEGVRENMLVGYGIVVGLNGTGDALRNAPFTKQSLEAMLERLGVNTRDAQLN 88

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KNVAAVMVTA LPPFA+PGS+IDVS+++LGDA SL+GG L++T LLGADG  YAVAQG+
Sbjct: 89  TKNVAAVMVTAKLPPFAAPGSQIDVSVSALGDAKSLQGGSLLVTPLLGADGRAYAVAQGT 148

Query: 144 V-VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           V   +        SS  +G+ T G+I  GA VE E   +  +   + L LRNPDF+TA R
Sbjct: 149 VQTGAISASGASGSSISKGVPTAGRIAGGASVELETGFQLANMGQMRLTLRNPDFTTARR 208

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           IAD +N+    RF  P +   ++ T+   +P + DL   M++VE L VE D PA+V+I+E
Sbjct: 209 IADAVNA----RF--PGSAVAENPTIVSLRPASGDLISFMAQVENLAVEPDAPAKVVIDE 262

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
             G IV+G+ VR+S V +  GNLT+ + E   V QP  F+  G T     TD++V + +G
Sbjct: 263 VAGVIVMGEAVRVSTVAIQQGNLTITVREQPGVSQPAPFARTGETAVVPQTDIEVDEERG 322

Query: 323 S--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
               ++     L +L+SG+N++G+    +ISILQ I+AAGALQ+EI
Sbjct: 323 RQFLTVGSGASLATLVSGLNALGVTPRDMISILQTIRAAGALQAEI 368


>gi|316932814|ref|YP_004107796.1| flagellar P-ring protein [Rhodopseudomonas palustris DX-1]
 gi|315600528|gb|ADU43063.1| flagellar P-ring protein [Rhodopseudomonas palustris DX-1]
          Length = 373

 Score =  301 bits (771), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 160/352 (45%), Positives = 239/352 (67%), Gaps = 8/352 (2%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
           ++A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++ 
Sbjct: 24  VAAGATSRIKDLANIEGIRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNI 83

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
            G  + + NVAAVMVT NLP FA+ G+R+DV++++LGDA +L+GG L++T LLGADGN+Y
Sbjct: 84  RGATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSALGDAKNLQGGTLLVTPLLGADGNVY 143

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           AVAQGS+ + G   +G+++    G+ T G+I NGAI+ERE+        ++ L LRN DF
Sbjct: 144 AVAQGSLAIGGFQAEGEAAKITRGVPTVGRIANGAIIEREIEFALNRLPNVRLALRNSDF 203

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTP 255
           +TA RIA  +N Y         AE  D  TV++S P     +   L++E+E L VE D  
Sbjct: 204 TTAKRIAAAVNDY----LGIKCAEPLDPSTVQLSIPAEFKGNAVALLTEIEQLQVEPDQV 259

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A++II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN     G TV   N+ +
Sbjct: 260 AKIIIDERSGIIVMGRDVRVATVAVAQGNLTVSISESPQVSQPNPLGG-GRTVVTPNSRI 318

Query: 316 KVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            V+++    +++ D   L  L+ G+NS+G+    +I ILQ IKAAGA++++I
Sbjct: 319 GVTEDGKKLAVVKDGVSLQQLVDGLNSLGIGPRDLIGILQAIKAAGAIEADI 370


>gi|86750903|ref|YP_487399.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           HaA2]
 gi|123098399|sp|Q2ITH2|FLGI_RHOP2 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|86573931|gb|ABD08488.1| Flagellar P-ring protein [Rhodopseudomonas palustris HaA2]
          Length = 373

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 158/352 (44%), Positives = 240/352 (68%), Gaps = 8/352 (2%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
           ++A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++ 
Sbjct: 24  VAANATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNI 83

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
            G  + + NVAAVMVT NLP FA+ G+R+DV++++LGDA +L+GG L++T LLGADGN+Y
Sbjct: 84  RGATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSALGDAKNLQGGTLLVTPLLGADGNVY 143

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           AVAQGS+ + G   +G+++    G+ T G+I NGAI+ERE+         + L LRN DF
Sbjct: 144 AVAQGSLAIGGFQAEGEAAKITRGVPTVGRIANGAIIEREIEFALNRLPMVRLALRNADF 203

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTP 255
           +TA RIA  +N +   + + PI    D  TV+++ P     +    ++E+E L VE D  
Sbjct: 204 TTAKRIAAAVNDFLGTKSAEPI----DPSTVQLTIPAEFKGNAVAFVTEIEQLQVEPDQA 259

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A++II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   +NG TV   N+ +
Sbjct: 260 AKIIIDERSGIIVMGRDVRVATVAVAQGNLTVSISESPQVSQPNPL-ANGRTVVTPNSRI 318

Query: 316 KVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            V+++    +L+ D   L  L+ G+N +G+    +I ILQ IKAAGA++++I
Sbjct: 319 GVTEDGKKLALVKDGVSLQQLVDGLNGLGIGPRDLIGILQAIKAAGAIEADI 370


>gi|90423008|ref|YP_531378.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           BisB18]
 gi|90105022|gb|ABD87059.1| flagellar P-ring protein [Rhodopseudomonas palustris BisB18]
          Length = 378

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 159/349 (45%), Positives = 233/349 (66%), Gaps = 6/349 (1%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++  G
Sbjct: 31  AGATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNIRG 90

Query: 80  GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
             + + NVAAVMVT NLPPF + G+R+DV++++LGD+ +L+GG L++T LLGADGN+YAV
Sbjct: 91  ATIRTGNVAAVMVTGNLPPFGTQGTRMDVTVSALGDSKNLQGGTLLVTPLLGADGNVYAV 150

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQGS+ + G   +G ++    G+ T G+I NGAI+ERE+        +  L LRN DF+T
Sbjct: 151 AQGSLAIGGFQAEGDAAKITRGVPTVGRIANGAIIEREIEFALNRLPNARLALRNGDFTT 210

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPAR 257
           A RIA  IN +   + + PI    D  TV+++ P     ++   ++E+E L VE D  A+
Sbjct: 211 AKRIAAAINDFVGAKCAEPI----DPSTVQLTIPAEFKGNVVAFLTEIEQLQVEPDLAAK 266

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           +II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN  S   +TVT N+     
Sbjct: 267 IIIDERSGIIVMGRDVRVATVAVAQGNLTVTISESPQVSQPNPLSRGRTTVTPNSKIGVT 326

Query: 318 SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            D K    + D   L  L+ G+N +G+    +I ILQ IKAAGA+Q++I
Sbjct: 327 EDGKKLAVVRDGVSLQQLVDGLNGLGIGPRDLIGILQAIKAAGAIQADI 375


>gi|83858813|ref|ZP_00952335.1| Flagellar P-ring protein [Oceanicaulis alexandrii HTCC2633]
 gi|83853636|gb|EAP91488.1| Flagellar P-ring protein [Oceanicaulis alexandrii HTCC2633]
          Length = 367

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 160/358 (44%), Positives = 234/358 (65%), Gaps = 7/358 (1%)

Query: 12  LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
           L  L    A+   RIKD+  ++  RDNQL+GYGLVVGL G+GD+LR++ FT Q++ S+L+
Sbjct: 11  LFCLAAPVAEANPRIKDIADVEGVRDNQLVGYGLVVGLDGSGDTLRNAVFTRQALNSMLE 70

Query: 72  NLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
              I+     L + NVAAV+VTA LPPFA  GSR+DV++++LGDA SL+GG+L+ T L+ 
Sbjct: 71  RFNINVREADLRTGNVAAVIVTAELPPFAMQGSRVDVTVSALGDADSLQGGVLIATPLMA 130

Query: 132 ADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQ 191
           A+G++YAVAQGS+ V G   +G  +S   G+ T G+I NG ++EREL       A + L 
Sbjct: 131 ANGDVYAVAQGSLAVGGFSAEGDGASITRGVPTNGRIANGGVIERELEWDLAGQAQIRLA 190

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLT 249
           LRNPDF+TA R+A  IN+Y         A A +  TV +++P     D+  L++EVE L 
Sbjct: 191 LRNPDFTTARRMAQTINAY----LGADAAAAQNPSTVALTRPLYFDGDMVALLAEVEQLR 246

Query: 250 VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
           VETD  ARV+I+E TGTIV+G++VR+S V ++ G LT+ +TE+ +V Q   F+  G T+ 
Sbjct: 247 VETDMRARVVIDESTGTIVMGEDVRVSTVAIAQGGLTITVTESPEVSQALPFADGGQTIE 306

Query: 310 QNNTDLKVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              T++   +    F +++    L  L+ G+N++G+    +I+ILQ IKAAGALQ+EI
Sbjct: 307 VPRTNVTAEEELREFGVLNGTVSLRELVDGLNALGVSPRDMITILQSIKAAGALQAEI 364


>gi|288958681|ref|YP_003449022.1| flagellar P-ring protein precursor [Azospirillum sp. B510]
 gi|288910989|dbj|BAI72478.1| flagellar P-ring protein precursor [Azospirillum sp. B510]
          Length = 380

 Score =  299 bits (765), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 166/347 (47%), Positives = 237/347 (68%), Gaps = 11/347 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+V ++  RDN LIGYGLVVGL GTGDSL +SPFTEQS+  +L+ +G++T G  L +
Sbjct: 37  RIKDIVDVEGVRDNMLIGYGLVVGLNGTGDSLNNSPFTEQSLTGMLERMGVNTRGTNLRT 96

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAVMVTA L  +A+ G+RIDV+++++GD+ SL GG L++T ++GADG +YAVAQG +
Sbjct: 97  KNVAAVMVTATLNAYAAQGTRIDVTVSAMGDSKSLLGGTLLVTPMMGADGEVYAVAQGPI 156

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
            VSG   +GQ +S   G+ T G+I +GAIVERE+     +   L L LRNPDF+TA R+A
Sbjct: 157 AVSGFTAQGQGASVTRGVPTSGRISSGAIVEREIQFSLAELPVLRLSLRNPDFTTAQRVA 216

Query: 205 DQIN-SYSLNRFSRPIAEAYDSRTVKVSKPT--NIDLTRLMSEVEMLTVETDTPARVIIN 261
             IN     NR     A+A D  +V ++ P     D+  L++E+E L +  D  ARV+++
Sbjct: 217 TAINIQLRGNR-----AQATDPASVLINVPEARRGDVVGLVTEIEQLRITPDQVARVVVD 271

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           E++G IV+G+NVRIS V ++ GNLT++ITE  QV QP  F S G T     TD++V D  
Sbjct: 272 EKSGVIVMGENVRISTVAIAQGNLTIRITETPQVSQPGPF-SQGQTAVVPRTDIQVDDQS 330

Query: 322 GS-FSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            +  +++++   L  L+  +N++G+    +I+ILQ IKAAGALQ+EI
Sbjct: 331 NNRLAVMNSGVTLQELVQSLNALGVGPRDMIAILQSIKAAGALQAEI 377


>gi|92116899|ref|YP_576628.1| flagellar basal body P-ring protein [Nitrobacter hamburgensis X14]
 gi|123265353|sp|Q1QNM9|FLGI_NITHX RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|91799793|gb|ABE62168.1| flagellar P-ring protein [Nitrobacter hamburgensis X14]
          Length = 374

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 162/350 (46%), Positives = 240/350 (68%), Gaps = 8/350 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++  G
Sbjct: 27  AHATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNIRG 86

Query: 80  GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
             + + NVAAVMVT NLP FA+ G+R+DV+++++GDA SL GG L++T LLGADGN+YAV
Sbjct: 87  ATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSAMGDAKSLHGGTLLVTPLLGADGNVYAV 146

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQGS+ + G   +G ++S  +G+ T G+I NGAIVERE+        ++ L LRN DF+T
Sbjct: 147 AQGSLAIGGFAAEGAAASVTKGVPTNGRIANGAIVEREIEFALNKMPNVRLALRNGDFTT 206

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPAR 257
           A RIA  +N +   + + PI    D  TV++S P     ++  L++E+E L VE DT A+
Sbjct: 207 AKRIAAAVNDFLGTKTAEPI----DPSTVQLSIPAEFKGNVVALLTEIEQLQVEPDTAAK 262

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           +II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   S G TV    T + V
Sbjct: 263 IIIDERSGIIVMGRDVRVATVAVAQGNLTVSISESPQVSQPNPL-SRGRTVVTPRTAVGV 321

Query: 318 SDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +++    +L+ +   L  L+ G+N +G+    +I ILQ IKAAGA++++I
Sbjct: 322 TEDGKKLALVKNGVSLQELVDGLNGLGIGPRDLIGILQAIKAAGAIEADI 371


>gi|302383712|ref|YP_003819535.1| flagellar P-ring protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302194340|gb|ADL01912.1| flagellar P-ring protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 368

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 169/351 (48%), Positives = 230/351 (65%), Gaps = 9/351 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           +A   SRIKD+ S++  R NQL+GYGLVVGL GTGDSLR+ PFT QS+  + + LG++  
Sbjct: 21  TASAQSRIKDIASIEGVRTNQLVGYGLVVGLAGTGDSLRNCPFTRQSLEGMTERLGVNIR 80

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           G    SKN+AA+MVTA+LPPFA+PG+R+DVS++SL DA SL GG L++TSL GADGN+YA
Sbjct: 81  GSNANSKNLAAIMVTADLPPFATPGARVDVSVSSLCDAKSLLGGTLLVTSLQGADGNVYA 140

Query: 139 VAQGSV-VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           VAQGSV   S        SS   G+ T G+I +GA VERE         ++ L LRNPDF
Sbjct: 141 VAQGSVQTGSVSGSGSSGSSVTRGVPTAGRIASGATVERETGFNLDSLQEVRLTLRNPDF 200

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPAR 257
           +TA R+A  IN+   +      A A +   + +  P  + +   +S VE + V  DTPAR
Sbjct: 201 TTAQRVAAAINATYPS-----TALAENGSVITLRAPAQLGMAAFISRVENMPVAVDTPAR 255

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           VII+E  G IV+G+NVRIS V ++ GNLT+ + E  QV QP  FS   +TV    +D+ V
Sbjct: 256 VIIDEVNGVIVMGENVRISTVAIAQGNLTISVQETPQVSQPAPFSQGQTTVVP-QSDVTV 314

Query: 318 SDNKG-SFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            +  G    L++ A  L++L++G+N++G+    +ISILQ IKAAGALQ+EI
Sbjct: 315 EEELGREIRLVNGATSLSTLVNGLNALGVSPRDMISILQAIKAAGALQAEI 365


>gi|84502372|ref|ZP_01000508.1| flagellar P-ring protein FlgI [Oceanicola batsensis HTCC2597]
 gi|84389184|gb|EAQ01981.1| flagellar P-ring protein FlgI [Oceanicola batsensis HTCC2597]
          Length = 358

 Score =  295 bits (756), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 163/352 (46%), Positives = 231/352 (65%), Gaps = 6/352 (1%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST- 77
           +AQ   RIKD+ S +  R+NQL+GYGLVVGL GTGD+LR+SPFTE+S+  +L+ LG+   
Sbjct: 10  AAQADVRIKDIASFEGVRENQLVGYGLVVGLNGTGDTLRNSPFTEKSIEGMLERLGVGNL 69

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
              ++ ++N AAVMVT+ LPPFA  GS IDV ++SLGDASSLRGG L++T L GADG +Y
Sbjct: 70  SDDQMRTQNTAAVMVTSMLPPFARRGSTIDVVVSSLGDASSLRGGTLIVTPLSGADGEVY 129

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           AVAQG + V+G   +G ++S +EG+ T  +I NGA VE E+  +        + LR PD 
Sbjct: 130 AVAQGPIAVAGYAAQGANASIVEGVPTVARIENGATVENEIDFRLASLRSFRIALRTPDM 189

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPAR 257
           +TA R+AD+IN           A+  DS T++V      D   +M+ VE L V+ D+ A+
Sbjct: 190 TTAHRVADKIN----QSLGPGTAQVLDSTTIEVVGNDKGDTPEMMAAVENLMVQPDSVAK 245

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           V+I+ R+GTIVIG NVR+ KV VS G LTV I E+ +V QP   +  G+TV    T+++V
Sbjct: 246 VVIDARSGTIVIGANVRVDKVAVSQGGLTVVIREDIEVSQPEPITIGGTTVVVPQTEVEV 305

Query: 318 SDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + +  F++++    L  L+ G+N+IG+     ISILQ IKAAGAL +++ I
Sbjct: 306 QEAEAHFTILEGDVSLQRLVDGLNAIGVTASQTISILQAIKAAGALHADLEI 357


>gi|115523550|ref|YP_780461.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           BisA53]
 gi|115517497|gb|ABJ05481.1| flagellar P-ring protein [Rhodopseudomonas palustris BisA53]
          Length = 378

 Score =  295 bits (754), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 157/350 (44%), Positives = 235/350 (67%), Gaps = 8/350 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++  G
Sbjct: 31  AGATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNIRG 90

Query: 80  GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
             + + NVAAVMVT NLP F + G+R+DV++++LGD+ +L+GG L++T LLGADGN+YAV
Sbjct: 91  ATIRTGNVAAVMVTGNLPAFGTQGTRMDVTVSALGDSKNLQGGTLLVTPLLGADGNVYAV 150

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQGS+ + G   +G ++    G+ T G+I NGAI+ERE+        +  L LRN DF+T
Sbjct: 151 AQGSLAIGGFQAEGDAAKITRGVPTVGRIANGAIIEREIEFAMNRLPNARLALRNADFTT 210

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPAR 257
           A RIA  IN +   + + PI    D  TV+++ P     ++   ++E+E L VE D  A+
Sbjct: 211 AKRIAAAINDFLGTKSAEPI----DPSTVQLTIPPEFKGNVVAFLTEIEQLQVEPDLAAK 266

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           +II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   S G T    N+ + V
Sbjct: 267 IIIDERSGIIVMGRDVRVATVAVAQGNLTVTISESPQVSQPNPL-SRGRTAVTPNSQIGV 325

Query: 318 SDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +++    +L+ A   L  L+ G+N +G+    +I ILQ IKAAGA+Q++I
Sbjct: 326 TEDGKKLALVKAGVSLQQLVDGLNGLGIGPRDLIGILQAIKAAGAIQADI 375


>gi|119385426|ref|YP_916482.1| flagellar basal body P-ring protein [Paracoccus denitrificans
           PD1222]
 gi|119375193|gb|ABL70786.1| flagellar P-ring protein [Paracoccus denitrificans PD1222]
          Length = 366

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 235/370 (63%), Gaps = 9/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R   LI  L  L         RIKD+ ++   R N L+GYGLVVGL G+GDSLR+SPFT
Sbjct: 1   MRFLCLILILFSLASPGLTAPVRIKDLANIDGVRGNDLVGYGLVVGLNGSGDSLRNSPFT 60

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           E+ M  LL+ LG++        KNVAAV+VTA LPPFA  GS+IDVS+ ++GDA SL GG
Sbjct: 61  EEIMAGLLERLGVNVTDEAFRPKNVAAVIVTATLPPFARSGSQIDVSVAAIGDAKSLLGG 120

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            LVMT L  ADG IYAVAQGSV+  G    G+++S ++G+ T G I +GA +ERE+   F
Sbjct: 121 TLVMTPLNAADGEIYAVAQGSVLAGGAEASGKAASVVQGVPTTGAIPSGARIEREVAFDF 180

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT--NIDLTR 240
               +L L LRNPDF+TA R+   IN     +  R +AE  DS T+ +       ++  R
Sbjct: 181 SQMTNLRLALRNPDFTTAARVEAAIN----RKLGRGLAELVDSGTIVIDSTVLGRVNPAR 236

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           LM ++E +TVE +  ARV+I+ ++GTIV+G++VRIS+V VS GNLT+++ E   V QPN 
Sbjct: 237 LMGQIENITVEPEMAARVVIDHKSGTIVMGEDVRISRVAVSQGNLTLRVRETPVVSQPNP 296

Query: 301 FSSNGSTVTQNNTDLKVSDNKG-SFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKA 358
           F+  G TVT   T  +++   G  F+ I     L+ +++G+N++G++   +I IL+ + A
Sbjct: 297 FAP-GETVTLPRTQAEITQEPGIGFAEITGESSLSDVVAGLNALGIRPRDMIDILKAVHA 355

Query: 359 AGALQSEIII 368
           AGAL +E I+
Sbjct: 356 AGALHAEFIV 365


>gi|85715045|ref|ZP_01046030.1| flagellar P-ring protein precursor [Nitrobacter sp. Nb-311A]
 gi|85698242|gb|EAQ36114.1| flagellar P-ring protein precursor [Nitrobacter sp. Nb-311A]
          Length = 374

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 162/365 (44%), Positives = 248/365 (67%), Gaps = 11/365 (3%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           IA +  + +G     A   SRIKD+ +++  R NQLIGYGLVVGL G+GD+L + PFT+Q
Sbjct: 15  IALMALASLG---TPAHATSRIKDLANIEGVRQNQLIGYGLVVGLNGSGDTLNNIPFTKQ 71

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           S++++L+ +G++  G  + + NVAAVMVT NLP FA+ G+R+DV+++++GDA SL+GG L
Sbjct: 72  SLQAMLERMGVNIRGATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSAMGDAKSLQGGTL 131

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           ++T LLGADGN+YAVAQGS+ + G   +G ++S  +G+ T G+I NGAIVERE+      
Sbjct: 132 LVTPLLGADGNVYAVAQGSLAIGGFAAEGAAASVTKGVPTNGRIANGAIVEREIEFALNR 191

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLM 242
             ++ L LRN DF+TA RIA  +N +   + + PI    D  TV++S P     ++  L+
Sbjct: 192 MPNVRLALRNGDFTTAKRIAAAVNDFLGTKTAEPI----DPSTVQLSIPGEYKGNVVALL 247

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +E+E L VE D  A+++I+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   
Sbjct: 248 TEIEQLQVEPDIAAKIVIDERSGVIVMGRDVRVATVAVAQGNLTVSISESPQVSQPNPL- 306

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           + G TV    TD+ V+++    +L+ +   L  L+ G+N +G+    +I+ILQ IKAAGA
Sbjct: 307 ARGRTVVTPRTDVGVTEDGRKLALVKNGVSLQELVDGLNGLGIGPRDLIAILQAIKAAGA 366

Query: 362 LQSEI 366
           ++++I
Sbjct: 367 IEADI 371


>gi|295688539|ref|YP_003592232.1| flagellar P-ring protein [Caulobacter segnis ATCC 21756]
 gi|295430442|gb|ADG09614.1| flagellar P-ring protein [Caulobacter segnis ATCC 21756]
          Length = 374

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 159/346 (45%), Positives = 231/346 (66%), Gaps = 9/346 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SRIKD+V+ +  R+NQL+GYG+VVGL G+GDSLR++P T+QS+ ++L+  G++     L 
Sbjct: 32  SRIKDIVAFEGVRENQLVGYGVVVGLNGSGDSLRNAPMTKQSLEAMLERQGVNVRDATLN 91

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KN A VMVTA+LPPF++ GS++DV++++LGDA SL GG L++TSL GADG  YAVAQG+
Sbjct: 92  TKNTATVMVTASLPPFSAAGSKLDVTVSALGDAKSLLGGTLLVTSLQGADGQTYAVAQGT 151

Query: 144 VVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           V    +   G S SS  +G+ T G+I +G I+ERE   +  +   L + LRNPDF+TA R
Sbjct: 152 VQTGSVSAGGASGSSVTKGVPTAGRIASGGIIERETGFQMVNMDILRMTLRNPDFTTARR 211

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           IAD +N    N      A+A +   V V  P  +D+   ++ +E L VE D PA+V+I+E
Sbjct: 212 IADAVNKKFPN-----CAQAQNPTIVAVRAPPGMDMISFVTNIENLEVEPDFPAKVVIDE 266

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
             G IV+GD+VRIS+V ++ GNLT+ + E+  V QP  F S G T     + + V + KG
Sbjct: 267 VAGVIVMGDDVRISQVAIAQGNLTITVQESPAVSQPAPF-SQGQTAVVPQSAVSVEEEKG 325

Query: 323 S--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
               +L  +P L SL+ G+N++G+    +ISILQ +KAAGALQ++I
Sbjct: 326 KKLITLGGSPSLKSLVGGLNALGVTPRDMISILQAVKAAGALQADI 371


>gi|78221655|ref|YP_383402.1| flagellar basal body P-ring protein [Geobacter metallireducens
           GS-15]
 gi|115311522|sp|Q39YJ7|FLGI_GEOMG RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|78192910|gb|ABB30677.1| Flagellar P-ring protein [Geobacter metallireducens GS-15]
          Length = 365

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 167/369 (45%), Positives = 236/369 (63%), Gaps = 10/369 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           MI RI  ++F L+ L +++  V  RIKD+ S    R+NQLIGYGLVVGL GTGDS +++ 
Sbjct: 1   MIKRIISIVFLLLTLPQLALAV--RIKDIASFDGVRENQLIGYGLVVGLNGTGDSDQTN- 57

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           F  QS+ ++L+ +G++     +  KNVAAVMVTANLPPFA  G+RID  ++S+GDA S+ 
Sbjct: 58  FPVQSLANVLERMGVTVNRNDITVKNVAAVMVTANLPPFAKQGTRIDTLVSSMGDAKSIA 117

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L GADG +YAVAQG V+ +     GQ++S  +   T G++ NG +VE ELP 
Sbjct: 118 GGTLLMTPLKGADGRVYAVAQGGVLTNSFSYGGQAASAQKNHPTAGRVPNGGLVELELPN 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--L 238
              D   L L L  PDF+TA RIA  +N     RF   +A A D   V ++ P      +
Sbjct: 178 VLSDRGQLRLNLHQPDFTTATRIAQAVNE----RFKGGVAAATDPGAVMMNLPEAYKGRV 233

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
              ++++E L V  D  A+V++NERTGTIVIGDNVRIS V VS+GNLT+ I E  +V QP
Sbjct: 234 VEFVADMERLEVRPDAMAKVVLNERTGTIVIGDNVRISTVAVSHGNLTLYIKETPKVSQP 293

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIK 357
             FS  G TV    T++KV++  G  +++ +   +  ++  +N++G+    +I ILQ IK
Sbjct: 294 APFSKTGETVVVPRTEIKVNEGGGGLAVVKEGASIGEVVRALNALGVTPRDLIGILQAIK 353

Query: 358 AAGALQSEI 366
           AAGA+Q+E+
Sbjct: 354 AAGAMQAEV 362


>gi|320354345|ref|YP_004195684.1| flagellar P-ring protein [Desulfobulbus propionicus DSM 2032]
 gi|320122847|gb|ADW18393.1| flagellar P-ring protein [Desulfobulbus propionicus DSM 2032]
          Length = 372

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 161/373 (43%), Positives = 239/373 (64%), Gaps = 12/373 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQV-VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           I+R+   +  L+ +  I+A    +RIKD+  ++  RDNQL+GYGLV+GL GTGD ++ S 
Sbjct: 5   IYRLGLSV--LLTVFCIAADASATRIKDLADIEGVRDNQLMGYGLVIGLNGTGDDIKKSV 62

Query: 61  FTEQSMRSLLQNLGISTPGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           FT+Q+M ++++ +G++ P     ++ + NVAAVMVTA LPPFA PGS ID+ ++S+GDAS
Sbjct: 63  FTKQAMINMIKRMGMAIPEDVFKQMKTDNVAAVMVTAQLPPFARPGSAIDIQVSSIGDAS 122

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SL GG L+MT L G DGN YAVAQG + V G+   G+++   +   T G +  GAIVER 
Sbjct: 123 SLSGGTLLMTPLKGPDGNTYAVAQGPLAVGGIAFGGKAAKAQKNFPTSGHLTGGAIVERA 182

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI- 236
           +      S DL+ QLR+ DF+TA R+A+ IN++    F    A+  DSRTVKV+KP+ + 
Sbjct: 183 VNYALPPSGDLLYQLRDTDFTTASRMAEAINAH----FGSGTAKPMDSRTVKVTKPSRVK 238

Query: 237 -DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
            D+   +S++E + +E D PA++++NERTGTIV+G +VRIS V VS+GNL + I+E  +V
Sbjct: 239 GDVVSFISDLESIEIEPDRPAKIVVNERTGTIVMGQDVRISTVAVSHGNLNLVISEATEV 298

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
            QPN  ++  +      T     +      L    +L  +   +N+IG     +I+I Q 
Sbjct: 299 SQPNPLAAGTTVAAPATTITATEEAGNLVVLPMGVNLGEIARALNAIGATPRDLIAIFQA 358

Query: 356 IKAAGALQSEIII 368
           IKAAGALQ E++I
Sbjct: 359 IKAAGALQGELVI 371


>gi|144899355|emb|CAM76219.1| Flagellar P-ring protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 419

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 165/359 (45%), Positives = 237/359 (66%), Gaps = 21/359 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLG--ISTPGGR 81
           SRIKD+   +  RDN L+GYGLVVGL GTGD L ++PFT++S+ ++L+ LG  I   GG 
Sbjct: 63  SRIKDIADYEGVRDNLLVGYGLVVGLAGTGDDLTNAPFTKESLVAMLERLGVNIREQGGT 122

Query: 82  LGS---KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           + +   KNVAAVMVTA LP F+  G+R+DVS+ ++GDA SL GG L++T L+GADG IYA
Sbjct: 123 IATVKPKNVAAVMVTATLPAFSRQGTRLDVSVAAMGDAKSLEGGTLLVTPLVGADGEIYA 182

Query: 139 VAQGSVVVSGLFVKGQSSS------FMEGISTGGKIVNGAIVERELPKKFKDSADLILQL 192
           VAQG +   G    G  +         +GI T GKI NGAI+ERELP +      + L L
Sbjct: 183 VAQGGLAGVGFTASGGGAGGGGTTSVRKGIPTTGKIANGAIIERELPFEMAHLESVKLSL 242

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTV 250
           RNPDF+TA R A  +N++  +  +RP     D  TV++  P +   ++  L++++E L V
Sbjct: 243 RNPDFTTANRTAQAVNAFLGSTVARP----TDPSTVQIVVPPDYRGNVVGLLTDIEQLKV 298

Query: 251 ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
           E D  A+++I++ TGTIV+G+NVRIS V V+ G LTV+ITE  QV QP+ FS+ G+T   
Sbjct: 299 EPDQVAKIVIDDATGTIVMGENVRISTVAVAQGQLTVRITETPQVSQPSPFSTTGTTTVV 358

Query: 311 NNTDLKVSDNKGSFSLIDAPD---LNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           + TD++V + +G   L+  P    L  L++G+N++G+    +I+ILQ IKAAGA+Q++I
Sbjct: 359 DRTDIEVDEGQGK-KLMVVPHGVTLQDLVTGLNALGISPRDLIAILQTIKAAGAIQADI 416


>gi|39998138|ref|NP_954089.1| flagellar basal body P-ring protein [Geobacter sulfurreducens PCA]
 gi|62286841|sp|Q748F5|FLGI_GEOSL RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|39985084|gb|AAR36439.1| flagellar P-ring protein FlgI [Geobacter sulfurreducens PCA]
 gi|298507075|gb|ADI85798.1| flagellar P-ring protein FlgI [Geobacter sulfurreducens KN400]
          Length = 368

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 159/345 (46%), Positives = 222/345 (64%), Gaps = 8/345 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+ S    RDNQLIGYGL+VGL GTGDS ++  F  QS+ ++L+ +GI+     +  
Sbjct: 26  RIKDIASFDGVRDNQLIGYGLIVGLNGTGDSDQTK-FPVQSLANVLERMGITVNRDDIKV 84

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAVMVTA LPPF+  G+R+DV ++SLGDA SL GG L+MT L GADG +YAVAQG +
Sbjct: 85  KNVAAVMVTAELPPFSKQGTRVDVLVSSLGDAKSLAGGTLLMTPLKGADGQVYAVAQGGL 144

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           + +     GQ+++  +   T G+I NGA+VERELP    D + L L L  PDF+TA RIA
Sbjct: 145 LTNSFSYGGQAATAQKNHPTAGRIPNGALVERELPNVLADRSQLRLNLHQPDFTTATRIA 204

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTPARVIINE 262
             +N     +F   +A   D  +V +S P      +   ++++E L V  D PA+V++NE
Sbjct: 205 RAVNE----QFKAGVASCNDPGSVVISLPDAYQGRVVEFVADMERLEVRPDNPAKVVLNE 260

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGTIVIG+NVRI  V VS+GNLT+ I E  +V QP   S  G TV    T +KVS+  G
Sbjct: 261 RTGTIVIGENVRIDTVAVSHGNLTLLIKETPRVSQPQPLSRTGETVVVPRTGIKVSEESG 320

Query: 323 SFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
             +++ +   +  ++  +N++G+    +I ILQ IKAAGA+Q+E+
Sbjct: 321 GLAVLREGASIGDVVRALNALGVTPRDLIGILQAIKAAGAMQAEL 365


>gi|255261799|ref|ZP_05341141.1| flagellar P-ring protein FlgI [Thalassiobium sp. R2A62]
 gi|255104134|gb|EET46808.1| flagellar P-ring protein FlgI [Thalassiobium sp. R2A62]
          Length = 369

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 163/353 (46%), Positives = 233/353 (66%), Gaps = 17/353 (4%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KD+V     R N L+GYGLVVGL G+GD LR+SPFTE+ + S+L+ LG++  G +   
Sbjct: 26  RLKDLVEFDGVRGNDLVGYGLVVGLNGSGDGLRNSPFTEEILSSILERLGVNVAGEQFRP 85

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAV+VTA LPPFA  G  IDV+++++GDA SLRGG LVMT L  ADG IYAVAQG +
Sbjct: 86  KNVAAVLVTATLPPFARAGGTIDVTVSAIGDAKSLRGGTLVMTPLNAADGEIYAVAQGPM 145

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +  G  V+G+++   +G+ T G I +GA VERE+  +  +   + L LR PDF+TA RI 
Sbjct: 146 IAGGAVVEGEAARVTQGVPTAGVIPSGARVEREILFELDELEIVRLALRTPDFTTAGRIE 205

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL------MSEVEMLTVETDTPARV 258
             IN      F R +A+  DS TV++    NI  TR+      +S VE + VE +  ARV
Sbjct: 206 TAIN----QSFGRSVAQMTDSGTVEL----NIASTRMRSTAHALSRVENILVEPERRARV 257

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           +I++R+GTIV+GD+VRIS V VS G LT+++ E  Q VQPN F+  G TV    T++ + 
Sbjct: 258 VIDQRSGTIVLGDDVRISSVAVSQGGLTLRVQELPQAVQPNPFAP-GETVVVPKTNVAIE 316

Query: 319 DNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +N+G+    + +   L+ +I G+N++G+  + +I IL+ IK+AGAL +E I+Q
Sbjct: 317 ENQGAGLAQVNEGTSLSEVIQGLNALGVAPNDMIDILKSIKSAGALHAEFIVQ 369


>gi|310816849|ref|YP_003964813.1| flagellar P-ring protein [Ketogulonicigenium vulgare Y25]
 gi|308755584|gb|ADO43513.1| flagellar P-ring protein [Ketogulonicigenium vulgare Y25]
          Length = 369

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 160/350 (45%), Positives = 230/350 (65%), Gaps = 10/350 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +R+KD+V     R N L+GYGLVVGL GTGD +R++PFTE+ M ++L+ LG++  G +  
Sbjct: 24  TRLKDLVEFDGVRGNDLVGYGLVVGLNGTGDGIRNAPFTEEIMANVLERLGVNITGEQFR 83

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            +NVAAVMVTA LPPFA  GS +DV+++++GDASSL GG LVMT L  ADG IYAVAQG+
Sbjct: 84  PRNVAAVMVTARLPPFARAGSPMDVTVSAIGDASSLLGGTLVMTPLNAADGEIYAVAQGT 143

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++  G   + Q++   +G+ T G I  GA +ERE+   F+  +++ L LR PDF+TA RI
Sbjct: 144 IIAGGFSAEAQAARVTQGVPTAGVIPAGATIEREVDFDFRTLSNVRLALRTPDFTTAARI 203

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVS--KPTNIDLTRLMSEVEMLTVETDTPARVIIN 261
              +N      F R +A   D+ TV VS  +         MS++E + VE +  ARV+++
Sbjct: 204 ETAVNQT----FGRAVAVMQDAGTVIVSIAQTQASSPAHAMSQIENILVEPEIRARVVVD 259

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT--QNNTDLKVSD 319
           +R+GTIVIG++VRIS+V VS G LTV++ E+  VVQPN F SNG TV   Q+   L V  
Sbjct: 260 QRSGTIVIGEDVRISRVAVSQGRLTVRVEESPMVVQPNPF-SNGETVVVPQSTAALSVDP 318

Query: 320 NKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             G  + ++    L+ L++GMN++G+    +I IL+ I+AAGAL +E I+
Sbjct: 319 GTGGMAEVNTGTSLSELVAGMNALGVAPHDMIDILKSIRAAGALHAEFIV 368


>gi|77464884|ref|YP_354388.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides 2.4.1]
 gi|124021067|sp|Q3IY97|FLGI2_RHOS4 RecName: Full=Flagellar P-ring protein 2; AltName: Full=Basal body
           P-ring protein 2; Flags: Precursor
 gi|77389302|gb|ABA80487.1| putative flagellar P-ring protein [Rhodobacter sphaeroides 2.4.1]
          Length = 363

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 164/372 (44%), Positives = 239/372 (64%), Gaps = 12/372 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ R+  L+  L G   ++ ++  RIKD+V     R N L+GYGLVVGL GTGD LR++P
Sbjct: 1   MLIRLLLLVICLAG-PGVAEEI--RIKDLVRFDGVRGNDLLGYGLVVGLNGTGDGLRNAP 57

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTE  M +LL+ LG++  G +   KNVAAV VTA LPPFA  G++IDV+++++GDA SL 
Sbjct: 58  FTEDIMSNLLERLGVNVTGEQYRPKNVAAVFVTATLPPFARAGAQIDVTVSAMGDAKSLL 117

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG LVMT L GADG IYAVAQG+++  G+  +GQ++  ++G+ T G I  GA VERE+  
Sbjct: 118 GGTLVMTPLNGADGQIYAVAQGTIIAGGVSAEGQAARVVQGVPTAGTIPEGARVEREVEF 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           +F     + L LR+PDF+TA RI D+IN        R +A   D+ TV +         R
Sbjct: 178 EFARLDRVRLALRSPDFTTAGRIEDRIN----RELGRGVATMLDAGTVSLDLGRLGPPAR 233

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           +M  +E L V  +T ARV++++R+GTIV+G++VRIS+V V+ G LT+++ E   VVQPN 
Sbjct: 234 VMGRIENLEVVPETVARVVVDQRSGTIVMGEDVRISRVAVAQGGLTLRVEEQPMVVQPNP 293

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAP---DLNSLISGMNSIGLKTDGIISILQGIK 357
           F S G TV    T   +    G+  L + P    L+ +++G+N++G+  + +I IL+ I 
Sbjct: 294 F-SRGETVVVPRTTASIQQRPGT-GLAEIPAETSLSRVVAGLNALGVAPNDMIDILKSIH 351

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E I++
Sbjct: 352 AAGALHAEFIVR 363


>gi|298529923|ref|ZP_07017325.1| flagellar P-ring protein [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509297|gb|EFI33201.1| flagellar P-ring protein [Desulfonatronospira thiodismutans ASO3-1]
          Length = 370

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 154/350 (44%), Positives = 231/350 (66%), Gaps = 9/350 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           SAQ V R+KDV +    R+NQL+GYGLVVGL G+GDS ++SPFT +SM ++L+ +G+S  
Sbjct: 25  SAQAV-RLKDVATFSGVRENQLVGYGLVVGLDGSGDS-QASPFTLRSMSNMLEGMGVSVN 82

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
              L   NVAAVMVTAN+P  A PGS++DV+++S+GDA SL GG+L+ T L G DGN YA
Sbjct: 83  PADLQPDNVAAVMVTANMPSSARPGSKMDVTVSSMGDADSLMGGVLIQTPLSGIDGNTYA 142

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           +AQG + V G  V+G ++    G+ TG +I  GA VERE+P +F    D+++ L   DFS
Sbjct: 143 LAQGQLTVGGYSVEGDAAEITTGVPTGARIPGGATVEREVPYRFNTQDDIVVNLNMQDFS 202

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPA 256
           T  ++ + IN +    F + +A A D+ T++V  P     +L   M+ +E L V  D+PA
Sbjct: 203 TTSQVTESINEH----FGQNLAHAKDNSTIRVDIPDGFQGNLVPFMAALENLQVSPDSPA 258

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV+++E+TGT+VIG+NVR+SKV VS+G+LTV + E   V  P  F ++   V    T++ 
Sbjct: 259 RVVVDEKTGTVVIGENVRLSKVAVSHGSLTVMVREMPDVFMPLPF-TDAPPVIAPETEID 317

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           + + +   ++I+   +N L+ G+N+IG     +ISIL+ +KA+GAL +E+
Sbjct: 318 IVEEEQHLTIIEGATINELVEGLNAIGATPRDLISILRTLKASGALHAEL 367


>gi|126463726|ref|YP_001044840.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|332559783|ref|ZP_08414105.1| FlgI2 [Rhodobacter sphaeroides WS8N]
 gi|126105390|gb|ABN78068.1| flagellar P-ring protein [Rhodobacter sphaeroides ATCC 17029]
 gi|332277495|gb|EGJ22810.1| FlgI2 [Rhodobacter sphaeroides WS8N]
          Length = 363

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 164/372 (44%), Positives = 239/372 (64%), Gaps = 12/372 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ R+  L+  L G   ++ ++  RIKD+V     R N L+GYGLVVGL GTGD LR++P
Sbjct: 1   MLIRLLLLVICLAG-PGVAEEI--RIKDLVRFDGVRGNDLLGYGLVVGLNGTGDGLRNAP 57

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTE  M +LL+ LG++  G +   KNVAAV VTA LPPFA  G++IDV+++++GDA SL 
Sbjct: 58  FTEDIMSNLLERLGVNVTGEQYRPKNVAAVFVTATLPPFARAGAQIDVTVSAMGDAKSLL 117

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG LVMT L GADG IYAVAQG+++  G+  +GQ++  ++G+ T G I  GA VERE+  
Sbjct: 118 GGTLVMTPLNGADGQIYAVAQGTIIAGGVSAEGQAARVVQGVPTAGTIPEGARVEREVDF 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           +F     + L LR+PDF+TA RI D+IN        R +A   D+ TV +         R
Sbjct: 178 EFARLDRVRLALRSPDFTTAGRIEDRIN----RELGRGVATMLDAGTVSLDLGRLGPPAR 233

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           +M  +E L V  +T ARV++++R+GTIV+G++VRIS+V V+ G LT+++ E   VVQPN 
Sbjct: 234 VMGRIENLEVVPETVARVVVDQRSGTIVMGEDVRISRVAVAQGGLTLRVEEQPMVVQPNP 293

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAP---DLNSLISGMNSIGLKTDGIISILQGIK 357
           F S G TV    T   +    G+  L + P    L+ +++G+N++G+  + +I IL+ I 
Sbjct: 294 F-SRGETVVVPRTTASIQQRPGT-GLAEIPAETSLSRVVAGLNALGVAPNDMIDILKSIH 351

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E I++
Sbjct: 352 AAGALHAEFIVR 363


>gi|221640805|ref|YP_002527067.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides KD131]
 gi|221161586|gb|ACM02566.1| Flagellar P-ring protein 2 precursor [Rhodobacter sphaeroides
           KD131]
          Length = 363

 Score =  288 bits (737), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 159/348 (45%), Positives = 228/348 (65%), Gaps = 9/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+V     R N L+GYGLVVGL GTGD LR++PFTE  M +LL+ LG++  G +   
Sbjct: 22  RIKDLVRFDGVRGNDLLGYGLVVGLNGTGDGLRNAPFTEDIMSNLLERLGVNVTGEQYRP 81

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAV VTA LPPFA  G++IDV+++++GDA SL GG LVMT L GADG IYAVAQG++
Sbjct: 82  KNVAAVFVTATLPPFARAGAQIDVTVSAMGDAKSLLGGTLVMTPLNGADGQIYAVAQGTI 141

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +  G+  +GQ++  ++G+ T G I  GA VERE+  +F     + L LR+PDF+TA RI 
Sbjct: 142 IAGGVSAEGQAARVVQGVPTAGTIPEGARVEREVEFEFARLDRVRLALRSPDFTTAGRIE 201

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERT 264
           D+IN        R +A   D+ TV +         R++  +E L VE +T ARV++++R+
Sbjct: 202 DRIN----RELGRGVATMLDAGTVSLDLGRLGSPARVLGRIENLAVEPETVARVVVDQRS 257

Query: 265 GTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSF 324
           GTIV+G++VRIS+V V+ G LT+++ E   VVQPN F S G TV    T   +    G+ 
Sbjct: 258 GTIVMGEDVRISRVAVAQGGLTLRVEEQPMVVQPNPF-SRGETVVVPRTTASIQQRPGT- 315

Query: 325 SLIDAP---DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            L + P    L+ +++G+N++G+  + +I IL+ I AAGAL +E I++
Sbjct: 316 GLAEIPAETSLSRVVAGLNALGVAPNDMIDILKSIHAAGALHAEFIVR 363


>gi|46203141|ref|ZP_00051999.2| COG1706: Flagellar basal-body P-ring protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 328

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 226/330 (68%), Gaps = 9/330 (2%)

Query: 41  IGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFA 100
           +GYG+VVGL GTGD+L + PFT+QS++++L+ LGI+T G  + ++N+AAVMVTANLPPFA
Sbjct: 1   MGYGIVVGLNGTGDTLNNIPFTKQSLQAMLERLGINTRGATMRTQNLAAVMVTANLPPFA 60

Query: 101 SPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME 160
           + G+ IDV+++SLGDA SL+GG LV TSLLGADG IYA+AQGSV ++G   +G+++    
Sbjct: 61  TQGTHIDVTVSSLGDAKSLQGGTLVATSLLGADGEIYALAQGSVAIAGFAAEGEAAKITR 120

Query: 161 GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIA 220
           G+ T G+I NGA++ERE+  K  ++  L L LRNPDF+T+ RIA  IN +         A
Sbjct: 121 GVPTNGRISNGALIEREMAFKLNEARSLRLSLRNPDFTTSKRIASAINDF----MGADTA 176

Query: 221 EAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKV 278
           E  D  T+ +  P     ++ RL++EVE L VE D  ARV+++ER+G IV+G +VR+S V
Sbjct: 177 EPTDPATITLQIPAKYRGNMIRLITEVEQLKVEPDQTARVVVDERSGIIVMGRDVRVSTV 236

Query: 279 VVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS-FSLI-DAPDLNSLI 336
            ++ GNLTV ITE   V QP    SNG T     T +KV    G+  +L+ +   L  L+
Sbjct: 237 AIAQGNLTVTITEQPMVSQPAPL-SNGQTAVVPRTGVKVDTGDGNKLALVKEGVSLRELV 295

Query: 337 SGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            G+N++G+    +ISILQ IK AGALQ++I
Sbjct: 296 DGLNALGVGPRDLISILQAIKTAGALQADI 325


>gi|329850451|ref|ZP_08265296.1| flagellar P-ring protein [Asticcacaulis biprosthecum C19]
 gi|328840766|gb|EGF90337.1| flagellar P-ring protein [Asticcacaulis biprosthecum C19]
          Length = 368

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 157/345 (45%), Positives = 225/345 (65%), Gaps = 9/345 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKDVV ++  R NQL+GYG+VVGL GTGD++R+SP  +QSM ++++ LGI+     L +
Sbjct: 27  RIKDVVEVEGVRGNQLVGYGIVVGLNGTGDTVRNSPMLKQSMEAMMERLGINVRDANLNT 86

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KN AAVMVTA LPPFA+PGSR+D+++++ GDA SL GG L++T L+GADG +YAVAQG+V
Sbjct: 87  KNAAAVMVTAELPPFAAPGSRLDITVSAAGDAKSLLGGTLLVTPLIGADGEVYAVAQGTV 146

Query: 145 VVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
               +   G S SS  +G+ T G+I +G I+ER+    F     + L LRNPDF+TA RI
Sbjct: 147 QTGSVSAGGASGSSVTKGVPTAGRISSGGIIERQTAFDFNSQPVVRLTLRNPDFTTAQRI 206

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
           A  I +          A A +   V +  P    +   ++ +E L+V+ D PARV+I+E 
Sbjct: 207 AAAITAQYPG-----TAVAENPSVVAIRAPAGQTMMSFVTLIEPLSVDIDVPARVVIDEV 261

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
            G IV+G+NVRIS+V ++ GNLT+++ E   V QP  F S G T T   TD+ + + KG 
Sbjct: 262 NGVIVMGENVRISRVAIAQGNLTIRVDERPDVSQPAPF-SQGQTATIPATDISIEEEKGK 320

Query: 324 --FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
               L     L+ L++G+N++G+    +ISILQ IKA+GALQ++I
Sbjct: 321 QLLQLGGGSTLSDLVAGLNALGVSPRDMISILQAIKASGALQADI 365


>gi|315498273|ref|YP_004087077.1| flagellar p-ring protein [Asticcacaulis excentricus CB 48]
 gi|315416285|gb|ADU12926.1| flagellar P-ring protein [Asticcacaulis excentricus CB 48]
          Length = 370

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 160/363 (44%), Positives = 231/363 (63%), Gaps = 13/363 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L   + G  E SA   SRIKD+V ++  R NQL+GYGLVVGL GTGD++R++P  +Q+M 
Sbjct: 14  LCAPVFGFAEASA--ASRIKDIVDIEGVRKNQLVGYGLVVGLNGTGDTVRNAPMLKQTME 71

Query: 68  SLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           S++  L ++     L +KN A VMVTA LPPFA+PG+RIDV+++++GDA SL GG L++T
Sbjct: 72  SMMGRLDVNIRDASLNTKNAAVVMVTAELPPFAAPGARIDVTVSAMGDAKSLLGGTLLVT 131

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
            LLGADG  YA AQGS+    +   G S SS  +G+ T G+I +G I+ERE    F    
Sbjct: 132 PLLGADGEAYAAAQGSIQTGSVSAGGASGSSVTKGVPTAGRIASGGIIERETGFDFNAMP 191

Query: 187 DLILQLRNPDFSTAIRIADQIN-SYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEV 245
            + L L+NPDF+TA RIAD +N +Y    F      A +   V V     +++   ++ +
Sbjct: 192 IVRLTLKNPDFTTAKRIADTVNKAYPGTAF------ADNPTVVSVRNRPEMNMMSFITAI 245

Query: 246 EMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
           E + V  DTPA+V+I+E  G IVIG+NVR+S+V ++ GNLT+++ E   V QP  F S G
Sbjct: 246 EQMAVTVDTPAKVVIDEVNGVIVIGENVRVSRVAIAQGNLTIRVDERPFVSQPAPF-SQG 304

Query: 306 STVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
            T    ++ + V + KG   F L +   L  L++G+N++G+    +ISILQ IKA+GALQ
Sbjct: 305 QTTAVPDSSVSVEEEKGKRLFELQETTSLTDLVNGLNALGVSPRDMISILQTIKASGALQ 364

Query: 364 SEI 366
           ++I
Sbjct: 365 ADI 367


>gi|294675567|ref|YP_003576182.1| flagellar P-ring protein FlgI [Rhodobacter capsulatus SB 1003]
 gi|294474387|gb|ADE83775.1| flagellar P-ring protein FlgI [Rhodobacter capsulatus SB 1003]
          Length = 365

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 159/349 (45%), Positives = 230/349 (65%), Gaps = 11/349 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+V     R N L+GYGLVVGL GTGD +R++PFTE+ M ++L+ LG++  G +   
Sbjct: 22  RIKDLVEFDGVRGNDLVGYGLVVGLNGTGDGIRNAPFTEEIMANILERLGVNVSGEQFRP 81

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAVMVTA LPPFA  GS+IDV+++++GDA SL GG L+MT L  ADG IYAVAQG+V
Sbjct: 82  KNVAAVMVTAALPPFARAGSKIDVTVSAIGDAKSLLGGTLIMTPLNAADGEIYAVAQGAV 141

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +  G+  +GQ++S ++G+ T G I +GA VERE+  +    +D+ L LR PDF+TA RI 
Sbjct: 142 IAGGVSAQGQAASVVQGVPTSGTIPSGAHVEREIGFELDSLSDVRLALRTPDFTTAARIE 201

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL---TRLMSEVEMLTVETDTPARVIIN 261
             IN      F   IA   DS TV VS   N ++     ++  +E LTVE +  ARV+++
Sbjct: 202 KAIN----REFGSRIAAMEDSGTVSVSI-ANANMRSAAHVLERLENLTVEPEQRARVVVD 256

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           +R+GTIV+G++VRIS+V VS GNLT+++ E    VQPN F + G TV    T+  + +  
Sbjct: 257 QRSGTIVMGEDVRISRVAVSQGNLTLRVQEAPIAVQPNPF-ARGETVVVPRTEASIEEGA 315

Query: 322 G--SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           G     + +   L+ +++G+N++G+    +I IL+ I AAGAL +E ++
Sbjct: 316 GLKMAEVGETSSLSDVVAGLNALGVSPRDMIDILKSINAAGALHAEFVV 364


>gi|163735546|ref|ZP_02142978.1| flagellar P-ring protein precursor I [Roseobacter litoralis Och
           149]
 gi|161391166|gb|EDQ15503.1| flagellar P-ring protein precursor I [Roseobacter litoralis Och
           149]
          Length = 367

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 161/354 (45%), Positives = 233/354 (65%), Gaps = 19/354 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+V     R N L+GYGLVVGL G+GD LR++PFTE+ M ++L+ LG++  G +   
Sbjct: 24  RIKDLVEFDGVRGNDLVGYGLVVGLNGSGDGLRNAPFTEEIMSNILERLGVNVSGEQFRP 83

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAV VTA LPPFA  GS+IDV+++++GDASSL GG L+MT +  ADG IYAVAQG++
Sbjct: 84  KNVAAVFVTAALPPFARGGSQIDVTVSAIGDASSLLGGTLIMTPMNAADGQIYAVAQGTI 143

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +  G   +G  ++  +G+ T G I +GA VERE+       ++L L LR+ DF+TA RI 
Sbjct: 144 IAGGATAEGDGANVTQGVPTSGVIPSGARVEREIDFDLSSLSELRLALRDADFTTAARIE 203

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMS------EVEMLTVETDTPARV 258
             IN    N F RP+A   DS TV +    N+D T ++S       +E ++VE +  ARV
Sbjct: 204 AAIN----NDFGRPVALMLDSGTVSL----NVDSTEMISVAHALGRIENISVEPERKARV 255

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++++R+GTIV+G++VRIS+V VS GNLT++I E    +QPN F + G TV    T  ++ 
Sbjct: 256 VVDQRSGTIVMGEDVRISRVAVSQGNLTLRIQEAPIAIQPNPF-AEGETVVVPRTRAELE 314

Query: 319 DNKGSFSLIDAPD---LNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +  G   L + PD   L+ +I+G+N++G+    +I IL+ IKAAGAL +E I++
Sbjct: 315 EEPG-IGLAEVPDGTSLSEVIAGLNALGVSPRDMIDILKSIKAAGALHAEFIVR 367


>gi|296283246|ref|ZP_06861244.1| flagellar P-ring protein precursor [Citromicrobium bathyomarinum
           JL354]
          Length = 363

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 161/350 (46%), Positives = 228/350 (65%), Gaps = 10/350 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SRIKD+V +++ R NQL+GYGLVVGL GTGD  R+ PFTE+S++S+L+ +G+S    +L 
Sbjct: 20  SRIKDIVDVENVRTNQLVGYGLVVGLAGTGDRTRNVPFTEESLQSMLERMGVSVRDMQLR 79

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KNVAAV VTA LPPFA  GSRIDV ++++GDA+SL+GG L+++ L   +G I+AVAQG 
Sbjct: 80  TKNVAAVTVTATLPPFARAGSRIDVQVSAMGDATSLQGGTLLISPLRALNGEIFAVAQGP 139

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + VSG   +G  +S   G+ST  +I  GAIVERE+P     +  L L L+NPDF+TA RI
Sbjct: 140 LAVSGFKAQGAGASISRGVSTSARIAGGAIVEREVPYVLGSADSLKLALKNPDFTTADRI 199

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKV--SKPTNIDLTRLMSEVEMLTVETDTPARVIIN 261
              IN     RF    A   D  TV++  +      L +L+ E+E L V+ D PAR+++N
Sbjct: 200 VRAIN----QRFPG-AARMLDPATVELGGAGGYGGSLLQLLPEIENLPVDVDQPARIVVN 254

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           E  GT+V+  +VRIS V ++ G LT+ + E+  V QP  F S G T     T L+V D  
Sbjct: 255 EAAGTVVMTSDVRISPVAIAQGGLTISVAESPIVSQPGPF-SGGETTVVPRTRLEVDDGS 313

Query: 322 G-SFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           G S ++++    L SL++G+N +G+    +I+IL  +K AGALQ+EI IQ
Sbjct: 314 GASLAMLEQGTSLQSLVNGLNRLGVSPRDLITILHALKGAGALQAEITIQ 363


>gi|148266113|ref|YP_001232819.1| flagellar basal body P-ring protein [Geobacter uraniireducens Rf4]
 gi|189044484|sp|A5G8X8|FLGI_GEOUR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|146399613|gb|ABQ28246.1| flagellar P-ring protein [Geobacter uraniireducens Rf4]
          Length = 368

 Score =  286 bits (732), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 164/371 (44%), Positives = 235/371 (63%), Gaps = 11/371 (2%)

Query: 2   IFR-IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           IFR I F  F L+ L + +  V  RIKD+ +    R+NQLIGYGLVVGL GTGDS ++  
Sbjct: 4   IFRKIVFAAFLLLALPQFALAV--RIKDIAAFDGVRENQLIGYGLVVGLNGTGDSDQTK- 60

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           F  QS+ + L+ +GI+     +  KNVAAVMVTA LPPFA  G+ +DV ++S+GD+ SL 
Sbjct: 61  FPVQSLVNTLERMGITINRADITVKNVAAVMVTAALPPFAKQGNSLDVLVSSVGDSKSLA 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L GAD  IYAVAQG V+ +     GQ++S  +   T G++  GA+VERELP 
Sbjct: 121 GGTLLMTPLKGADSQIYAVAQGGVLTNSFSYGGQAASVQKNHPTAGRVPGGALVERELPN 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--L 238
                + L L L  PDF+TA R+A  IN    N+F   +A   D  +V+++ P +     
Sbjct: 181 VLAGRSQLRLNLHQPDFTTASRVAAVIN----NKFKMTVASLTDPGSVQLAIPDDYQGKT 236

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
              ++ +E L V  D  ARV++NERTGTIVIG+NVRIS V VS+GNLT+ + E  +V QP
Sbjct: 237 VEFVAALERLEVTPDVMARVVLNERTGTIVIGENVRISTVAVSHGNLTLYVKETPRVSQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIK 357
             FSS G T     T +KV++++GS +++    ++  ++  +N++G+    +I I+Q IK
Sbjct: 297 APFSSTGETKVVPRTSIKVTEDRGSLAILQQGANIGDVVRALNALGVTPRDLIGIMQAIK 356

Query: 358 AAGALQSEIII 368
           AAGAL +E+++
Sbjct: 357 AAGALNAELMV 367


>gi|260574383|ref|ZP_05842387.1| flagellar P-ring protein [Rhodobacter sp. SW2]
 gi|259023279|gb|EEW26571.1| flagellar P-ring protein [Rhodobacter sp. SW2]
          Length = 364

 Score =  286 bits (731), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 161/369 (43%), Positives = 233/369 (63%), Gaps = 17/369 (4%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           +F  + L   +A    RIKD+V     R N L+GYGLVVGL GTGD +R+SPFTE+ M +
Sbjct: 5   VFLFLCLAFPAAASPIRIKDLVQFDGVRGNDLVGYGLVVGLNGTGDGIRNSPFTEEIMSN 64

Query: 69  LLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTS 128
           LL+ LG++  G +   KNVAAV VTA LPPFA  G +IDVS++++GD+ SL GG L+MT 
Sbjct: 65  LLERLGVNVAGEQYRPKNVAAVFVTAALPPFARAGGQIDVSVSAIGDSKSLLGGTLIMTP 124

Query: 129 LLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADL 188
           L GADG IYAVAQG+++  G+  +G ++  ++G+ T G I +GA VERE+   F     +
Sbjct: 125 LNGADGQIYAVAQGTIIAGGISAEGDAARVVQGVPTAGVIPSGARVEREVEFDFSSLTSV 184

Query: 189 ILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTV-------KVSKPTNIDLTRL 241
            L LR  DF+TA RI   IN      F R IA   DS TV       +++ P ++     
Sbjct: 185 RLALRTADFTTAGRIEQVIN----QEFGRSIAVMLDSGTVALDLSGARMASPAHV----- 235

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           +  VE L VE +T ARV++++R+GTIV+G++VRIS+V V+ GNLT++I E+  VVQPN F
Sbjct: 236 LGRVENLLVEPETRARVVVDQRSGTIVMGEDVRISRVAVAQGNLTLRIEESPMVVQPNPF 295

Query: 302 SSNGS-TVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           +   S  V +   D+   D  G   +    +L+ +++G+N++G+    +I IL+ I AAG
Sbjct: 296 TDGESIVVPRTRADINKGDGTGLAEITGGTNLSEVVAGLNALGVAPHDMIDILKSINAAG 355

Query: 361 ALQSEIIIQ 369
           AL +E ++Q
Sbjct: 356 ALHAEFLVQ 364


>gi|110677960|ref|YP_680967.1| flagellar basal body P-ring protein [Roseobacter denitrificans OCh
           114]
 gi|109454076|gb|ABG30281.1| flagellar P-ring protein FlgI [Roseobacter denitrificans OCh 114]
          Length = 367

 Score =  286 bits (731), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 161/354 (45%), Positives = 230/354 (64%), Gaps = 19/354 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+V     R N L+GYGLVVGL GTGD LR++PFTE+ M ++L+ LG++  G +   
Sbjct: 24  RIKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNAPFTEEIMSNILERLGVNVSGEQFRP 83

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
            NVAAV VTA LPPFA  GS+IDV+++++GDA+SL GG L+MT +  ADG IYAVAQG++
Sbjct: 84  NNVAAVFVTATLPPFARGGSQIDVTVSAIGDANSLLGGTLIMTPMNAADGQIYAVAQGTI 143

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +  G  V+G  ++   G+ T G I +GA VERE+        +L L LR+ DF+TA RI 
Sbjct: 144 IAGGAAVEGDGANVTRGVPTSGVIPSGARVEREIEFDLSSLNELRLALRDADFTTAARIE 203

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMS------EVEMLTVETDTPARV 258
             IN    N F RP+A   DS TV++    N+D T + S       +E + VE +  ARV
Sbjct: 204 AAIN----NDFGRPVAVMLDSGTVRL----NVDATEMASVAHALGRIENIPVEPERKARV 255

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++++R+GTIV+G++VRIS+V VS GNLT++I E    +QPN F+  G TV    T  ++ 
Sbjct: 256 VVDQRSGTIVMGEDVRISRVAVSQGNLTLRIQEAPIAIQPNPFAE-GETVVVPRTRAELE 314

Query: 319 DNKGSFSLIDAPD---LNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +  G   L + PD   L+ +I+G+N++G+    +I IL+ IKAAGAL +E I++
Sbjct: 315 EEPG-IGLAEVPDGTSLSEVIAGLNALGVSPRDMIDILKSIKAAGALHAEFIVR 367


>gi|326403260|ref|YP_004283341.1| flagellar P-ring protein [Acidiphilium multivorum AIU301]
 gi|325050121|dbj|BAJ80459.1| flagellar P-ring protein [Acidiphilium multivorum AIU301]
          Length = 384

 Score =  285 bits (730), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 164/350 (46%), Positives = 229/350 (65%), Gaps = 12/350 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP--GGRL 82
           RIKD+  +Q  RDNQLIGYGLVVGL+GTGDSL +S FT QS+  +L+ LG++T      L
Sbjct: 42  RIKDITDIQGIRDNQLIGYGLVVGLRGTGDSLNNSIFTRQSLIGMLERLGVNTQNQAQNL 101

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            +K++AAVMVTANLP FA  G  IDV+++++GDA+ L GG L++T LLGADG +YAVAQG
Sbjct: 102 QTKDIAAVMVTANLPAFAHSGETIDVTVSAMGDATDLTGGTLLVTPLLGADGRVYAVAQG 161

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           S+V   +   G ++SF +G+ T G+I NGAIVER +  K        L+LRNPDF+TA+R
Sbjct: 162 SLVTGAIQAAGANASFTQGVPTVGRITNGAIVERSVSFKLASEKTPKLELRNPDFTTAMR 221

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVS-KPTNIDLTRLMSEVEMLTVETDTPARVIIN 261
           I+  I+     R    IA   D RT+ +  K  N+     ++E+E L V+  TPA V+++
Sbjct: 222 ISRVID----ERLGPGIATVDDPRTITLDLKGRNV--VSDLAEIEDLRVQPSTPAVVVVD 275

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           E TGTIV+G NVRIS V +  GN+TV +     V QPN   + G+TV  + T + V  ++
Sbjct: 276 EATGTIVMGANVRISTVAIDEGNITVTVKNTPVVSQPNPL-AGGTTVATSQTSISVKKDR 334

Query: 322 G-SFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           G    ++     L  L+S +NS+G+    +ISILQ IKAAGALQ+ +++Q
Sbjct: 335 GKKMDIVHGNISLQQLVSSLNSLGVAPHDMISILQAIKAAGALQARLVVQ 384


>gi|260431759|ref|ZP_05785730.1| flagellar P-ring protein FlgI [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415587|gb|EEX08846.1| flagellar P-ring protein FlgI [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 364

 Score =  285 bits (729), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 159/366 (43%), Positives = 232/366 (63%), Gaps = 7/366 (1%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L F L+ L  ++     R+KD+V     R N L+GYGLVVGL GTGD LR+SPFTE+ M
Sbjct: 3   LLAFVLMLLPTVAFSGAVRLKDLVDFDGVRGNDLVGYGLVVGLNGTGDGLRNSPFTEEIM 62

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
            ++L+ LG++  G     KNVAAV+VTA LPPF+  GS+IDV+++++GD+ SL GG LVM
Sbjct: 63  SNILERLGVNVNGEDFRPKNVAAVLVTATLPPFSRVGSQIDVTVSAIGDSKSLLGGTLVM 122

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L  ADG IYAVAQG+V+  G   +G+++    G+ T G I +GA VERE+  +F    
Sbjct: 123 TPLNAADGQIYAVAQGTVLAGGAVAEGEAAKVTRGVPTSGVIPSGARVEREIDFEFSGLT 182

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN--IDLTRLMSE 244
            L L LR PDF+TA RI   IN      F+RP+A   DS TV++S P          +  
Sbjct: 183 QLRLALREPDFTTAGRIEAAIN----REFNRPVAIMRDSGTVELSIPETRAASTAHAVGR 238

Query: 245 VEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           +E + +E ++ ARV++++R+GTIV+G +VRIS+V VS GNLT+++ E    VQPN F+  
Sbjct: 239 IENILIEPESKARVVVDQRSGTIVMGQDVRISRVAVSQGNLTLRVEEAPIAVQPNPFAEG 298

Query: 305 GSTVTQNN-TDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
            S V       ++  +  G   + +A  L+ +++G+N++G+    +I IL+ IKAAGAL 
Sbjct: 299 ESVVVPRTVAGIEEEEGTGLAEIPEATTLSEVVAGLNALGVSPRDMIDILKTIKAAGALH 358

Query: 364 SEIIIQ 369
           +E I++
Sbjct: 359 AEFIVR 364


>gi|148259772|ref|YP_001233899.1| flagellar basal body P-ring protein [Acidiphilium cryptum JF-5]
 gi|146401453|gb|ABQ29980.1| flagellar P-ring protein [Acidiphilium cryptum JF-5]
          Length = 384

 Score =  285 bits (729), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 165/350 (47%), Positives = 229/350 (65%), Gaps = 12/350 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP--GGRL 82
           RIKD+  +Q  RDNQLIGYGLVVGL+GTGDSL +S FT QS+  +L+ LG++T      L
Sbjct: 42  RIKDITDIQGIRDNQLIGYGLVVGLRGTGDSLNNSIFTRQSLIGMLERLGVNTQNQAQNL 101

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            +K++AAVMVTANLP FA  G  IDV+++++GDA+ L GG L++T LLGADG +YAVAQG
Sbjct: 102 QTKDIAAVMVTANLPAFAHSGETIDVTVSAMGDATDLTGGTLLVTPLLGADGRVYAVAQG 161

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           S+V   +   G ++SF +G+ T G+I NGAIVER +  K        L+LRNPDF+TA+R
Sbjct: 162 SLVTGAIQAAGANASFTQGVPTVGRITNGAIVERSVSFKLASEKTPKLELRNPDFTTAMR 221

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVS-KPTNIDLTRLMSEVEMLTVETDTPARVIIN 261
           I+  I+     R    IA   D RT+ +  K  N+     ++E+E L V+  TPA V+++
Sbjct: 222 ISRVID----ERLGPGIATVDDPRTITLDLKGRNV--VSDLAEIEDLRVQPSTPAVVVVD 275

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           E TGTIV+G NVRIS V +  GN+TV +     V QPN   + G+TV  + T + V  ++
Sbjct: 276 EATGTIVMGANVRISTVAIDEGNITVTVKNTPVVSQPNPL-AGGTTVATSQTSISVKKDR 334

Query: 322 GSFSLIDAPD--LNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           G    I   +  L  L+S +NS+G+    +ISILQ IKAAGALQ+ +++Q
Sbjct: 335 GKKMDIVHGNISLQQLVSSLNSLGVAPHDMISILQAIKAAGALQARLVVQ 384


>gi|296534164|ref|ZP_06896657.1| flagellar P-ring protein FlgI [Roseomonas cervicalis ATCC 49957]
 gi|296265510|gb|EFH11642.1| flagellar P-ring protein FlgI [Roseomonas cervicalis ATCC 49957]
          Length = 383

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 168/349 (48%), Positives = 228/349 (65%), Gaps = 10/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG--GRL 82
           R+KD+  ++  RDNQL+GYGLVVGL GTGD LR++ FT QS+  +L+ LG++T     RL
Sbjct: 41  RVKDIADIEGVRDNQLVGYGLVVGLNGTGDRLRNAVFTRQSLIGVLERLGVNTRDQENRL 100

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            ++NVAAVMVTANLP FA  GSR+D+++++LGDA++L GG LV+T L GADG +YAVAQG
Sbjct: 101 DTRNVAAVMVTANLPAFARNGSRVDITVSALGDATNLGGGTLVVTPLHGADGEVYAVAQG 160

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
            V    +  +G ++S   G+ T G+I NGAIVERE+P  F +   L L LRNPD +TA R
Sbjct: 161 QVATGAIAARGAAASVTRGVPTSGRIPNGAIVEREVPFAFGNKPTLRLSLRNPDLTTARR 220

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           +A  IN  +    +     A D RTV VS     D     +E+E L VE D  ARV+I E
Sbjct: 221 VAAAINRMAGAGAA----AANDPRTVTVSL-VGRDPVGFATEIEQLRVEPDQAARVVIEE 275

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
            +GTIV+G NVRIS V ++ GNLT+++TE  QVVQPNA +  G T     T ++V D   
Sbjct: 276 ASGTIVMGANVRISTVAIAQGNLTIRVTEAPQVVQPNALAG-GQTAVVPRTGIEVDDQSE 334

Query: 323 SFS--LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                L     L  L+ G+N++G+    +ISILQ IKAAGALQ+++ ++
Sbjct: 335 RRLGILQSGVSLQELVRGLNNLGVGPRDMISILQTIKAAGALQAQLEVR 383


>gi|254467240|ref|ZP_05080651.1| flagellar P-ring protein FlgI [Rhodobacterales bacterium Y4I]
 gi|206688148|gb|EDZ48630.1| flagellar P-ring protein FlgI [Rhodobacterales bacterium Y4I]
          Length = 368

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 161/368 (43%), Positives = 234/368 (63%), Gaps = 12/368 (3%)

Query: 8   LIFSLIGLHEISAQVVS-RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           L F+ + L  ++AQ  + R+KD+V     R N L+GYGLVVGL GTGD LR+SPFTE+ M
Sbjct: 7   LFFACLFLLPVAAQANTIRLKDLVEFDGVRGNDLVGYGLVVGLDGTGDGLRNSPFTEEIM 66

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
            ++L+ LG++  G +   KNVAAV VTA LPPFA  GS IDV+++++GD+ SL GG L+M
Sbjct: 67  TNILERLGVNVTGEQFRPKNVAAVFVTATLPPFARVGSTIDVTVSAIGDSKSLLGGTLIM 126

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L  ADG IYAVAQG+++  G   +G++++  +G+ T G I +GA VERE+        
Sbjct: 127 TPLNAADGQIYAVAQGTILAGGAVAEGEAATVTQGVPTAGVIPSGARVEREIDFDLASLT 186

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVS--KPTNIDLTRLMSE 244
            + L LR PDF+TA RI   IN    N F R +A   DS TV+V   +         +  
Sbjct: 187 SMRLALREPDFTTAGRIERAIN----NEFGRNVALMRDSGTVEVDIGRTNTRSTAHAVGR 242

Query: 245 VEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           +E + VE    ARV++++R+GTIV+G +VRIS+V V+ GNLT++I E   VVQPN F ++
Sbjct: 243 IENILVEPQRKARVVVDQRSGTIVMGSDVRISRVAVAQGNLTLRIEETPLVVQPNPF-AD 301

Query: 305 GSTVTQNNTDLKVSDNKGSFSLIDAPDLNSL---ISGMNSIGLKTDGIISILQGIKAAGA 361
           G TV    T   + + +G   L + P+  SL   +SG+N++G+    +I IL+ +KAAGA
Sbjct: 302 GETVVVPRTGAAIEEEEG-IQLAEVPETTSLSEVVSGLNALGVSPRDMIDILKSLKAAGA 360

Query: 362 LQSEIIIQ 369
           L +E +++
Sbjct: 361 LHAEFVVR 368


>gi|58039091|ref|YP_191055.1| flagellar basal body P-ring protein [Gluconobacter oxydans 621H]
 gi|81557150|sp|Q5FT97|FLGI_GLUOX RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|58001505|gb|AAW60399.1| Flagellar P-ring protein precursor [Gluconobacter oxydans 621H]
          Length = 380

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 170/366 (46%), Positives = 229/366 (62%), Gaps = 13/366 (3%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           AF+   L+ L   +     RIKD+  ++  R NQLIGYGLVVGL GTGD L ++ FT ++
Sbjct: 20  AFVCVGLLLLPGFTLAASVRIKDITDMEGVRSNQLIGYGLVVGLNGTGDRLTNTIFTRET 79

Query: 66  MRSLLQNLG--ISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           + S+L  LG  I     +L + +VAAVMVTA+LP F   G+RIDV++++ GDASSL GG 
Sbjct: 80  LISMLNRLGVNIRDQETQLQTHDVAAVMVTADLPAFVHGGNRIDVTVSAAGDASSLTGGT 139

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L++T L+ ADG +YAVAQGS+  +    +G ++S    + T G I NG IVERE+P    
Sbjct: 140 LLVTPLMAADGEVYAVAQGSLATNAFSARGAAASITRNVPTSGHIANGGIVEREVPFDLS 199

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMS 243
             A+L L LRNPDF+TA RIA  I     NR   PIA   D RTV +   +N D    +S
Sbjct: 200 HRANLHLSLRNPDFTTASRIASII-----NRTFGPIAIVQDPRTVLLDL-SNHDPVSTLS 253

Query: 244 EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
            +  L V  DTPA+V+++E +GTI++G +VRIS V V+ GNLTVQ+TE  QV QP  F S
Sbjct: 254 RIGDLLVTPDTPAKVVVDEASGTIIMGADVRISTVAVAQGNLTVQVTETPQVSQPGPF-S 312

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAP---DLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            G T     T++KV   K +  L   P    L  L+SG+N++G+    +ISILQ IKA G
Sbjct: 313 GGQTAVVPRTNVKVDTGK-THHLAVVPGGTTLRELVSGLNALGVGPRDMISILQAIKADG 371

Query: 361 ALQSEI 366
           ALQ+E+
Sbjct: 372 ALQAEL 377


>gi|114765251|ref|ZP_01444383.1| flagellar P-ring protein precursor [Pelagibaca bermudensis
           HTCC2601]
 gi|114542386|gb|EAU45414.1| flagellar P-ring protein precursor [Roseovarius sp. HTCC2601]
          Length = 370

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 169/373 (45%), Positives = 241/373 (64%), Gaps = 11/373 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVS--RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
            RIA  + +LIG   ++   ++  RIKD+ + +  R+NQL+GYGLVVGL GTGDSLR+SP
Sbjct: 1   MRIAACLLALIGALSLALPALADVRIKDIATFEGVRENQLVGYGLVVGLNGTGDSLRNSP 60

Query: 61  FTEQSMRSLLQNLGIST-PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FTE+S+ ++L+ LG+       + + N AAVMVTA LPPFA  GS IDV ++SLGDA+SL
Sbjct: 61  FTEKSIEAMLERLGVGNLSDDNIKTTNTAAVMVTAMLPPFARLGSTIDVVVSSLGDATSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L++T L GADG +YAVAQG + V+G    G ++S  EG+ T  +I NGA VE E+ 
Sbjct: 121 RGGTLIVTPLTGADGEVYAVAQGPIAVAGFSATGVAASITEGVPTVARIENGATVENEVD 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVK--VSKPTNID 237
            +      + + LRNPDF+TA+R++D IN    +R     +   DS TV+  +      D
Sbjct: 181 FQLSSLNSVRITLRNPDFTTAVRMSDAIN----DRLGGNSSRVLDSGTVELAIQGAGKGD 236

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           +  ++SEVE L +E D+ A+V+++ +TGTIVIG NVRI +V VS G LTV + E+  V Q
Sbjct: 237 VPGVLSEVENLRLEPDSIAKVVVDAKTGTIVIGANVRIDRVAVSQGGLTVMVREDPVVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPD--LNSLISGMNSIGLKTDGIISILQG 355
           PN  +  G+TV    T + V + +  F++++  D  L  L+  +N+IGL     ISILQ 
Sbjct: 297 PNPITIGGTTVVVPRTTVGVEEQEAHFTILEGADVSLQRLVDALNAIGLSAMQTISILQA 356

Query: 356 IKAAGALQSEIII 368
           IKAAGAL +++ I
Sbjct: 357 IKAAGALHADLEI 369


>gi|289208118|ref|YP_003460184.1| flagellar P-ring protein [Thioalkalivibrio sp. K90mix]
 gi|288943749|gb|ADC71448.1| flagellar P-ring protein [Thioalkalivibrio sp. K90mix]
          Length = 401

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 153/349 (43%), Positives = 225/349 (64%), Gaps = 9/349 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
            R+KDV S+   R+NQL+GYGLVVGL GTGD    +PFT QS+ ++L  LG++   G   
Sbjct: 57  ERVKDVASVFGVRENQLVGYGLVVGLDGTGDQTTQTPFTIQSLNNMLGQLGLTPDAGNPQ 116

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            +NVAAVMVTA LPPF+ PG RIDV+++S+G+A+SLRGG L+MT L GADG  Y++AQG+
Sbjct: 117 LRNVAAVMVTAELPPFSKPGQRIDVTVSSMGNATSLRGGTLLMTPLKGADGQTYSIAQGN 176

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G   +GQ  S +   + + G+I NGA VERE+P  F     + L L  PDF+TA R
Sbjct: 177 LVVGGFGAEGQDGSRITVNVPSVGRIPNGATVEREVPTAFAQGDHVTLNLNRPDFTTANR 236

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVETDT-PARVII 260
           + + +N    + F   +A A D  +V+V  P N D     ++E+E L +E    PARVI+
Sbjct: 237 LVETVN----DTFGPGVAHALDGSSVRVRAPQNPDQRVGFVAELENLPIERGAPPARVIV 292

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTGT+VIG  V+++   VS+G+LTV I+E  QVVQP  F+  G T  Q  TD+ +  +
Sbjct: 293 NSRTGTVVIGSRVQVTPAAVSHGSLTVTISEAPQVVQPMPFAE-GETAVQPQTDIAIQQD 351

Query: 321 KGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             +  L D    L+ ++  +N++G     +++IL+ ++ AGAL++E+++
Sbjct: 352 DSTMFLFDPGTSLDEIVRAVNNVGAAPGDLVAILEALREAGALRAELVV 400


>gi|89068724|ref|ZP_01156110.1| flagellar P-ring protein precursor [Oceanicola granulosus HTCC2516]
 gi|89045687|gb|EAR51749.1| flagellar P-ring protein precursor [Oceanicola granulosus HTCC2516]
          Length = 372

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 162/346 (46%), Positives = 232/346 (67%), Gaps = 7/346 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST-PGGRLG 83
           RIKD+ + +  R+NQL+GYGLVVGL GTGDSLR+SPFT+QS++ +L+ LG+      ++ 
Sbjct: 31  RIKDIATFEGVRENQLVGYGLVVGLNGTGDSLRNSPFTQQSIQGMLERLGVGNLSDDQMK 90

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           ++N AAVMVTA+LPPFA  GS IDV ++SLGDASSLRGG L++T L GADG IYAVAQG 
Sbjct: 91  TENTAAVMVTASLPPFARRGSTIDVVVSSLGDASSLRGGTLIVTPLTGADGEIYAVAQGP 150

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + V+G   +G +++ +EG+ T  +I NGA++E E+  + ++   + + LR PDF+TA+R+
Sbjct: 151 IAVAGYAAQGANAAIVEGVPTVARIENGALIENEIGFRLEELESVRIALRVPDFTTAVRV 210

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
            D IN+          A A D  T++V      D+  LM+ +E L V  D+ A+V+I+ R
Sbjct: 211 QDVINAA----LGGGTARALDPGTIEVYPSDKSDIPGLMAGLENLRVNPDSVAKVVIDAR 266

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           +GTIVIG  VRI +V VS G LTV + E+ +V QP  FS  G TV    T + V + + +
Sbjct: 267 SGTIVIGAEVRIGRVAVSQGGLTVIVKEDVEVSQPEPFSV-GETVVVPQTTVTVEERRTN 325

Query: 324 FSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           F++I+    L  L+ G+N+IGL     ISILQ +KAAGAL +++ I
Sbjct: 326 FAIIEGDVSLQRLVDGLNAIGLGATETISILQAMKAAGALHADLEI 371


>gi|283850810|ref|ZP_06368096.1| flagellar P-ring protein [Desulfovibrio sp. FW1012B]
 gi|283573733|gb|EFC21707.1| flagellar P-ring protein [Desulfovibrio sp. FW1012B]
          Length = 386

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 161/368 (43%), Positives = 237/368 (64%), Gaps = 8/368 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +IF  + L+ + I          +RIKD+ S+   R NQL+GYGLVVGL GTGD  R S 
Sbjct: 22  VIFLTSLLVLAAILFCLARPAHGARIKDIASVSGMRKNQLVGYGLVVGLSGTGDQ-RGSD 80

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FT QS+ ++L  +G+      L  KNVAAVMVTA +P  A PGSRIDV+++SLGD++SL 
Sbjct: 81  FTVQSIFNMLDKMGVRVDRATLKPKNVAAVMVTAQMPVSAKPGSRIDVTVSSLGDSTSLL 140

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG+L++T L G DGNIYA+AQGSV+V G+  +G  +S  + I+T G +  GA VER +  
Sbjct: 141 GGVLLVTPLKGVDGNIYAIAQGSVLVGGVSAQGAGASVSKNITTVGILPGGANVERAVAF 200

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVS-KPTNI-DL 238
            F D  DL L LRNPDFSTA R+A ++N          +A A D+ T++++  P N  +L
Sbjct: 201 SFNDQTDLTLSLRNPDFSTATRVAKRVNET----MGAAMATAVDAGTIRLAVAPENQGNL 256

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           T LM+ +E + V  D+ ARV+++E+TGT+V+G NV+IS V V++GNL +Q+ E+  V QP
Sbjct: 257 TPLMAAIENIEVTPDSRARVVVDEKTGTVVLGQNVQISPVAVTHGNLQIQVQESADVSQP 316

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
             F S G TV    T++ V++      +I+   L  L+ G+N++G     +ISIL+ +++
Sbjct: 317 LPF-SGGQTVVTPQTNIGVNEENRKLKMIEGATLQELVEGLNALGATPRDLISILRTLES 375

Query: 359 AGALQSEI 366
           +GAL +++
Sbjct: 376 SGALAADL 383


>gi|239907789|ref|YP_002954530.1| flagellar P-ring protein precursor [Desulfovibrio magneticus RS-1]
 gi|239797655|dbj|BAH76644.1| flagellar P-ring protein precursor [Desulfovibrio magneticus RS-1]
          Length = 394

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 155/364 (42%), Positives = 235/364 (64%), Gaps = 8/364 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +A LI + + L  +     +RIKD+ ++   R NQL+GYGLVVGL GTGD  R S FT Q
Sbjct: 34  LAVLILAALVLGVVHTAHSARIKDLATVSGMRKNQLVGYGLVVGLSGTGDQ-RGSDFTVQ 92

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           S+ ++L  +G+      L  KNVAAVMVTA +P  +  GSR+DV+++S+GD++SL GG+L
Sbjct: 93  SIYNMLDKMGVRVDKATLKPKNVAAVMVTAQMPVSSKAGSRLDVTVSSIGDSTSLLGGVL 152

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           ++T L G DGNIYA+AQGSV+V G+  +G  +S  + I+T G +  G  +ER +P  F D
Sbjct: 153 LVTPLKGIDGNIYAIAQGSVLVGGVSAQGAGASVSKNITTVGMVPGGGNIERSVPFAFND 212

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLM 242
             DL L LRNPDFSTA R+A ++N        + +A A D+ T++++ P     +L  LM
Sbjct: 213 QPDLTLSLRNPDFSTATRLAKRVNES----LGQAMATAIDAGTIRLAVPPENQGNLAMLM 268

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           + +E L V  D  ARV+++E+TGT+V+G NV+IS V V++GNL +Q+ E+  V QP  F 
Sbjct: 269 ASIENLDVTPDHRARVVVDEKTGTVVLGQNVQISPVAVTHGNLQIQVQESADVSQPLPF- 327

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           SNG TV    T++ V++      +I+   L  L+ G+N++G     +IS+L+ ++A+GAL
Sbjct: 328 SNGRTVVTPETNIAVNEENRKLKMIEGATLQELVEGLNALGATPRDLISVLRTLEASGAL 387

Query: 363 QSEI 366
            +++
Sbjct: 388 SADL 391


>gi|114762174|ref|ZP_01441642.1| flagellar P-ring protein precursor I [Pelagibaca bermudensis
           HTCC2601]
 gi|114545198|gb|EAU48201.1| flagellar P-ring protein precursor I [Roseovarius sp. HTCC2601]
          Length = 370

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 167/379 (44%), Positives = 238/379 (62%), Gaps = 21/379 (5%)

Query: 1   MIFRIA--FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS 58
           MI R+    L F+L  L + +A    RIKD+V     R N L+GYGLVVGL GTGD LR+
Sbjct: 1   MITRLLGLCLAFTLCLLTQSAAAQSVRIKDLVEFDGVRSNDLVGYGLVVGLNGTGDGLRN 60

Query: 59  SPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           +PFTE+ M+++L+ LG++  G +   +NVAAV VT+ LPPF   GS+IDV+++++GDASS
Sbjct: 61  APFTEEIMQNILERLGVNVTGEQFRPRNVAAVFVTSRLPPFGRAGSQIDVTVSAIGDASS 120

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           L GG L+MT L  ADG IYAVAQG+V+  G+  +G  +  ++G+ T G I  GA +ERE+
Sbjct: 121 LLGGTLIMTPLNAADGQIYAVAQGTVIAGGVNAEGDGARVVQGVPTSGMIPAGARIEREV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL 238
              F D + L L LR PDF+TA RI   IN     R  R  AE  D+ TV V    N+  
Sbjct: 181 EFAFADLSTLRLALREPDFTTAARIEAAIN----RRVGRRAAEMLDAGTVSV----NLQQ 232

Query: 239 T------RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
           T      + +  +E L VE +  ARV++++R+GTIV+G++VRIS+V VS GNLT++I E 
Sbjct: 233 TGTGSPAQAVVAIENLPVEPERRARVVVDQRSGTIVMGEDVRISRVAVSQGNLTLRIEET 292

Query: 293 EQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP---DLNSLISGMNSIGLKTDGI 349
              VQPN F + G TV    T   + +  G   L + P    L+ +I+G+N++G+    +
Sbjct: 293 PIAVQPNPF-AEGETVIVPRTGADIVEEPG-IGLAEVPGGTSLSEVIAGLNALGVSPRDM 350

Query: 350 ISILQGIKAAGALQSEIII 368
           I IL+ IKAAGAL ++ ++
Sbjct: 351 IDILKSIKAAGALHADFLV 369


>gi|254477264|ref|ZP_05090650.1| flagellar P-ring protein FlgI [Ruegeria sp. R11]
 gi|214031507|gb|EEB72342.1| flagellar P-ring protein FlgI [Ruegeria sp. R11]
          Length = 367

 Score =  282 bits (721), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 160/373 (42%), Positives = 236/373 (63%), Gaps = 11/373 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + RI   + +L+ L  ++     R+KD+V     R N L+GYGLVVGL GTGD LR+SPF
Sbjct: 1   MMRIVRFLLALVLLPAMAQANAIRLKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNSPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE+ M ++L+ LG++  G +   KNVAAV VTA LPPFA  G  +DV+++++GD+ SL G
Sbjct: 61  TEEIMSNILERLGVNVTGEQFRPKNVAAVFVTATLPPFARVGGTVDVTVSAIGDSKSLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L  ADG IYAVAQG+++  G   +G+ +S  +G+ T G I +GA VERE+   
Sbjct: 121 GTLIMTPLNAADGQIYAVAQGTILAGGAVAEGEGASVTQGVPTAGVIPSGARVEREIDFD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVS-KPTNIDLT- 239
                 + L LR PDF+TA RI   IN+     F R +A   DS TV+V  + TN   T 
Sbjct: 181 LASLTSMRLALREPDFTTAGRIERAINA----EFGRSVALMRDSGTVEVDVQRTNARSTA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             +  +E + VE    ARV++++R+GTIV+G +VRIS+V V+ GNLT++I E   VVQPN
Sbjct: 237 HAVGRIENILVEPQRKARVVVDQRSGTIVMGSDVRISRVAVAQGNLTLRIEETPLVVQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPD---LNSLISGMNSIGLKTDGIISILQGI 356
            F S+G TV    T   + + +G   L + P+   L+ +++G+N++G+    +I IL+ +
Sbjct: 297 PF-SDGETVVVPRTGAAIDEEEG-IQLAEVPETTTLSEVVAGLNALGVSPRDMIDILKSL 354

Query: 357 KAAGALQSEIIIQ 369
           KAAGAL +E +++
Sbjct: 355 KAAGALHAEFVVR 367


>gi|254488985|ref|ZP_05102190.1| flagellar P-ring protein FlgI [Roseobacter sp. GAI101]
 gi|214045854|gb|EEB86492.1| flagellar P-ring protein FlgI [Roseobacter sp. GAI101]
          Length = 367

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 240/377 (63%), Gaps = 19/377 (5%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R   + F+LI L   +     RIKD+V     R+N L+GYGLVVGL G+GD LR++PF
Sbjct: 1   MIRGWLITFALIVLILPAYAGPVRIKDLVDFDGVRENDLVGYGLVVGLNGSGDGLRNAPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE  M ++L+ LG++  G +   KNVAAV+VTA LP FA  GS+IDV+++++GDA SL G
Sbjct: 61  TEDIMTNILERLGVNVTGEQFRPKNVAAVLVTATLPAFARTGSQIDVTVSAIGDAKSLMG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L  ADG+IYAVAQG+++  G   +G + + ++G+ T G I +GA VERE+  +
Sbjct: 121 GTLIMTPLNAADGDIYAVAQGTIIAGGAVAEGDAGAVIQGVPTSGVIPSGARVEREIDFQ 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL 241
               +DL L LR  DF+TA RI   IN      F R +A   DS TV++    NI+ TR+
Sbjct: 181 LSSLSDLRLALREGDFTTATRIERAINL----EFGREVAVMLDSGTVQL----NIERTRM 232

Query: 242 ------MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                 +  +E L+VE +  ARV++++R+GTIV+G++VRIS+V VS GNL ++I E   V
Sbjct: 233 PSVAHALGRIENLSVEPERKARVVVDQRSGTIVMGEDVRISRVAVSQGNLVLRIQEEPIV 292

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPD---LNSLISGMNSIGLKTDGIISI 352
           VQPN F + G T+    T   + +  G   L + P+   L+ +I G+N++G+    +I I
Sbjct: 293 VQPNPF-AEGETIIVPRTRAAIEEQPG-IGLAEIPNGTSLSEVIGGLNALGVSPRDMIDI 350

Query: 353 LQGIKAAGALQSEIIIQ 369
           L+ IKAAGAL +E +++
Sbjct: 351 LKSIKAAGALHAEFVVR 367


>gi|303248236|ref|ZP_07334499.1| flagellar P-ring protein [Desulfovibrio fructosovorans JJ]
 gi|302490374|gb|EFL50285.1| flagellar P-ring protein [Desulfovibrio fructosovorans JJ]
          Length = 383

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 227/345 (65%), Gaps = 8/345 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+ S+   R NQL+GYGLVVGL GTGD  R S FT QS+ ++L  +G+      L 
Sbjct: 42  ARIKDIASVSGMRRNQLVGYGLVVGLSGTGDQ-RGSDFTVQSIFNMLDKMGVRVDKATLK 100

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA +P  A PGSR+DV+++S+GDA+SL GG+L++T + G DGNIYA+AQGS
Sbjct: 101 PKNVAAVMVTAQMPVSARPGSRLDVTVSSIGDATSLLGGVLLVTPMKGVDGNIYAIAQGS 160

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+V G+  +G  +S  + I+T G +  GA VER +   F D ADL L LRNPDFSTA R+
Sbjct: 161 VLVGGVSAQGAGASVSKNITTVGLLPGGANVERAVAFSFNDQADLTLSLRNPDFSTATRV 220

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKP--TNIDLTRLMSEVEMLTVETDTPARVIIN 261
           A ++N          +A A D+ T++++ P     +L  LM+ +E + V  D  ARV+++
Sbjct: 221 AKRVNET----MGAAMATAIDAGTIRLAVPPENQGNLAPLMASIENIEVTPDHRARVVVD 276

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           E+TGT+V+G NV+IS V +++GNL +Q+ E+  V QP  F S G TV    T++ V++  
Sbjct: 277 EKTGTVVLGQNVQISPVAITHGNLQIQVQESADVSQPLPF-SGGQTVVTPQTNIGVTEEN 335

Query: 322 GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
               +I+   L  L+ G+N++G     +ISIL+ ++++GAL +++
Sbjct: 336 RKLKMIEGATLQELVEGLNALGATPRDLISILRTLESSGALAADL 380


>gi|163742562|ref|ZP_02149948.1| flagellar P-ring protein precursor I [Phaeobacter gallaeciensis
           2.10]
 gi|161384147|gb|EDQ08530.1| flagellar P-ring protein precursor I [Phaeobacter gallaeciensis
           2.10]
          Length = 367

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 160/373 (42%), Positives = 236/373 (63%), Gaps = 11/373 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R   ++F+++ L  ++     R+KD+V     R N L+GYGLVVGL GTGD LR+SPF
Sbjct: 1   MMRFIRILFAVMLLPAMAQANAIRLKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNSPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE+ M ++L+ LG++  G +   KNVAAV VTA LPPFA  G  +DV+++++GD+ SL G
Sbjct: 61  TEEIMSNILERLGVNVTGEQFRPKNVAAVFVTATLPPFARVGGTVDVTVSAIGDSKSLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G LVMT L  ADG IYAVAQG+++  G   +G+ +S  +G+ T G I +GA VERE+   
Sbjct: 121 GTLVMTPLNAADGQIYAVAQGTILAGGAVAEGEGASVTQGVPTAGVIPSGARVEREIDFD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVS-KPTNIDLT- 239
                 + L LR PDF+TA RI   IN+     F R +A   DS TV+V  + TN   T 
Sbjct: 181 LSSLTSMRLALREPDFTTAGRIERAINA----EFGRNVALMQDSGTVEVDVQRTNTRSTA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             +  +E + VE    ARV++++R+GTIV+G +VRIS+V V+ GNLT++I E   VVQPN
Sbjct: 237 HAVGRIENILVEPQRKARVVVDQRSGTIVMGSDVRISRVAVAQGNLTLRIEETPLVVQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSL---ISGMNSIGLKTDGIISILQGI 356
            F ++G TV    T   + + +G   L + P+  SL   ++G+N++G+    +I IL+ +
Sbjct: 297 PF-ADGETVIVPRTGAAIEEEEG-IQLAEVPETTSLSEVVAGLNALGVSPRDMIDILKSL 354

Query: 357 KAAGALQSEIIIQ 369
           KAAGAL +E +++
Sbjct: 355 KAAGALHAEFVVR 367


>gi|149203103|ref|ZP_01880074.1| flagellar P-ring protein precursor I [Roseovarius sp. TM1035]
 gi|149143649|gb|EDM31685.1| flagellar P-ring protein precursor I [Roseovarius sp. TM1035]
          Length = 372

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 162/369 (43%), Positives = 232/369 (62%), Gaps = 11/369 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           I  L  +L G+   ++ +  RIKD+V     R N L+GYGLVVGL GTGD LR++PFTE+
Sbjct: 11  IMALALALAGVTAAASPI--RIKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNAPFTEE 68

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            M ++L+ LGI+  G +   KNVAAV VTA LPPFA  GS+IDV+I+++GDA SL GG L
Sbjct: 69  IMSNILERLGINVSGEQFRPKNVAAVFVTAELPPFARAGSQIDVTISAIGDAKSLLGGTL 128

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           VMT L  ADG IYAVAQG+++  G+  +G +   ++G+ T G I +GA VERE+   F  
Sbjct: 129 VMTPLNAADGQIYAVAQGTIIAGGVAAQGDAGGVVQGVPTAGVIPSGARVEREIDFDFAG 188

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVK--VSKPTNIDLTRLM 242
              + L LR PDF+TA RI   IN     R  R  A   D+ TV+  +S+         +
Sbjct: 189 LDTIRLALREPDFTTAGRIETAIN----GRVGRDAAIMLDAGTVQLTLSRMRAASPAHAL 244

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            ++E + VE +  ARV++++R+GTIV+G +VRIS+V VS GNLT++I E   VVQPN F 
Sbjct: 245 GQIENILVEPERKARVVVDQRSGTIVMGQDVRISRVAVSQGNLTLRIQETPLVVQPNPF- 303

Query: 303 SNGSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           + G TV    T   + +    G   ++    L+ +I+G+N++G+    +I IL+ IKAAG
Sbjct: 304 AQGETVVVPRTQAGIEEEPGIGLAEVLPGTSLSEVIAGLNALGVAPRDMIDILKSIKAAG 363

Query: 361 ALQSEIIIQ 369
           AL +E +++
Sbjct: 364 ALHAEFVVR 372


>gi|260428977|ref|ZP_05782954.1| flagellar P-ring protein FlgI [Citreicella sp. SE45]
 gi|260419600|gb|EEX12853.1| flagellar P-ring protein FlgI [Citreicella sp. SE45]
          Length = 367

 Score =  279 bits (714), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 162/375 (43%), Positives = 238/375 (63%), Gaps = 17/375 (4%)

Query: 2   IFRIAFLIFSLIGL-HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           + R   +  +L GL H  SAQ V RIKD+V +   R N L+GYGLVVGL GTGD LR++P
Sbjct: 1   MLRSLIVCLALFGLMHPASAQSV-RIKDLVEVDGVRANDLVGYGLVVGLNGTGDGLRNAP 59

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTE+ M+++L+ LG++  G +   +NVAAV VT  LPPF   GS+IDV+++++GDA SL 
Sbjct: 60  FTEEIMQNILERLGVNVTGEQFRPRNVAAVFVTGRLPPFGRAGSQIDVTVSAIGDAKSLL 119

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT +  ADG IYAVAQG+V+  G+  +G ++  ++G+ T G I  GA +ERE+  
Sbjct: 120 GGTLIMTPMNAADGQIYAVAQGTVIAGGVEAQGDAARLVQGVPTSGVIPAGARIEREVDF 179

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEA----YDSRTVKVSKPTNI 236
            F   + L L LR PDF+TA RI + IN  S+ R +  + +A     D R    S P   
Sbjct: 180 DFTQLSSLRLALREPDFTTAARIENAIN-RSVGRGAAQMLDAGTVSVDLRRTGASSP--- 235

Query: 237 DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
              R +  +E L VE +  ARV++++R+GTIV+G++VRIS+V VS GNLT++I E    V
Sbjct: 236 --ARAVVAIENLPVEPERRARVVVDQRSGTIVMGEDVRISRVAVSQGNLTLRIEETPIAV 293

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP---DLNSLISGMNSIGLKTDGIISIL 353
           QP+ F + G TV    T  ++ +  G   L + P    L+ +++G+N++G+    +I IL
Sbjct: 294 QPSPF-AEGETVVVPRTGAEIVEEPG-IGLAEIPSGTSLSEVVAGLNALGVSPRDMIDIL 351

Query: 354 QGIKAAGALQSEIII 368
           + IKAAGAL +E ++
Sbjct: 352 KSIKAAGALHAEFVV 366


>gi|83595979|gb|ABC25339.1| flagellar P-ring protein [uncultured marine bacterium Ant24C4]
          Length = 369

 Score =  278 bits (712), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 155/376 (41%), Positives = 236/376 (62%), Gaps = 19/376 (5%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +  F+I     +   ++    R+KD+V     R N L+GYGLVVGL GTGD LR++PFT
Sbjct: 4   LKCVFIILLCWAIPVTASSTPIRLKDLVEFDGVRPNNLLGYGLVVGLNGTGDGLRNAPFT 63

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           E+ M ++L+ LG++  G +   KNVAAV+VTA+LPPFA  GS +DV+++++GDA+SL GG
Sbjct: 64  EEIMTNILERLGVNVTGEQFRPKNVAAVLVTASLPPFARAGSPMDVTVSAIGDATSLLGG 123

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L  ADG IYAVAQGS++  G+  +GQ +   +G+ T G + +GAI+ERE+   F
Sbjct: 124 TLIMTPLNAADGEIYAVAQGSIIAGGVTAEGQGARVTQGVPTAGVVPSGAIIEREVDFDF 183

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVS-------KPTN 235
                L L LR PDF+TA RI   IN+     F   +A   D+ TV++         P +
Sbjct: 184 TGLTSLRLALRTPDFTTAARIEQAINAT----FGNQVALMLDAGTVQIDIVGTQARSPAH 239

Query: 236 IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                 + ++E + VE +  ARV+I++R+GTIV+GD+VRIS+V VS G LT++I E   V
Sbjct: 240 -----ALGQIENILVEPERRARVVIDQRSGTIVMGDDVRISRVAVSQGGLTLRIEEAPLV 294

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISIL 353
            QPN FS  G T+    T++ + + +  G   + +   L+ +++G+N++G+    +I IL
Sbjct: 295 SQPNPFSP-GETLIVPRTNVGIEEEQGIGLAEIREGTSLSEVVAGLNALGVAPRDMIDIL 353

Query: 354 QGIKAAGALQSEIIIQ 369
           + IKA+GAL +E I++
Sbjct: 354 KSIKASGALHAEFIVR 369


>gi|114797455|ref|YP_758978.1| flagellar basal body P-ring protein [Hyphomonas neptunium ATCC
           15444]
 gi|114737629|gb|ABI75754.1| flagellar P-ring protein FlgI [Hyphomonas neptunium ATCC 15444]
          Length = 369

 Score =  278 bits (712), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 150/355 (42%), Positives = 234/355 (65%), Gaps = 8/355 (2%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
           + A   +RI+DVV +Q  R+N L+GYG+VVGL GTGD++R+SPFTE S+  LL+ LG++ 
Sbjct: 20  LPADAQARIRDVVDVQGVRENDLVGYGIVVGLNGTGDTVRNSPFTEDSLTHLLERLGVNV 79

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
            G ++  KNVAAV+VTA+LPPF+  GS IDV+I S+GDA+SL GG L++T L   D  IY
Sbjct: 80  QGEQIKPKNVAAVLVTASLPPFSRKGSSIDVNIASIGDATSLEGGTLILTPLKAGDNEIY 139

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           AVAQGS++VSG+ VK Q +    G  T G + NGA VERE+   F  +  + L LR+PDF
Sbjct: 140 AVAQGSIIVSGIDVKAQGARETRGSPTTGSVPNGAKVEREVNYDFNRNELISLALRSPDF 199

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVS-KPTNIDLTRLMSEVEMLTVETDTPA 256
           +TA RI D IN+        P+A   D  T+++  +  +    RL++ +E L+VE  +PA
Sbjct: 200 TTAARIEDTINAA----LGVPLASMRDPGTIELDLRGISESPARLLASIENLSVEVASPA 255

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           R++I+E++GTIV+G++V IS+V ++ GN+ +++ E     QPN F+   S V   +    
Sbjct: 256 RIVIDEKSGTIVLGEDVTISRVAIAQGNIAIKVRETPVASQPNPFARGESMVLPRSEITI 315

Query: 317 VSDNKGSFSLIDAPD--LNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                 + +++D P+  L+ LI+G+N++G+    +  I++ +KAAGA+ ++++I+
Sbjct: 316 TQTGNSNIAMLD-PNVTLSQLIAGLNALGVSPQEMADIIRSMKAAGAIHADLVIR 369


>gi|317153841|ref|YP_004121889.1| flagellar P-ring protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316944092|gb|ADU63143.1| flagellar P-ring protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 383

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 149/345 (43%), Positives = 225/345 (65%), Gaps = 8/345 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +R+KD+ S    R N L+GYGLVVGL GTGD   SS FT QSM ++LQ +G+     +L 
Sbjct: 42  ARLKDIASFSGVRTNDLVGYGLVVGLSGTGDG-TSSTFTLQSMSNMLQKMGVEADPSKLK 100

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAA MVTA LP  A PGS IDV+++SLGDA SL GG+L++T L G DG +YAV+QG 
Sbjct: 101 PKNVAAAMVTARLPVSAKPGSTIDVTVSSLGDAKSLLGGVLLLTPLKGLDGQVYAVSQGP 160

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + + G  V G++++  + I T G+I NGA+VER++P KF +   + L L   DFST +++
Sbjct: 161 LTIGGFTVAGEAATAQKNIPTVGRIPNGAVVERDVPFKFNNQDSMTLNLSVHDFSTTMQV 220

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIIN 261
            ++IN+     F    A A D  TV+++ P     ++  LM+ +E L +  D  ARV+++
Sbjct: 221 VNKINATMGGSF----ASARDISTVELALPERYLGNMVPLMASLENLDISPDGRARVVVD 276

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           E+TGT+V+G +VR+S+V V++GNL + I+E++ V QP  F S+G TV    TD+ + +  
Sbjct: 277 EKTGTVVLGHDVRLSRVAVAHGNLQIVISESQDVSQPGPF-SDGQTVVTPRTDMAIEEQN 335

Query: 322 GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
               L++   L+ L+ G+NSIG     +ISI++ +KAAG+L +++
Sbjct: 336 NPLMLMEGATLHELVDGLNSIGATPRDLISIIRALKAAGSLHADV 380


>gi|114777908|ref|ZP_01452822.1| flagellar P-ring protein precursor I [Mariprofundus ferrooxydans
           PV-1]
 gi|114551695|gb|EAU54247.1| flagellar P-ring protein precursor I [Mariprofundus ferrooxydans
           PV-1]
          Length = 372

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 162/373 (43%), Positives = 233/373 (62%), Gaps = 15/373 (4%)

Query: 1   MIFRIAFL---IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLR 57
           M FR  FL     S++ +  + AQ   RIKD+  ++  R N L+GYGLVVGL GTGDS  
Sbjct: 5   MSFRPLFLPAIALSML-MMPLMAQA-ERIKDLADIEGVRGNALVGYGLVVGLNGTGDSGT 62

Query: 58  SSPFTEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGD 115
           SSPFT  S+ ++L+ LG++      ++  KN+AAVMVT+ LP FA PG ++DV+++S+GD
Sbjct: 63  SSPFTISSITAMLERLGVNVRADITKMKPKNIAAVMVTSELPAFARPGQQLDVTVSSIGD 122

Query: 116 ASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVE 175
           A  LRGG L++T LLG DG  YAVAQG +   G  + G+S+S  +G  T  ++ NGA VE
Sbjct: 123 AKDLRGGTLLVTPLLGGDGRPYAVAQGGLSTGGFSIAGKSASTTKGHPTAARVPNGARVE 182

Query: 176 RELPKKFKDSADLI-LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT 234
           R  P+      D I L L NPDF+TA  + D IN+    R    +A A DS TV+V  P 
Sbjct: 183 RAAPRGLSADQDKISLNLHNPDFTTAKNMQDAINA----RLGNGMARAIDSGTVQVWNP- 237

Query: 235 NIDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQ 294
           N +   L++ +E + +  D  A VI++ERTGTIV+G  VRI  V V++GN++V ITEN Q
Sbjct: 238 NSNAVELIARLEQIDIPLDHAAVVIVDERTGTIVMGQEVRIDTVAVAHGNISVSITENPQ 297

Query: 295 VVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISIL 353
           V QPNAF   G T T + + + V +++    ++     L+ L++ +N++G     +I++L
Sbjct: 298 VSQPNAF-GGGQTTTVDRSKVNVQEDEAKLVVLPKQVSLSKLVTALNAVGATPSDLIAVL 356

Query: 354 QGIKAAGALQSEI 366
           Q IKAAGAL +E+
Sbjct: 357 QAIKAAGALHAEL 369


>gi|209545543|ref|YP_002277772.1| flagellar basal body P-ring protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533220|gb|ACI53157.1| flagellar P-ring protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 386

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 161/373 (43%), Positives = 237/373 (63%), Gaps = 11/373 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++  +A L+  +  +     + V RIKD+V  +  RDNQL+GYGLVVGL G+GD L ++ 
Sbjct: 21  LLAAVALLVTGMAPMSSARGEQV-RIKDIVDYEGVRDNQLVGYGLVVGLNGSGDRLTNTI 79

Query: 61  FTEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           FT +++ S+L  LG++      +L + +VAAVMVTA LPPF+  G  IDV+++++GDA +
Sbjct: 80  FTRETLISMLNRLGVNIRDREIQLQTHDVAAVMVTATLPPFSHGGGHIDVTVSAVGDARA 139

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           L GG L++T L  ADG +YAVAQGS+V +     GQ+++    I T G I NG +VERE+
Sbjct: 140 LTGGTLLVTPLQAADGEVYAVAQGSLVTNAFTATGQAANVTRNIPTSGHIANGGVVEREV 199

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL 238
           P    +   + L L NP+F+TA RIAD INS+      R IA   D RTV V+  T  D 
Sbjct: 200 PVMLGEKGFIRLSLYNPNFTTATRIADAINSH----IGRGIARVDDPRTVAVNL-TGRDP 254

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           ++ +  +  L +E DT A+V+++E +GTIV+GDNVRI+ V ++ GNLT+QITE  Q V P
Sbjct: 255 SQTLYRIGDLLIEPDTMAKVVVDEASGTIVMGDNVRITTVAIAQGNLTIQITETPQAV-P 313

Query: 299 NAFSSNGSTVTQNNTDLKVS-DNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGI 356
            A  +NG T     T +  S D+     ++ + P L SL+ GMN++G+    +ISILQ I
Sbjct: 314 AAPFTNGQTAVVPRTQITASTDSTHRLGILREGPTLASLVGGMNALGMGPRDMISILQAI 373

Query: 357 KAAGALQSEIIIQ 369
           KA GALQ+++ ++
Sbjct: 374 KADGALQADLEVR 386


>gi|254510781|ref|ZP_05122848.1| flagellar P-ring protein FlgI [Rhodobacteraceae bacterium KLH11]
 gi|221534492|gb|EEE37480.1| flagellar P-ring protein FlgI [Rhodobacteraceae bacterium KLH11]
          Length = 364

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 160/367 (43%), Positives = 236/367 (64%), Gaps = 9/367 (2%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L F LI L         R+KD+V     R N L+GYGLVVGL GTGD LR+SPFTE+ M
Sbjct: 3   ILAFLLILLPCTVTAGAIRLKDLVDFDGVRGNDLVGYGLVVGLNGTGDGLRNSPFTEEIM 62

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
            ++L+ LG++  G     KNVAAV+VTA+LPPF+  GS+IDV+++++GD++SL GG L+M
Sbjct: 63  SNILERLGVNVNGEDFRPKNVAAVLVTASLPPFSRVGSQIDVTVSAIGDSNSLLGGTLIM 122

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L  ADG IYAVAQGSV+  G   +G++++ ++G+ T G I +GA VERE+  +     
Sbjct: 123 TPLNAADGQIYAVAQGSVLAGGASAEGEAATVVQGVPTSGMIPSGARVEREIDFELSALT 182

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVK--VSKPTNIDLTRLMSE 244
            L L LR PDF+TA RI   INS     F+R +A   DS TV+  ++   +      +  
Sbjct: 183 RLRLALREPDFTTAGRIETAINS----EFNRAVAIMRDSGTVELNIAATQSASTAHAIGR 238

Query: 245 VEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           +E + VE ++ ARV++++R+GTIV+G +VRIS+V VS GNLT+ + E    VQPN F + 
Sbjct: 239 IENILVEPESKARVVVDQRSGTIVMGRDVRISRVAVSQGNLTLTVEEAPIAVQPNPF-AR 297

Query: 305 GSTVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           G TV    T   + + +G+    + +A  L+ +++G+N++G+    +I IL+ IKAAGAL
Sbjct: 298 GETVVVPRTVAGIEEEEGTGLAEIPEATTLSEVVAGLNALGVSPRDMIDILKTIKAAGAL 357

Query: 363 QSEIIIQ 369
            +E I++
Sbjct: 358 HAEFIVR 364


>gi|163738042|ref|ZP_02145458.1| flagellar P-ring protein [Phaeobacter gallaeciensis BS107]
 gi|161388658|gb|EDQ13011.1| flagellar P-ring protein [Phaeobacter gallaeciensis BS107]
          Length = 367

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 159/373 (42%), Positives = 235/373 (63%), Gaps = 11/373 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R   ++ +++ L  ++     R+KD+V     R N L+GYGLVVGL GTGD LR+SPF
Sbjct: 1   MMRFIRILLAVMLLPAMAQANAIRLKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNSPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE+ M ++L+ LG++  G +   KNVAAV VTA LPPFA  G  +DV+++++GD+ SL G
Sbjct: 61  TEEIMSNILERLGVNVTGEQFRPKNVAAVFVTATLPPFARVGGTVDVTVSAIGDSKSLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G LVMT L  ADG IYAVAQG+++  G   +G+ +S  +G+ T G I +GA VERE+   
Sbjct: 121 GTLVMTPLNAADGQIYAVAQGTILAGGAVAEGEGASVTQGVPTAGVIPSGARVEREIDFD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVS-KPTNIDLT- 239
                 + L LR PDF+TA RI   IN+     F R +A   DS TV+V  + TN   T 
Sbjct: 181 LSSLTSMRLALREPDFTTAGRIERAINA----EFGRNVALMQDSGTVEVDVQRTNTRSTA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             +  +E + VE    ARV++++R+GTIV+G +VRIS+V V+ GNLT++I E   VVQPN
Sbjct: 237 HAVGRIENILVEPQRKARVVVDQRSGTIVMGSDVRISRVAVAQGNLTLRIEETPLVVQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSL---ISGMNSIGLKTDGIISILQGI 356
            F ++G TV    T   + + +G   L + P+  SL   ++G+N++G+    +I IL+ +
Sbjct: 297 PF-ADGETVIVPRTGAAIEEEEG-IQLAEVPETTSLSEVVAGLNALGVSPRDMIDILKSL 354

Query: 357 KAAGALQSEIIIQ 369
           KAAGAL +E +++
Sbjct: 355 KAAGALHAEFVVR 367


>gi|162147433|ref|YP_001601894.1| flagellar basal body P-ring protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786010|emb|CAP55592.1| putative flagellar P-ring protein precursor (Basal body P-ring
           protein) [Gluconacetobacter diazotrophicus PAl 5]
          Length = 390

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 158/349 (45%), Positives = 227/349 (65%), Gaps = 10/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--RL 82
           RIKD+V  +  RDNQL+GYGLVVGL G+GD L ++ FT +++ S+L  LG++      +L
Sbjct: 48  RIKDIVDYEGVRDNQLVGYGLVVGLNGSGDRLTNTIFTRETLISMLNRLGVNIRDREIQL 107

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            + +VAAVMVTA LPPF+  G  IDV+++++GDA +L GG L++T L  ADG +YAVAQG
Sbjct: 108 QTHDVAAVMVTATLPPFSHGGGHIDVTVSAVGDARALTGGTLLVTPLQAADGEVYAVAQG 167

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           S+V +     GQ+++    I T G I NG +VERE+P    +   + L L NP+F+TA R
Sbjct: 168 SLVTNAFTATGQAANVTRNIPTSGHIANGGVVEREVPVMLGEKGFIRLSLYNPNFTTATR 227

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           IAD INS+      R IA   D RTV V+  T  D ++ +  +  L +E DT A+V+++E
Sbjct: 228 IADAINSH----IGRGIARVDDPRTVAVNL-TGRDPSQTLYRIGDLLIEPDTMAKVVVDE 282

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS-DNK 321
            +GTIV+GDNVRI+ V ++ GNLT+QITE  Q V P A  +NG T     T +  S D+ 
Sbjct: 283 ASGTIVMGDNVRITTVAIAQGNLTIQITETPQAV-PAAPFTNGQTAVVPRTQITASTDST 341

Query: 322 GSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
               ++ + P L SL+ GMN++G+    +ISILQ IKA GALQ+++ ++
Sbjct: 342 HRLGILREGPTLASLVGGMNALGMGPRDMISILQAIKADGALQADLEVR 390


>gi|322421659|ref|YP_004200882.1| flagellar P-ring protein [Geobacter sp. M18]
 gi|320128046|gb|ADW15606.1| flagellar P-ring protein [Geobacter sp. M18]
          Length = 371

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 156/346 (45%), Positives = 221/346 (63%), Gaps = 9/346 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+ +    R NQLIGYGLVVGL GTGDS ++  F  QS+   L+ +G++     + 
Sbjct: 29  ARIKDIAAFDGVRQNQLIGYGLVVGLNGTGDSDQTK-FPVQSLVGALERMGLTVSRNDIT 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LPPFA  G+R+DV ++SLGD+ SL GG L+M  L GADG +YAVAQG+
Sbjct: 88  VKNVAAVMVTAQLPPFAKQGNRLDVLVSSLGDSKSLAGGTLMMAPLKGADGQVYAVAQGA 147

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+ +     GQ++S ++   T G +  GA+VERELP    +   L L L   DF+TA R+
Sbjct: 148 VLTNSFSYGGQATSAVKNHPTAGTVPEGALVERELPNVLANRQGLKLNLHQSDFTTAARV 207

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTPARVIIN 261
           A  IN     RF    A   D  +V+++ P      +   ++++E L V  D  A+V++N
Sbjct: 208 AAAING----RFQGS-ASLSDPGSVQIAIPAEYQNRVVEFVADLERLEVNPDVMAKVVMN 262

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           ERTGTIV+G+NVRIS V VS+GNLTV + E  +V QP  FS  G+T     TDLK+S+ K
Sbjct: 263 ERTGTIVMGENVRISTVAVSHGNLTVVVKETPRVSQPAPFSKTGTTTVVPRTDLKISEEK 322

Query: 322 GSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            + SL+ +  +L  ++ G+N++G+    ++ I+Q IKAAGAL +E+
Sbjct: 323 VNLSLVREGANLGEVVRGLNTLGVTPRDLLGIMQAIKAAGALNAEL 368


>gi|95929877|ref|ZP_01312618.1| flagellar P-ring protein [Desulfuromonas acetoxidans DSM 684]
 gi|95134173|gb|EAT15831.1| flagellar P-ring protein [Desulfuromonas acetoxidans DSM 684]
          Length = 368

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 160/370 (43%), Positives = 235/370 (63%), Gaps = 12/370 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           I  IA ++FSL      S  + SRIKD+  ++  R NQL+GYGLVVGL GTGDS  S+ F
Sbjct: 7   IVIIALVLFSL----SCSTGLASRIKDLADIEGVRTNQLVGYGLVVGLNGTGDS-SSTEF 61

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T QS+ ++++ LG+     ++   NVAAVMVTA LP FA  GS IDV ++S+GDA SL G
Sbjct: 62  TIQSLVNMMERLGMRVERDKVKVDNVAAVMVTAELPAFAKAGSAIDVLVSSIGDADSLVG 121

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L   DGN+YAVAQG++ V  L   G+++   +   T G+I +GAIVERE+P +
Sbjct: 122 GTLLMTPLKAPDGNVYAVAQGALAVGALSFGGKAAKVQKNHPTVGRIPSGAIVEREVPFR 181

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVK--VSKPTNIDLT 239
             ++  L  +LR  DF+T  R+AD +N Y    F +P+A A DS +++  V+      L 
Sbjct: 182 LPENRALNYRLRTADFTTVSRMADVVNGY----FGQPLAHALDSGSLQVIVADEYADSLV 237

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             ++ VE L V+ D  A++I+NER+GTIV+G++VR+S V VS+GNL + I ++  V QP+
Sbjct: 238 EFIARVEHLEVQPDMIAKIIVNERSGTIVMGEHVRLSTVAVSHGNLNLVINDSALVSQPS 297

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKA 358
             S  G+TV    TD+ VS+++G+  ++     +  +   +N+IG     +I+I Q IKA
Sbjct: 298 PLSETGNTVEVPQTDISVSEDRGNLVVLPMGVSIGDVARALNAIGATPRDLIAIFQAIKA 357

Query: 359 AGALQSEIII 368
           AGAL +E+ I
Sbjct: 358 AGALHAELEI 367


>gi|83944169|ref|ZP_00956625.1| flagellar P-ring protein precursor [Sulfitobacter sp. EE-36]
 gi|83845036|gb|EAP82917.1| flagellar P-ring protein precursor [Sulfitobacter sp. EE-36]
          Length = 393

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 159/360 (44%), Positives = 223/360 (61%), Gaps = 20/360 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR-LG 83
           RIKD+   +  R+N LIGYGLVVGL GTGD L SSPFT +S+R +L+ LG++   G  L 
Sbjct: 37  RIKDIAHFEGVRENHLIGYGLVVGLLGTGDKLNSSPFTRESIRGMLERLGVANLDGEALK 96

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KN AAVMVTA LPPFA  GS ID++++SLGDA+SLRGG L++T L GADG +YAV QG+
Sbjct: 97  TKNTAAVMVTAKLPPFARRGSPIDITVSSLGDATSLRGGTLLITPLTGADGEVYAVGQGA 156

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V  SG  V G ++S ++G+ T  +I NGAIVERE+         + + L NPDF+TA R+
Sbjct: 157 VAASGYRVDGNAASVVDGVPTIARIENGAIVEREIEFSLFQLDSIRIALNNPDFTTADRV 216

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
            + I  +          E  DS T++V      +    +  VE L V  D  ARV+I+E+
Sbjct: 217 REAIAKH----LGSSQVEVLDSGTIEVWVGDKRNAPETIMAVENLLVTPDAVARVVIDEK 272

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP--------------NAFSSNGSTVT 309
           +GTIV+G +VRI++V +S G LTV++ EN  V QP                 S  G+TV 
Sbjct: 273 SGTIVMGSDVRIAQVAISQGGLTVRVRENFGVSQPGPISLGGNTAVISEEPISIGGTTVI 332

Query: 310 QNNTDLKVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              T++ + +  GSF++++    L  L+ G+N+IG+     I+ILQ IKAAGAL +++ I
Sbjct: 333 VPETEIDIEETDGSFTILNGDVSLQELVDGLNAIGVGARQTIAILQAIKAAGALHADLEI 392


>gi|288940413|ref|YP_003442653.1| flagellar P-ring protein [Allochromatium vinosum DSM 180]
 gi|288895785|gb|ADC61621.1| flagellar P-ring protein [Allochromatium vinosum DSM 180]
          Length = 392

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 153/349 (43%), Positives = 224/349 (64%), Gaps = 10/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+ ++   RDNQLIGYGLVVGL GTGD    +PF+ QS++++L  LG++ P G    
Sbjct: 48  RIKDLATIAGVRDNQLIGYGLVVGLDGTGDQTTQAPFSTQSLKNMLSQLGVTIPEGVNPQ 107

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KN+AAVM+TA+LPPFA PG R+D++++SLG+A SLRGG L+MT L GADG +YA+AQG+
Sbjct: 108 TKNMAAVMITADLPPFAKPGQRMDITVSSLGNAKSLRGGTLLMTPLKGADGQVYAIAQGN 167

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           + V G    G   S +   + + G++ NGA VERE+P  F     L L LR PDF+TA R
Sbjct: 168 LTVGGFGAGGADGSRITVNVPSVGRVPNGATVEREVPTSFSQGDHLTLNLRRPDFTTAYR 227

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVE-TDTPARVII 260
           + D INS    RF   +A++ D  +V+V  P + +     +S +E LT+E  + PARV+I
Sbjct: 228 MVDVINS----RFGDDVAQSIDGSSVQVRAPRDPNQRVAFVSMLENLTLEAAEPPARVVI 283

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTGTIV+G  V +    +S+GNLTV I+EN  V QP A +  G T     TD+ +  +
Sbjct: 284 NARTGTIVMGAGVTVRPAAISHGNLTVTISENPAVSQPGALAG-GQTAVVPQTDVAIEQD 342

Query: 321 KGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           K    L +    L  ++  +N +G     +++IL+ ++ AGAL++E+++
Sbjct: 343 KNRMFLFEPGTALGDIVEAVNEVGAAPGDLVAILEALREAGALRAELVV 391


>gi|85706145|ref|ZP_01037240.1| flagellar P-ring protein precursor [Roseovarius sp. 217]
 gi|85669309|gb|EAQ24175.1| flagellar P-ring protein precursor [Roseovarius sp. 217]
          Length = 370

 Score =  276 bits (705), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 153/348 (43%), Positives = 219/348 (62%), Gaps = 7/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+V     R N L+GYGLVVGL GTGD LR++PFTE+ M ++L+ LGI+  G +   
Sbjct: 27  RIKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNAPFTEEIMSNILERLGINVSGEQFRP 86

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAV VTA LPPFA  G +IDV+++++GDA SL GG LVMT L  ADG IYAVAQG++
Sbjct: 87  KNVAAVFVTAELPPFARAGGQIDVTVSAIGDAKSLLGGTLVMTPLNAADGQIYAVAQGTI 146

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +  G   +G++   ++G+ T G I +GA VERE+   F     + L LR PDF+TA RI 
Sbjct: 147 IAGGFSAEGEAGGVVQGVPTAGVIPSGARVEREIDFDFTTIETIRLALREPDFTTAARIE 206

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVK--VSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
             IN        R  A   DS TV+  +S+         + ++E + VE +  ARV++++
Sbjct: 207 SAINGT----IGRDAAIMLDSGTVRLTLSRMRAASPAHALGQIENILVEPERKARVVVDQ 262

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT-QNNTDLKVSDNK 321
           R+GTIV+G +VRIS+V VS GNLT+++ E   VVQPN F+   + V  +   + +     
Sbjct: 263 RSGTIVMGQDVRISRVAVSQGNLTLRVQETPLVVQPNPFAQGETVVVPRTQAEFEKEPGI 322

Query: 322 GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           G   L     L+ +I+G+N++G+    +I IL+ IKAAGAL +E +++
Sbjct: 323 GMAELEPGTSLSDVIAGLNALGVAPRDMIDILKSIKAAGALHAEFVVR 370


>gi|254420498|ref|ZP_05034222.1| flagellar P-ring protein FlgI [Brevundimonas sp. BAL3]
 gi|196186675|gb|EDX81651.1| flagellar P-ring protein FlgI [Brevundimonas sp. BAL3]
          Length = 380

 Score =  276 bits (705), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 162/361 (44%), Positives = 232/361 (64%), Gaps = 11/361 (3%)

Query: 10  FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSL 69
           F+ +GL    A   SRIKD+ +++  R NQL+GYG+V+GL GTGDSLR+ PFT QS+  +
Sbjct: 24  FAALGLVASPALAQSRIKDIAAVEGVRGNQLVGYGMVMGLNGTGDSLRNCPFTRQSLEGM 83

Query: 70  LQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSL 129
            + LG++  G    +KN+AAVMV+A LP FA+PGSRIDV+++S+ DA SL GG LV+TSL
Sbjct: 84  TERLGVNIRGANANTKNMAAVMVSAELPAFATPGSRIDVNVSSMCDAKSLLGGALVVTSL 143

Query: 130 LGADGNIYAVAQGSV-VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADL 188
            GADG +YAVAQGSV   +     G  SS   G+ T G+I +GA VERE   +  +  ++
Sbjct: 144 QGADGQVYAVAQGSVQTGAVSASGGSGSSVTRGVPTAGRIASGASVERETGFEMSNMNEV 203

Query: 189 ILQLRNPDFSTAIRIADQINSYSLNRFSRP-IAEAYDSRTVKVSKPTNIDLTRLMSEVEM 247
            L LRNPDF+TA R+A  +N+      + P  A A +   V +  P  + +   +S VE 
Sbjct: 204 RLNLRNPDFTTAQRVAAVVNA------AYPGTALAENGTVVTLRAPGQLGMAGFISRVEN 257

Query: 248 LTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGST 307
           L V  D+PA+VII+E  G IV+GD VRIS+V ++ GNLT+ + E   V QP  F S G T
Sbjct: 258 LAVTVDSPAKVIIDEVNGVIVMGDAVRISRVAIAQGNLTISVDEQLSVSQPAPF-SQGQT 316

Query: 308 VTQNNTDLKVSDNKGSFSLI--DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSE 365
               ++ + V ++ G+   I      L++L++G+N++G+    +ISILQ IKA+GALQ++
Sbjct: 317 AVIPDSQVSVEEDLGTQMRIVGGGTSLSTLVNGLNALGVSPRDMISILQAIKASGALQAD 376

Query: 366 I 366
           I
Sbjct: 377 I 377


>gi|83955131|ref|ZP_00963787.1| flagellar P-ring protein FlgI [Sulfitobacter sp. NAS-14.1]
 gi|83840460|gb|EAP79633.1| flagellar P-ring protein FlgI [Sulfitobacter sp. NAS-14.1]
          Length = 385

 Score =  276 bits (705), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 159/360 (44%), Positives = 223/360 (61%), Gaps = 20/360 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR-LG 83
           RIKD+   +  R+N LIGYGLVVGL GTGD L SSPFT +S+R +L+ LG++   G  L 
Sbjct: 29  RIKDIAHFEGVRENHLIGYGLVVGLLGTGDKLNSSPFTRESIRGMLERLGVANLDGEALK 88

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KN AAVMVTA LPPFA  GS ID++++SLGDA+SLRGG L++T L GADG +YAV QG+
Sbjct: 89  TKNTAAVMVTAKLPPFARRGSPIDITVSSLGDATSLRGGTLLITPLTGADGEVYAVGQGA 148

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V  SG  V G ++S ++G+ T  +I NGAIVERE+         + + L NPDF+TA R+
Sbjct: 149 VAASGYRVDGNAASVVDGVPTIARIENGAIVEREIEFSLFQLDSIRIALNNPDFTTADRV 208

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
            + I  +          E  DS T++V      +    +  VE L V  D  ARV+I+E+
Sbjct: 209 REAIAKH----LGSSQVEVLDSGTIEVWVGDKRNAPETIMAVENLLVTPDAVARVVIDEK 264

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP--------------NAFSSNGSTVT 309
           +GTIV+G +VRI++V +S G LTV++ EN  V QP                 S  G+TV 
Sbjct: 265 SGTIVMGSDVRIAQVAISQGGLTVRVRENFGVSQPGPISLGGNTAVISEEPISIGGTTVI 324

Query: 310 QNNTDLKVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              T++ + +  GSF++++    L  L+ G+N+IG+     I+ILQ IKAAGAL +++ I
Sbjct: 325 VPETEIDIEETDGSFTILNGDVSLQELVDGLNAIGVGARQTIAILQAIKAAGALHADLEI 384


>gi|304321123|ref|YP_003854766.1| flagellar P-ring protein precursor [Parvularcula bermudensis
           HTCC2503]
 gi|303300025|gb|ADM09624.1| flagellar P-ring protein precursor [Parvularcula bermudensis
           HTCC2503]
          Length = 367

 Score =  275 bits (703), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 155/353 (43%), Positives = 226/353 (64%), Gaps = 9/353 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           SA+V   ++D+V ++  R N LIGYGLVVGL GTGD++R+SP+TE+++ SLLQ LG++  
Sbjct: 22  SAEVA--LRDLVDVEGVRGNDLIGYGLVVGLNGTGDTVRNSPYTEEALASLLQRLGVNVQ 79

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
                  NVAAVMVTA LP FA  GS IDV+++S+GDA  L GG LVMT L  A+G++YA
Sbjct: 80  DEDFRPDNVAAVMVTAELPAFARTGSEIDVTVSSIGDADDLTGGTLVMTPLTAANGDVYA 139

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           VAQG V+VSG   +G+++S  +G  T G I  GA VERE+   F     + L L+ PDF+
Sbjct: 140 VAQGPVLVSGFQAEGEAASITQGTPTAGTIPAGARVEREVDFAFGRMQTINLALKTPDFT 199

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARV 258
           TA RI D +N+    R     A   D  TV+++ P+  +  R++SE+E + +    PARV
Sbjct: 200 TAARIEDALNA----RLGAGAATITDPGTVQLTLPSGRNPARVLSEIEQMAIRPSAPARV 255

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           +I++R+GTIV+G  VR+S V ++ GNL++ I E     QPNAF   G T     T + V+
Sbjct: 256 VIDQRSGTIVLGSAVRLSSVGIAQGNLSIAIAETPVASQPNAF-GEGETAILPRTTINVN 314

Query: 319 DNK-GSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +   G+ +LI+    L  L+S +N++G+     I IL+ +K AGAL +E+++Q
Sbjct: 315 EGATGNVALIEETVSLADLVSALNALGVTPRETIDILKSLKVAGALHAELMLQ 367


>gi|307823535|ref|ZP_07653764.1| flagellar P-ring protein [Methylobacter tundripaludum SV96]
 gi|307735520|gb|EFO06368.1| flagellar P-ring protein [Methylobacter tundripaludum SV96]
          Length = 367

 Score =  275 bits (703), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 161/366 (43%), Positives = 226/366 (61%), Gaps = 13/366 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           ++  L+G+         RIKD+ S++  R NQL+GYGLVVGL  +GD    + FT QS+R
Sbjct: 9   ILLLLLGIAVSGPVCAERIKDIASIEGVRSNQLVGYGLVVGLDKSGDK---TTFTGQSLR 65

Query: 68  SLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           S+L  LGI+ P G    SKN+AAV V A LPPFA  G  IDV+++SLGDA SLRGG L+M
Sbjct: 66  SMLTRLGITLPPGLDPKSKNIAAVSVQAELPPFAKSGQAIDVTVSSLGDAKSLRGGSLLM 125

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           + L GADG +YA+AQGS+VVSGL   GQ  SS        G+I NGAIVER +   F + 
Sbjct: 126 SPLKGADGQVYAIAQGSLVVSGLSASGQDGSSVTVNNPNVGRIPNGAIVERTVSTSFSEG 185

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEV 245
             L+  L +PDF+TA R+A+ IN           A+A D+ +V+V+ P + +     + V
Sbjct: 186 DALVFNLHSPDFTTANRMAESINRV----LGTNTAKAIDATSVRVNAPVDPNQKVTFASV 241

Query: 246 --EMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
              M+    D PARVI+N RTGT+V+   VR+    VS+G+LTV ITEN QV QPNA  S
Sbjct: 242 VENMMVTPDDAPARVIVNSRTGTVVVNGKVRVQPAAVSHGSLTVTITENPQVSQPNAL-S 300

Query: 304 NGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           NG TV    +++KV + K   F       L+ ++  +N++G     +++IL+ +K+AG+L
Sbjct: 301 NGQTVVTPKSNIKVEEEKNHMFVFNPGVSLDEIVQAVNNVGAAPSDLVAILEALKSAGSL 360

Query: 363 QSEIII 368
            +E+I+
Sbjct: 361 HAELIV 366


>gi|77918757|ref|YP_356572.1| flagellar basal body P-ring protein [Pelobacter carbinolicus DSM
           2380]
 gi|115311527|sp|Q3A5F5|FLGI_PELCD RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|77544840|gb|ABA88402.1| P-ring of flagella basal body-like protein [Pelobacter carbinolicus
           DSM 2380]
          Length = 367

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 152/348 (43%), Positives = 231/348 (66%), Gaps = 9/348 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+  LQ  R NQL+GYGLVVGL G+GDS  S+ FT +S+ ++++ LG++     + 
Sbjct: 25  TRIKDIARLQGVRSNQLVGYGLVVGLNGSGDS-DSTAFTVRSLVNMMERLGVTVDVNDVK 83

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
             NVAAV+VTA LP F+  GS IDV ++S+GDA SL GG L+MT L GADG IYAVAQG 
Sbjct: 84  VDNVAAVIVTAELPAFSKTGSTIDVLVSSIGDADSLVGGSLLMTPLKGADGKIYAVAQGP 143

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + V  L   G++++  +   T G+I  GA+VERE+P +    A+L  QL NPDF+T  R+
Sbjct: 144 LAVGALAFGGKAATVQKNHPTVGRIPGGALVEREVPFRLTPGAELHYQLTNPDFTTVTRM 203

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIIN 261
           A  IN +    F + +A A DS ++K++ P +   +    ++++E L +  D+ AR+++N
Sbjct: 204 AQAINKH----FQKTLARAEDSGSLKITIPEDQQNEPIHFIADLESLNIRPDSMARIVVN 259

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           E+TGTIV+G++VRI+ V VS+GNL + I+EN+QV QP  FS  G TV   +T ++VS++ 
Sbjct: 260 EKTGTIVMGEDVRIATVAVSHGNLNLIISENDQVSQPLPFSE-GETVVVPDTSMEVSEDN 318

Query: 322 GSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           G+  +++    +  +   +N+IG     +I+I Q IKAAGAL +E+++
Sbjct: 319 GNLVVMEMGVSIGDVARALNAIGATPRDLIAIFQAIKAAGALHAELVV 366


>gi|163783622|ref|ZP_02178611.1| flagellar P-ring protein precursor [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881115|gb|EDP74630.1| flagellar P-ring protein precursor [Hydrogenivirga sp. 128-5-R1-1]
          Length = 362

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 156/357 (43%), Positives = 230/357 (64%), Gaps = 7/357 (1%)

Query: 10  FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSL 69
             L+ L  +S  +  RIKD+ +++  R N L GYGLVVGL+GTGD  +++ FT +S+ + 
Sbjct: 10  IPLLILLFVSLSMAERIKDIATIEGNRVNYLQGYGLVVGLKGTGDG-KATQFTVKSLANA 68

Query: 70  LQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSL 129
           LQ +GI     R+  KNVAAV VTA +PP+A  G R+DVS++S+GDA SL GG L++T L
Sbjct: 69  LQKMGIVVDPNRITVKNVAAVFVTAKIPPYAKAGMRVDVSVSSIGDAKSLEGGTLLLTPL 128

Query: 130 LGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLI 189
            G DG IYA+AQG ++V G   +G+ +S ++ + T G+I NGA++ER+LP    + AD+ 
Sbjct: 129 RGPDGRIYALAQGQLIVGGYEARGRGASQVKNVPTVGRIPNGAVLERDLPFDM-NVADVN 187

Query: 190 LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLT 249
           + L  PDF+TA R+ D INS    RF  PIA A DS TVKV  PT ++    ++E+E L 
Sbjct: 188 IILDVPDFTTAKRVQDAINS----RFKAPIAVALDSATVKVGIPTGVNPVDFLAEIENLE 243

Query: 250 VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
           ++T   A+V+I+ R+GTIV+G NVRIS V V+ G+L V++ E  +V QP   S  G T  
Sbjct: 244 IKTSQVAKVVIDGRSGTIVLGGNVRISPVAVAVGSLVVKVKELAEVSQPPPLSP-GETKV 302

Query: 310 QNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              T+++V + K     +    ++ L++ +N IG     IIS+LQ IK AGAL++++
Sbjct: 303 VPRTEVEVIEEKRRLIPLKGTTVHELVTSLNKIGATPREIISVLQAIKEAGALKAKL 359


>gi|146278772|ref|YP_001168931.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557013|gb|ABP71626.1| flagellar P-ring protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 365

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 166/380 (43%), Positives = 237/380 (62%), Gaps = 26/380 (6%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ R+  L   L      + Q+  RIKD+V     R N L+GYGLVVGL GTGD LR+SP
Sbjct: 1   MLIRLLILFLCLTS-SASAGQI--RIKDLVRFDGVRGNDLVGYGLVVGLNGTGDGLRNSP 57

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTE  M +LL+ LG++  G     KNVAAV VTA LPPFA  G++IDV+++++GDA SL 
Sbjct: 58  FTEDIMSNLLERLGVNVTGEEYRPKNVAAVFVTATLPPFARAGAQIDVTVSAMGDAKSLL 117

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG LVMT L GADG IYAVAQG+++  G+  +GQ++  + G+ T G I  GA VERE+  
Sbjct: 118 GGTLVMTPLNGADGQIYAVAQGAIIAGGIAAEGQAARVVLGVPTAGMIPEGARVEREVDF 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
            F    ++ L LR PDF+TA RI ++IN        R +A   D+ TV      ++DL R
Sbjct: 178 DFASLNNVRLALRTPDFTTAGRIEERIN----RELGRGVAAMLDAGTV------SLDLVR 227

Query: 241 L--------MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
           +        +S +E L VE    ARV++++R+GTIVIG+ VRIS+V V+ G LT+++ E 
Sbjct: 228 VRSPSPAHTLSRIENLAVEPQMVARVVVDQRSGTIVIGEEVRISRVAVAQGGLTLRVEEQ 287

Query: 293 EQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPD---LNSLISGMNSIGLKTDGI 349
             VVQPN F S G T+    T   + + +G+  L + P    L+ +++G+N++G+  + +
Sbjct: 288 PAVVQPNPF-SQGETIVVPRTRASIEEREGT-GLAEIPSETTLSRVVAGLNALGVAPNDM 345

Query: 350 ISILQGIKAAGALQSEIIIQ 369
           I IL+ I AAGAL +E I++
Sbjct: 346 IDILKSIHAAGALHAEFIVK 365


>gi|220905266|ref|YP_002480578.1| flagellar basal body P-ring protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|254789291|sp|B8J2Y1|FLGI_DESDA RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|219869565|gb|ACL49900.1| flagellar P-ring protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 370

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 156/363 (42%), Positives = 228/363 (62%), Gaps = 13/363 (3%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           A L+ S++    + AQ V RIKD+ S    RDNQLIGYGLVVGL GTGD  + + FT  S
Sbjct: 16  AALLLSMV----LPAQAV-RIKDIASFSGVRDNQLIGYGLVVGLAGTGDK-KDAVFTLSS 69

Query: 66  MRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           M++++  +GI      L +KNVA+VMVTA +P  A PG+R+DV+++S+GDA+SL GG+L+
Sbjct: 70  MKNMMDRMGIGVDSSALKTKNVASVMVTARMPVSAKPGTRLDVTVSSVGDATSLLGGVLL 129

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
            T+L G DG IY +AQGS+ V G   +G+++S  + IST G I  G IVER +P +F   
Sbjct: 130 QTALKGVDGKIYTLAQGSLTVGGFSSQGRAASVSKNISTVGIIPGGGIVERGIPFEFNQQ 189

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMS 243
             L L LR  DFSTA +IA+++N         P A A D  ++ +  P     ++  LM+
Sbjct: 190 DKLTLHLRTADFSTAQQIAERVNGA----MGGPFARAIDDMSITMDIPAQYRNNMVPLMA 245

Query: 244 EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
            +E L V  DT A+V+++E+TGT+V+G +VRI++  V++GNL + + E EQV QP  F S
Sbjct: 246 SIENLDVSPDTAAKVVVDEKTGTVVLGRDVRITRTAVAHGNLQITVQEGEQVSQPGPF-S 304

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
            G TV    T+  V +      +I+   L  L+ G+NSIG     +ISIL+ ++ +GAL 
Sbjct: 305 QGQTVVTPTTETNVREENRHLVIIEGATLQELVDGLNSIGATPRDLISILRTMQVSGALL 364

Query: 364 SEI 366
           +E+
Sbjct: 365 AEL 367


>gi|94987186|ref|YP_595119.1| flagellar basal body P-ring protein [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731435|emb|CAJ54798.1| Flagellar basal-body P-ring protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 379

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 150/368 (40%), Positives = 234/368 (63%), Gaps = 9/368 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
            I R ++L    I +    AQ V RIKD+ +    R+NQLIGYGLV+GL GTGD  R SP
Sbjct: 16  FIIRSSYLTLLFIAVFHNPAQSV-RIKDIATFSGVRNNQLIGYGLVIGLAGTGDK-RDSP 73

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FT  SM ++L+ +G++    ++  KNVAAVMVTAN+P  A PG+ +DV+++S+GDA SL+
Sbjct: 74  FTASSMTNMLERMGVAVDANKIKPKNVAAVMVTANMPVSARPGTELDVTVSSVGDAKSLQ 133

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG+L+ T L G DG +YA+AQGS+++ G   +G ++S  +  +T G I  G IVE+ +P 
Sbjct: 134 GGVLLQTPLKGVDGKVYALAQGSLIIGGYSAEGTAASVQKNSTTVGSIPGGGIVEKGIPF 193

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DL 238
            F    +L L + + DFST +++ +++N+     F    A A D+ TV++  P     +L
Sbjct: 194 DFNTQQNLTLNMNSNDFSTTMQVVNRLNATMGGNF----ASAIDAGTVRIDIPPAYKGNL 249

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             L++ +E L +  ++ A+V+++E+TGTIV+G  VR+S+V V++GNL V I E+ QV QP
Sbjct: 250 VPLIASIENLEINPESVAKVVVDEKTGTIVLGREVRLSRVAVAHGNLQVVIQESAQVSQP 309

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
             F S G TV    T+L + +     +L++   L  L+ G+N+IG     +ISIL+ +KA
Sbjct: 310 GPF-SQGQTVITPETNLTLQEETKRLNLLEGASLQELVDGLNAIGATPRDMISILRALKA 368

Query: 359 AGALQSEI 366
           AG+L +++
Sbjct: 369 AGSLHAQL 376


>gi|189426327|ref|YP_001953504.1| flagellar basal body P-ring protein [Geobacter lovleyi SZ]
 gi|189422586|gb|ACD96984.1| flagellar P-ring protein [Geobacter lovleyi SZ]
          Length = 363

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 158/350 (45%), Positives = 222/350 (63%), Gaps = 14/350 (4%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SRIKD+ +    RDNQL+GYGLVVGL G+GDS ++  F  QS+ S+L+ +G++     + 
Sbjct: 22  SRIKDIAAFDGVRDNQLVGYGLVVGLNGSGDSDQTK-FPVQSLVSMLERMGVTINRSDVK 80

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LPPFA  G+++DV ++SLGDA ++ GG L+MT L GAD  +YAVAQGS
Sbjct: 81  VKNVAAVMVTATLPPFAKQGTKLDVLVSSLGDAKTIAGGTLIMTPLKGADNQVYAVAQGS 140

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++ +     GQ +S  +   T G+I  GA+VERELP        L L L   DF+TA RI
Sbjct: 141 ILTNSFAFAGQGASATKNHPTAGRIPAGALVERELPNVLAGKRSLRLNLAQSDFTTASRI 200

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIIN 261
                  ++N+  +  A + D  +V V  P +        ++++E L V  D PARV++N
Sbjct: 201 V-----AAINKNFKEAASSSDGGSVTVQIPDDFANRPVEFIAQLENLEVTQDQPARVVVN 255

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           ERTGTIV+GD V+IS V VS+GNLT+ + E  +VVQP    + G T     T+LKV + K
Sbjct: 256 ERTGTIVMGDKVKISSVAVSHGNLTLTVKETPKVVQPKLL-AKGETKEVPRTELKVQEEK 314

Query: 322 GSFSLIDAPDLNSL---ISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              S++  PD N++   + G+N +G+    +ISILQ IKAAGALQ+E++I
Sbjct: 315 NRLSVL--PDGNTIGDVVRGLNLLGVTPRDLISILQSIKAAGALQAELVI 362


>gi|89067520|ref|ZP_01155033.1| flagellar P-ring protein precursor [Oceanicola granulosus HTCC2516]
 gi|89047089|gb|EAR53143.1| flagellar P-ring protein precursor [Oceanicola granulosus HTCC2516]
          Length = 365

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 153/349 (43%), Positives = 226/349 (64%), Gaps = 11/349 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KD+V     R N L+GYGLVVGL GTGD LR+SPFTE+ M ++L+ LG++  G +   
Sbjct: 22  RLKDLVEFDGVRSNDLVGYGLVVGLNGTGDGLRNSPFTEEIMTNILERLGVNVTGEQFRP 81

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAV+VTA+LPPFA  GS IDV+++++GDA SL GG L+MT +  ADG IYAVAQG++
Sbjct: 82  KNVAAVIVTASLPPFARAGSPIDVTVSAIGDAGSLLGGTLIMTPMNAADGQIYAVAQGTI 141

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +  G   +G +++ ++G+ T G I +GA VERE+   F     + L LR PDF+TA RI 
Sbjct: 142 IAGGASAEGDAAAVVQGVPTSGVIPSGATVEREVAFDFAALDQMRLALRTPDFTTAARIE 201

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVK--VSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
             +N      F   +A   DS TV+  V+          +  +E + VE +  ARV++++
Sbjct: 202 AAVNRA----FGAHVALMIDSGTVEINVAGTGAASPAHAIGRIENILVEPERRARVVVDQ 257

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           R+GTIV+G++VRIS+V VS GNLT++I E   VVQPN F+  G TV    ++ ++++  G
Sbjct: 258 RSGTIVMGEDVRISRVAVSQGNLTLRIEEAPLVVQPNPFAP-GETVVVPRSEAEIAEEPG 316

Query: 323 SFSLID---APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              L +      L+ +++G+N++G+    +I IL+ IKAAGAL +E I+
Sbjct: 317 -IGLAEVQGGTSLSEVVAGLNALGVSPRDMIDILKSIKAAGALHAEFIV 364


>gi|261856356|ref|YP_003263639.1| flagellar P-ring protein [Halothiobacillus neapolitanus c2]
 gi|261836825|gb|ACX96592.1| flagellar P-ring protein [Halothiobacillus neapolitanus c2]
          Length = 372

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 157/372 (42%), Positives = 227/372 (61%), Gaps = 14/372 (3%)

Query: 7   FLIFSLIGL-------HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           F++  L+GL         ++ +   RIKD+ +    R+NQ+IGYGLVVGL GTGD     
Sbjct: 4   FMLIMLVGLLLPVTVAQAVTQEPAQRIKDLATFAGVRNNQIIGYGLVVGLPGTGDQTTQV 63

Query: 60  PFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           PFT QS++++L   G+S   G +  KNVAAVMVT++LPPFA PG +IDV+++S+G+A SL
Sbjct: 64  PFTLQSIQNMLARQGLSPAAGNVQLKNVAAVMVTSSLPPFAKPGQQIDVTVSSIGNAKSL 123

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVEREL 178
           RGG L+MT L G DG IYAVAQGS++V GL V G+  S +   I T G+I NGA+VER +
Sbjct: 124 RGGELLMTPLKGVDGKIYAVAQGSLLVGGLDVSGKDGSRVTVNIPTAGRIPNGALVERSV 183

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL 238
                 +  + L L  PDF+TA  +   IN          +AEA D  T++V  P + + 
Sbjct: 184 ASTMGGANSVYLDLNTPDFTTAKNMEKAINQM----LGGGVAEAVDGGTIRVRAPQDANA 239

Query: 239 -TRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               MS +E + V   +  A+V++N RTGT+VIG NVRI    VS+G+LTV + EN QV 
Sbjct: 240 RVGFMSVLEGIEVSPGEGAAKVVVNARTGTVVIGQNVRIEAAAVSHGDLTVTVKENAQVS 299

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QP  FS   + VT N+      D K +F       LN ++  +N++G     +++IL+ +
Sbjct: 300 QPAPFSRGQTVVTPNSQVSAKEDKKRAFLFNPGVTLNDIVKAVNAVGASPSDLVAILEAL 359

Query: 357 KAAGALQSEIII 368
           K+AGAL++++I+
Sbjct: 360 KSAGALKAQLIV 371


>gi|159045916|ref|YP_001534710.1| flagellar basal body P-ring protein [Dinoroseobacter shibae DFL 12]
 gi|157913676|gb|ABV95109.1| flagellar P-ring protein FlgI [Dinoroseobacter shibae DFL 12]
          Length = 367

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 231/373 (61%), Gaps = 15/373 (4%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           R+   IF  + L   +     R+KD+V     R N L+GYGLVVGL GTGD +R++PFTE
Sbjct: 3   RLFLAIFMSLNLAATAMATPIRLKDLVEFDGVRGNDLVGYGLVVGLNGTGDGIRNAPFTE 62

Query: 64  QSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           + + ++L+ LG++  G +   KNVAAV+VTA LPPFA  GS+IDV+++++GDA SL GG 
Sbjct: 63  EILGNILERLGVNVSGEQFRPKNVAAVIVTAELPPFARVGSQIDVTVSAIGDAKSLLGGT 122

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L+MT +  ADG IYAVAQG+++  G  V G +   + G+ T G I  GA VE+E+   F 
Sbjct: 123 LIMTPMNAADGEIYAVAQGTIIAGGEAVAGGNEEIVTGVPTAGVIPAGARVEQEVDFVFG 182

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMS 243
           D   L L LR PDF+TA RI   IN +    F R +A   DS TV++    +I  TRL S
Sbjct: 183 DLTSLRLALRAPDFTTAGRIESAINEF----FDRQVALMLDSGTVEI----DISRTRLRS 234

Query: 244 ------EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
                  +E L +E +  ARV++++R+GTIV+G+NVR+S+V VS GNLT++I +   +  
Sbjct: 235 AAHAIGRIENLLIEPELRARVVVDQRSGTIVMGENVRVSRVAVSQGNLTLRIEDQPVIAV 294

Query: 298 PNAFSSNGSTVTQNN-TDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PN FS   + V       ++     G   + +  +L+ +ISG+N++G+    +I IL+ I
Sbjct: 295 PNPFSRGDTIVVPRQVVTMEEEPGIGLAEVKEGTNLSEVISGLNALGVSPRDMIDILKSI 354

Query: 357 KAAGALQSEIIIQ 369
           KAAGAL +E +++
Sbjct: 355 KAAGALHAEFVVR 367


>gi|117926376|ref|YP_866993.1| flagellar basal body P-ring protein [Magnetococcus sp. MC-1]
 gi|117610132|gb|ABK45587.1| flagellar P-ring protein [Magnetococcus sp. MC-1]
          Length = 386

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 163/349 (46%), Positives = 220/349 (63%), Gaps = 17/349 (4%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST---PGG 80
           +R+KDVV+++  RDN L GYGL+VGL GTGDS  S+ FT+QSM+ +LQ +GIS    P  
Sbjct: 46  TRLKDVVTIEGVRDNPLNGYGLLVGLNGTGDS--SAAFTQQSMQQMLQRMGISMSTLPK- 102

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
               KNVAAVMVTA LPPFA  G+++DV+I SLGDA SL GG LVMT L  ADG IYAVA
Sbjct: 103 ---VKNVAAVMVTATLPPFARQGNKVDVTIASLGDAKSLEGGTLVMTPLRAADGRIYAVA 159

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG V V G    G   +  +   T  +I +GA VERE+  K      L L L+  DF+TA
Sbjct: 160 QGPVSVGGFSAGGAGGNVQKNFPTVARIADGATVEREVDFKLARETSLQLALKEHDFTTA 219

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTPARV 258
            R+   IN      F  P+A A DS TVKV  P +    +   +S +E   VE DT A V
Sbjct: 220 NRVVSAINGL----FGEPLAHALDSGTVKVQVPPSYKGRVVEFVSRMEGAEVEVDTRAVV 275

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++NERTGTIV+G+NVR+S V +S+G L+++IT+  QV QPN   + G T   N  D++V+
Sbjct: 276 VVNERTGTIVMGENVRVSTVALSHGALSIRITDTPQVSQPNPL-AGGDTAVVNQRDVQVT 334

Query: 319 DNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +       + +   L  L+ G+N++G+    +I+ILQ IKA+GALQ+++
Sbjct: 335 EKDARLVQMEEGVTLGDLVKGLNNLGVTPRDLIAILQAIKASGALQADL 383


>gi|88813658|ref|ZP_01128887.1| flagellar P-ring protein precursor [Nitrococcus mobilis Nb-231]
 gi|88789076|gb|EAR20214.1| flagellar P-ring protein precursor [Nitrococcus mobilis Nb-231]
          Length = 371

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 157/352 (44%), Positives = 228/352 (64%), Gaps = 13/352 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+ ++   R NQL+GYGLV GL GTGD    +PFT QS+R++L + GI  P  +L S
Sbjct: 24  RIKDLATVAGVRPNQLVGYGLVAGLDGTGDRTTQTPFTVQSIRAMLASQGIQLPVAQLRS 83

Query: 85  ---KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
              KNVAAVMVTA LP FA PG +IDV+++SLG+A SLRGG L+MT L G DG++YA+AQ
Sbjct: 84  MQLKNVAAVMVTAELPAFAKPGQQIDVTVSSLGNAKSLRGGNLLMTPLKGVDGSVYAMAQ 143

Query: 142 GSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           G+++VSG    G+  S  +  + + G+I +GA VER +   F     ++L L  PDF+TA
Sbjct: 144 GNLLVSGFGASGRDGSKIVVNVLSTGRIPDGATVERSVASPFALGESVVLNLHTPDFTTA 203

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET-DTPARV 258
            R+A QIN  +L   S   A A D+ +VKV  P + +     ++ +E L V   + PARV
Sbjct: 204 KRVAKQIND-TLGAAS---ATALDAVSVKVRAPRDANQRVSFVAFLENLEVAPGEAPARV 259

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           I+N RTGTIVIG +VR+    +++G+LTV I+E  QV QP  F+  G TV    +D++++
Sbjct: 260 IVNARTGTIVIGSHVRVQPAAITHGSLTVTISERTQVSQPAPFARRGQTVVNPQSDVQIT 319

Query: 319 DNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + K    L  AP  +L++++  +N +G     +++ILQ +K AGAL++E+II
Sbjct: 320 EEKRPMFLF-APGTELSAIVEAVNRVGASPSDLVAILQALKQAGALRAELII 370


>gi|295111395|emb|CBL28145.1| Flagellar basal-body P-ring protein [Synergistetes bacterium SGP1]
          Length = 380

 Score =  273 bits (697), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 218/346 (63%), Gaps = 12/346 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+  ++  RDNQL G GLV GL+GTGD+   S  T   MR++++N G++     + +
Sbjct: 42  RIKDIADIEGARDNQLTGVGLVTGLRGTGDN---SAMTTHMMRNMMRNFGVTLAPNEVKT 98

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           +NVA V +TA LPP+A PG RIDVS+N++G+A SL+GG L+   L  ADGN+YAVAQGSV
Sbjct: 99  RNVAVVSLTATLPPYARPGQRIDVSVNAIGNAQSLQGGTLIQAPLHAADGNVYAVAQGSV 158

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +V G    G S+S  + + T G++ +GAIVER++P  F     + L LR+PDF+TA R+A
Sbjct: 159 LVGGWAADGSSASTTKNVPTVGRVPSGAIVERDVPSDFTLGGQMALLLRDPDFTTAQRVA 218

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIINE 262
           D IN     +F   IA   D+  V V+ P       T  ++ VE L +  D  ARV +NE
Sbjct: 219 DAIN----QKFG-AIASPVDAGRVAVNLPGQYLAAPTAFLANVERLEITPDMVARVAVNE 273

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+V+G NVRIS V V++GNLTV + ++  VVQP AFS  G T  +  TD+ V+++  
Sbjct: 274 RTGTVVMGGNVRISSVAVAHGNLTVSVKDDPNVVQPEAFSG-GETRVEIRTDITVNEDGA 332

Query: 323 SFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEII 367
           S   + A   +  ++  +N+IG     II+ILQ I  AGAL  +++
Sbjct: 333 SMIAMPATTTVRDMVRVLNAIGATPRDIITILQAIDKAGALHGQLV 378


>gi|308535386|ref|YP_002140547.2| flagellar basal body P-ring protein [Geobacter bemidjiensis Bem]
 gi|308052731|gb|ACH40751.2| flagellar P-ring protein FlgI [Geobacter bemidjiensis Bem]
          Length = 367

 Score =  272 bits (696), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 153/351 (43%), Positives = 225/351 (64%), Gaps = 11/351 (3%)

Query: 21  QVV--SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           QVV  +RIKD+ +    R+NQLIGYGLVVGL G+GDS ++  F  QS+   L+ +GI+  
Sbjct: 20  QVVFGARIKDIAAFDGVRENQLIGYGLVVGLNGSGDSDQTK-FPVQSLVGALERMGITVN 78

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
              +  KN+AAVMVTA LPPFA  G+R+DV ++S+GDA SL GG L+M  L GAD  +YA
Sbjct: 79  RNDITVKNIAAVMVTAQLPPFAKQGNRLDVLVSSMGDAKSLAGGTLMMAPLKGADNQVYA 138

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           VAQG+V+ +     GQ++S M+   T G +  GA++ERE+P    + + L L L   DF+
Sbjct: 139 VAQGAVLTNSFSYGGQAASAMKNHPTAGTVPGGALIEREIPNVLANRSQLKLNLHQSDFT 198

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTPA 256
           TA R+A  IN     RF   +A   D  +V+++ P+     +   ++ +E L V  D  A
Sbjct: 199 TASRVAAAINE----RFQGQVATLTDPGSVQIAVPSEYQNRVVEFIANLERLEVNPDVLA 254

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV++NERTGTIV+G+NVRIS V VS+GNLTV + E  +V QP A +  G+T     TDL+
Sbjct: 255 RVVMNERTGTIVMGENVRISTVAVSHGNLTVVVKETPKVSQPRALAQ-GTTTVVPRTDLR 313

Query: 317 VSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           V++ K + S++ +  +L  ++  +N++G+    ++ I+Q IKAAGAL +E+
Sbjct: 314 VAEEKVNLSMVREGANLGEVVRALNTLGVTPRDLLGIMQAIKAAGALNAEL 364


>gi|260772278|ref|ZP_05881194.1| flagellar P-ring protein FlgI [Vibrio metschnikovii CIP 69.14]
 gi|260611417|gb|EEX36620.1| flagellar P-ring protein FlgI [Vibrio metschnikovii CIP 69.14]
          Length = 362

 Score =  272 bits (695), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 163/365 (44%), Positives = 222/365 (60%), Gaps = 13/365 (3%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           I  L+ +   S+   +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+QS R+
Sbjct: 5   ILLLLMVFMASSAHATRIKDVAQVAGVRSNQLVGYGLVTGLPGTGES---NPFTDQSFRA 61

Query: 69  LLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +LQN GI   PG R  +KNVAAVM+TA LPPF   G  IDV+++S+G ASSLRGG L  T
Sbjct: 62  MLQNFGIQLPPGTRTNTKNVAAVMLTAELPPFTKQGQTIDVTVSSIGSASSLRGGTLTQT 121

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSA 186
            L G DG +YAVAQG++VVSG    G   S + G + T G I NGAIVERE+P  F    
Sbjct: 122 FLKGLDGQVYAVAQGNLVVSGFSATGADGSSLVGNNPTVGMISNGAIVEREIPTPFGRGD 181

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEV 245
            +   L   DF+TA R+AD +N +        +A A D+ +V+V  P  +      +S V
Sbjct: 182 FITFNLFQSDFTTAQRMADTVNQF----LGPDMASAIDATSVRVRAPREVSQRVAFLSAV 237

Query: 246 EMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           E L  E  D  A++I+N RTGTIVIG +VR+    V++G +TV I EN  V QPN F + 
Sbjct: 238 ENLEFEPADMAAKIIVNSRTGTIVIGQHVRLRPAAVTHGGMTVAIKENWGVDQPNPF-AG 296

Query: 305 GSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G T    +TD++V + +G  F L     L+ L+  +N +G     +++ILQ +K AGA+Q
Sbjct: 297 GETAIIPDTDIEVVEQQGKMFKLETGTTLDELVRAVNEVGAAPSDLMAILQALKQAGAIQ 356

Query: 364 SEIII 368
            ++II
Sbjct: 357 GQLII 361


>gi|99082782|ref|YP_614936.1| flagellar basal body P-ring protein [Ruegeria sp. TM1040]
 gi|99039062|gb|ABF65674.1| Flagellar P-ring protein precursor [Ruegeria sp. TM1040]
          Length = 367

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 156/350 (44%), Positives = 223/350 (63%), Gaps = 11/350 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KD+V     R N L+GYGLVVGL GTGD LR+SPFTE+ M ++L+ LG++  G +   
Sbjct: 24  RLKDLVEFDGVRGNDLVGYGLVVGLDGTGDGLRNSPFTEEIMTNILERLGVNVSGEQFRP 83

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAV VTA LPPFA  G  ID +++++GD+SSL GG L+MT L  ADG IYAVAQG++
Sbjct: 84  KNVAAVFVTATLPPFARVGGTIDATVSAIGDSSSLLGGTLIMTPLNAADGQIYAVAQGTI 143

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +  G   +G +++  +G+ T G I +GA VERE+         + L LR PDF+TA RI 
Sbjct: 144 LAGGAVAEGDAATVTQGVPTSGVIPSGARVEREIEFDLSSLNSMRLALREPDFTTAGRIE 203

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVS-KPTNIDLT-RLMSEVEMLTVETDTPARVIINE 262
             IN    N F R +A   DS TV+V+ + TN   T   +  +E + VE    ARV++++
Sbjct: 204 RAIN----NEFGRNVAVMRDSGTVEVNIQRTNARSTAHAVGRMENVLVEPQRKARVVVDQ 259

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           R+GTIV+G +VRIS V V+ GNLT+++ E   V QPN F ++G TV    T   + +  G
Sbjct: 260 RSGTIVMGSDVRISNVAVAQGNLTLRVEEAPLVSQPNPF-ADGETVVVPRTGAAIEEEDG 318

Query: 323 SFSLIDAPDLNSL---ISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              L + P+  SL   +SG+N++G+    +I IL+ +KAAGAL +E +++
Sbjct: 319 -IQLAEVPETTSLSEVVSGLNALGVSPRDMIDILKSLKAAGALHAEFVVR 367


>gi|171059408|ref|YP_001791757.1| flagellar basal body P-ring protein [Leptothrix cholodnii SP-6]
 gi|170776853|gb|ACB34992.1| flagellar P-ring protein [Leptothrix cholodnii SP-6]
          Length = 392

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 155/363 (42%), Positives = 218/363 (60%), Gaps = 9/363 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L+ +   L   +    +RIK+V S+Q  R NQL+GYGLVVGL GTGD    +PFT QS+ 
Sbjct: 32  LVLASTALWWPAPAHATRIKEVASVQGVRPNQLVGYGLVVGLDGTGDQTTQTPFTAQSLT 91

Query: 68  SLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++LQ LG++ P G  +  KNVAAVMVTA LPPFA PG  +DV++ SLG+A SLRGG L+ 
Sbjct: 92  AMLQQLGVTVPPGTNMQIKNVAAVMVTATLPPFAQPGQSVDVTVASLGNAKSLRGGTLIG 151

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L GAD  IYA+AQG++++ G       S       + G+I +GA VER +P    +  
Sbjct: 152 TPLRGADNQIYALAQGNLIIGGAGASAGGSKVQVNHLSAGRIPDGATVERAVPTPLAEGD 211

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEV 245
            L L L++ DF+TA  ++  IN     RF +  A A D R V+V  P   D     ++++
Sbjct: 212 SLQLDLKSSDFATARAVSQAIN----ERFGKGTASAMDGRVVRVKMPATPDERVNFLADM 267

Query: 246 EMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           E L +E   P A+VI+N RTG+IV+   V ++   V++GNL+V IT   QV QP  F SN
Sbjct: 268 ENLAIELAKPAAKVIVNARTGSIVMNQAVTLAACAVAHGNLSVTITSTPQVSQPAPF-SN 326

Query: 305 GSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G T     TD+K++   GS   L +   L  ++  +NS+G     +++ILQ IKAAGAL 
Sbjct: 327 GQTTVTEKTDIKINQEPGSLIQLKEGTQLTDVVKALNSLGATPGDLLAILQAIKAAGALN 386

Query: 364 SEI 366
           +E+
Sbjct: 387 AEL 389


>gi|56695118|ref|YP_165465.1| flagellar basal body P-ring protein [Ruegeria pomeroyi DSS-3]
 gi|62286715|sp|Q5LWZ2|FLGI_SILPO RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|56676855|gb|AAV93521.1| flagellar P-ring protein FlgI [Ruegeria pomeroyi DSS-3]
          Length = 366

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 155/367 (42%), Positives = 233/367 (63%), Gaps = 11/367 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L+  L+ L  ++     R+KD+V     R N L+GYGLVVGL GTGD LR++PFTE+ M 
Sbjct: 6   LLACLLFLPCLAQAGAVRLKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNAPFTEEIMS 65

Query: 68  SLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           ++L+ LG++  G     KNVAAV VTA LPPFA  GS+ID++++++GD+ SL GG L+MT
Sbjct: 66  NILERLGVNVTGEDFRPKNVAAVFVTAALPPFARVGSQIDITVSAIGDSKSLLGGTLIMT 125

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD 187
            L  ADG IYAVAQG+V+  G   +GQ++S ++G+ T G I  GA VERE+         
Sbjct: 126 PLNAADGQIYAVAQGTVLAGGASAEGQAASVVQGVPTSGVIPAGARVEREIEFDLGSLTQ 185

Query: 188 LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVK--VSKPTNIDLTRLMSEV 245
           L L LR PDF+TA RI   +NS     F+  +A   DS TV+  ++         ++  +
Sbjct: 186 LRLALREPDFTTAGRIETAVNSA----FNGRVAVMRDSGTVELDIAATQARSPAHVIGRI 241

Query: 246 EMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
           E + VE +  ARV++++R+GTIV+G +VRIS+V VS G+LT+++ E    VQPN F ++G
Sbjct: 242 ENILVEPERKARVVVDQRSGTIVMGADVRISRVAVSQGSLTLRVEEAPIAVQPNPF-ADG 300

Query: 306 STVTQNNTDLKVSDNKGSFSLIDAPD---LNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            TV    T+ ++    G   L + P+   L+ +++G+N++G+    +I IL+ IKAAGAL
Sbjct: 301 DTVVVPRTNAEIEQEPG-IKLAEVPESASLSDVVAGLNALGVSPRDMIDILKTIKAAGAL 359

Query: 363 QSEIIIQ 369
            +E +++
Sbjct: 360 HAEFVVR 366


>gi|259417993|ref|ZP_05741912.1| flagellar P-ring protein FlgI [Silicibacter sp. TrichCH4B]
 gi|259346899|gb|EEW58713.1| flagellar P-ring protein FlgI [Silicibacter sp. TrichCH4B]
          Length = 367

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 154/350 (44%), Positives = 224/350 (64%), Gaps = 11/350 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KD+V     R N L+GYGLVVGL GTGD LR+SPFTE+ M ++L+ LG++  G +   
Sbjct: 24  RLKDLVEFDGVRGNDLVGYGLVVGLDGTGDGLRNSPFTEEIMANILERLGVNVSGEQFRP 83

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAV VTA LPPFA  G  +D +++++GD+SSL GG L+MT L  ADG IYAVAQG++
Sbjct: 84  KNVAAVFVTATLPPFARVGGTLDATVSAIGDSSSLLGGTLIMTPLNAADGQIYAVAQGTI 143

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +  G   +G++++  +G+ T G I +GA VERE+         + L LR PDF+TA RI 
Sbjct: 144 LAGGAVAEGEAATVTQGVPTSGVIPSGARVEREIDFDLSSLNSMRLALREPDFTTAGRIE 203

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVS-KPTNIDLT-RLMSEVEMLTVETDTPARVIINE 262
             INS     F R +A   DS TV+V+ + TN   T   +  +E + VE    ARV++++
Sbjct: 204 QAINS----EFGRNVAVMRDSGTVEVNIQRTNARSTAHAVGRMENVLVEPQRKARVVVDQ 259

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           R+GTIV+G +VRIS V V+ GNLT+++ E   V QPN F + G TV    T   + + +G
Sbjct: 260 RSGTIVMGSDVRISNVAVAQGNLTLRVEEAPLVSQPNPF-AEGETVVVPRTGAAIEEEEG 318

Query: 323 SFSLIDAPDLNSL---ISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              L + P+  SL   ++G+N++G+    +I IL+ +KAAGAL +E +++
Sbjct: 319 -VQLAEVPETTSLSEVVAGLNALGVSPRDMIDILKSLKAAGALHAEFVVR 367


>gi|332140550|ref|YP_004426288.1| flagellar basal body P-ring protein [Alteromonas macleodii str.
           'Deep ecotype']
 gi|226701941|sp|B4RV29|FLGI_ALTMD RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|327550572|gb|AEA97290.1| flagellar basal body P-ring protein [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 370

 Score =  270 bits (690), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 160/374 (42%), Positives = 234/374 (62%), Gaps = 14/374 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F +   +F+L+   +  AQ   RIKDV S+Q  R NQL+GYGLVVGL GTG+    SPF
Sbjct: 3   LFSVVLAVFTLLLPSQAFAQ---RIKDVASIQGVRSNQLVGYGLVVGLPGTGE---QSPF 56

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           TEQS R++L+N GIS     +   +NVAAV V A+LP FA PG  ID++++S+G+A+SL+
Sbjct: 57  TEQSFRTMLRNFGISLDANTKPKIRNVAAVAVHADLPAFAKPGQTIDITVSSVGEAASLQ 116

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVK-GQSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+ T L G DG +YAVAQGS+VVSG   + G  S  +    T G+I NGA+VE+ +P
Sbjct: 117 GGTLLQTFLRGVDGKVYAVAQGSLVVSGFGAQGGDGSRIVVNTPTVGRIPNGAMVEQSVP 176

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSY--SLNRFSRPIAEAYDSRTVKVSKPTNI- 236
             F +   L L L  PDFSTA  +AD IN    +       IA+  D+ +V+VS P ++ 
Sbjct: 177 TGFANGDTLTLNLHYPDFSTAKSLADTINERLGAQPENGYVIAKPIDAASVRVSAPRDVG 236

Query: 237 DLTRLMSEVEMLT-VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                ++ +E       D PARV+IN RTGTIVIG +VR+    +++G LTV I+EN+QV
Sbjct: 237 QRVGFLATLENFEFTPADAPARVVINSRTGTIVIGSDVRLLPAAITHGGLTVTISENQQV 296

Query: 296 VQPNAFSSNGSTV-TQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQ 354
            QPNAF+   + + TQ+  D+ ++D++  F       L+ L+  +N +G     +++IL+
Sbjct: 297 TQPNAFADGQTAITTQSIVDVDLADSR-MFKFEPGVTLDQLVRAVNEVGAAPGDLMAILE 355

Query: 355 GIKAAGALQSEIII 368
            ++ AGAL+ E++I
Sbjct: 356 ALRHAGALRGELVI 369


>gi|126730124|ref|ZP_01745936.1| flagellar P-ring protein precursor I [Sagittula stellata E-37]
 gi|126709504|gb|EBA08558.1| flagellar P-ring protein precursor I [Sagittula stellata E-37]
          Length = 368

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 159/354 (44%), Positives = 229/354 (64%), Gaps = 21/354 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+V +   R N L+GYGLVVGL GTGD LR+SPFTE+ M ++L+ LG++  G +   
Sbjct: 25  RIKDLVEVDGVRSNDLVGYGLVVGLNGTGDGLRNSPFTEEIMTNILERLGVNVTGEQFRP 84

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           +NVAAV+VT  LPPFA  G ++DV+++++GDA SL GG L+MT L  ADG IYAVAQG+V
Sbjct: 85  RNVAAVLVTGRLPPFARTGGQVDVTVSAIGDAKSLLGGTLIMTPLNAADGQIYAVAQGTV 144

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +  G   +G+++  ++G+ T G I +GA VERE+P  F + + L L LR PDF+TA RI 
Sbjct: 145 IAGGAEAEGEAARVVQGVPTSGVIPSGARVEREVPFDFANLSSLRLALREPDFTTAARIE 204

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKV-------SKPTNIDLTRLMSEVEMLTVETDTPAR 257
           D IN  SL R +   A   D+ T++V       S P      R +  +E L VE    AR
Sbjct: 205 DVIN-RSLGRRA---AVMMDAGTIQVNLQNTGASSP-----ARAVVAIENLAVEPQRRAR 255

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           V++++R+GTIV+G +VRIS+V VS GNLT++I E    +QPN F ++G TV    T   +
Sbjct: 256 VVVDQRSGTIVMGADVRISRVAVSQGNLTLRIEEAPLAIQPNPF-ADGETVVVPRTGAAI 314

Query: 318 SDNKGSFSLIDAP---DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            +  G   L + P    L+ +I+G+N++G+    +I IL+ IKAAGAL ++ ++
Sbjct: 315 EEEPG-IGLAEVPSGTSLSEVIAGLNALGVSPRDMIDILKSIKAAGALHADFVV 367


>gi|37679151|ref|NP_933760.1| flagellar basal body P-ring protein [Vibrio vulnificus YJ016]
 gi|161501852|ref|NP_759229.2| flagellar basal body P-ring protein [Vibrio vulnificus CMCP6]
 gi|320157105|ref|YP_004189484.1| flagellar P-ring protein FlgI [Vibrio vulnificus MO6-24/O]
 gi|61213554|sp|Q7MMV0|FLGI_VIBVY RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|61213593|sp|Q8DFJ2|FLGI_VIBVU RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|37197893|dbj|BAC93731.1| flagellar basal-body P-ring protein FlgI [Vibrio vulnificus YJ016]
 gi|319932417|gb|ADV87281.1| flagellar P-ring protein FlgI [Vibrio vulnificus MO6-24/O]
 gi|319999023|gb|AAO08756.2| Flagellar P-ring protein flgI [Vibrio vulnificus CMCP6]
          Length = 363

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 160/371 (43%), Positives = 228/371 (61%), Gaps = 17/371 (4%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           F +  L F L     +++   +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT
Sbjct: 4   FTLLLLCFVL----PMTSAYAARIKDVAQVAGVRSNQLVGYGLVSGLPGTGES---TPFT 56

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQS  ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG +IDV+++S+G A SLRG
Sbjct: 57  EQSFAAMLQNFGIQLPAGTKPKIKNVAAVMVTAELPPFSKPGQQIDVTVSSIGSAKSLRG 116

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPK 180
           G L+ T L G DG +YAVAQG++VVSG   +G   S + G + T G I +GA+VERE+P 
Sbjct: 117 GTLLQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGIISSGAMVEREVPT 176

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L   DF+TA R+AD +N++        +A A D+ +V+V  P +I    
Sbjct: 177 PFGRGDFITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDISQRV 232

Query: 240 RLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QP
Sbjct: 233 AFLSAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLSVSQP 292

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N F S G TV   N+D+ V++ +G  F       L+ L+  +N +G     +++ILQ +K
Sbjct: 293 NGF-SGGETVVVPNSDISVTEEQGKMFKFEPGLTLDDLVRAVNQVGAAPSDLMAILQALK 351

Query: 358 AAGALQSEIII 368
            AGA++ ++II
Sbjct: 352 QAGAIEGQLII 362


>gi|303325595|ref|ZP_07356038.1| flagellar P-ring protein FlgI [Desulfovibrio sp. 3_1_syn3]
 gi|302863511|gb|EFL86442.1| flagellar P-ring protein FlgI [Desulfovibrio sp. 3_1_syn3]
          Length = 370

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 148/344 (43%), Positives = 219/344 (63%), Gaps = 8/344 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+ +    RDNQLIGYGLVVGL GTGD  + S FT  SM++++  +GI      L  
Sbjct: 30  RIKDIATFSGVRDNQLIGYGLVVGLAGTGDK-KDSVFTLSSMKNMMDRMGIGVNSSALKI 88

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVA+VMVTA +P  + PGSR+DV+++S+GDA+SL GG+L+ T+L G DG  Y +AQG++
Sbjct: 89  KNVASVMVTARMPVSSKPGSRLDVTVSSVGDATSLLGGVLLQTALKGVDGKTYCLAQGAL 148

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
            V G  V G ++S  + ++T G I  G IVER +P +F     L L +R  DFSTA +IA
Sbjct: 149 TVGGFSVTGAAASTQKNVNTVGLIPGGGIVERGIPFEFNQQDKLTLNMRVGDFSTAQQIA 208

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIINE 262
           +++N+        P A A D+ +V V  P     +L  LM+ VE L V  DT A+V+++E
Sbjct: 209 ERLNAA----MGGPYARAVDAMSVSVDVPPQYKSNLVPLMASVENLEVTPDTAAKVVVDE 264

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           +TGT+V+G +VRIS+  V++GNL + + E++QV QP  F S G TV    TD+ V +   
Sbjct: 265 KTGTVVLGRDVRISRAAVAHGNLQITVQESQQVSQPGPF-SQGQTVVTPQTDINVREENR 323

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              +++   L  L+ G+N+IG     +ISIL+ ++ +G+L +E+
Sbjct: 324 RLVMVEGATLQELVDGLNAIGATPRDLISILRSLQVSGSLHAEL 367


>gi|126738560|ref|ZP_01754265.1| flagellar P-ring protein precursor I [Roseobacter sp. SK209-2-6]
 gi|126720359|gb|EBA17065.1| flagellar P-ring protein precursor I [Roseobacter sp. SK209-2-6]
          Length = 367

 Score =  269 bits (688), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 158/372 (42%), Positives = 230/372 (61%), Gaps = 16/372 (4%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           + I FL   ++    + A  + R+KD+V     R N L+GYGLVVGL GTGD LR+SPFT
Sbjct: 7   YLIVFLFLPIM----VQANAI-RLKDLVEFDGVRGNDLVGYGLVVGLDGTGDGLRNSPFT 61

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           E  M ++L+ LG++  G +   KNVAAV VTA LPPFA  G  IDV+++++GD+ SL GG
Sbjct: 62  EDIMSNILERLGVNVTGEQFRPKNVAAVFVTATLPPFARVGGNIDVTVSAIGDSKSLLGG 121

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L  ADG IYAVAQG+++  G   +G+ +S  +G+ T G I +G  VERE+    
Sbjct: 122 TLIMTPLNAADGQIYAVAQGTILAGGAVAEGEGASVTQGVPTAGVIPSGGRVEREIDFDL 181

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVS-KPTNIDLT-R 240
              + + L LR PDF+TA RI   +N      F R +A   DS TV++    TN   T  
Sbjct: 182 SSLSTMRLALREPDFTTAGRIERAVN----REFGRNVALMQDSGTVRIDIGGTNSRSTAH 237

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
            +  +E + VE    ARV++++R+GTIV+G +VRIS+V V+ GNLT++I E   V QPN 
Sbjct: 238 AIGRIENILVEPQRKARVVVDQRSGTIVMGSDVRISRVAVAQGNLTLRIEEAPLVAQPNP 297

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSL---ISGMNSIGLKTDGIISILQGIK 357
           F ++GSTV    T   + +  G   L + P+  SL   ++G+N++G+    +I IL+ +K
Sbjct: 298 F-ADGSTVVVPRTTAAIDEEPG-IQLAEVPETTSLSEVVAGLNALGVSPRDMIDILKSLK 355

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E +++
Sbjct: 356 AAGALHAEFVVR 367


>gi|323697475|ref|ZP_08109387.1| flagellar P-ring protein [Desulfovibrio sp. ND132]
 gi|323457407|gb|EGB13272.1| flagellar P-ring protein [Desulfovibrio desulfuricans ND132]
          Length = 385

 Score =  269 bits (687), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 223/345 (64%), Gaps = 8/345 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +R+KD+ S    R N+L+GYGLVVGL GTGD   SS FT +SM ++L+ +G+ T    L 
Sbjct: 44  ARLKDIASFSGVRTNELVGYGLVVGLAGTGDG-TSSTFTMRSMSNMLEKMGVETNPDDLK 102

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMV+A +P  A PGS +D++++SLGDA SL GG+L++T L G DG +YAV QGS
Sbjct: 103 PKNVAAVMVSAKMPVSAKPGSSLDITVSSLGDAKSLLGGVLLVTPLKGLDGRVYAVGQGS 162

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + + G  V G ++   + I T G+I NGA+VER +P KF +   + + L   DF T +++
Sbjct: 163 LTIGGFTVGGVAADAQKNIPTVGRIPNGAVVERSVPFKFNNQDHMTVNLDVRDFGTTMQV 222

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIIN 261
            ++IN+    +F    A+A D  T+ +  P     D+  LM+ +E L +  D  A+V+++
Sbjct: 223 VNKINASMGGQF----AKAKDISTIDLELPDRFRGDMVPLMASLEDLDISPDGKAKVVVD 278

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           E+TGT+V+G +VR+S+V V++GNL + ++E +QV QP  F S+G TV    TD++V +  
Sbjct: 279 EKTGTVVLGQDVRLSRVAVAHGNLQIVVSETQQVSQPGPF-SDGETVVTPQTDIQVQEQN 337

Query: 322 GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
               L++   L  L+ G+NSIG     +ISI++ +KAAG+L +E+
Sbjct: 338 NKLMLMEGATLQELVDGLNSIGATPRDLISIIRTLKAAGSLHAEV 382


>gi|260544343|ref|ZP_05820164.1| flagellar basal body P-ring protein [Brucella abortus NCTC 8038]
 gi|260759604|ref|ZP_05871952.1| flagellar basal body P-ring protein [Brucella abortus bv. 4 str.
           292]
 gi|260097614|gb|EEW81488.1| flagellar basal body P-ring protein [Brucella abortus NCTC 8038]
 gi|260669922|gb|EEX56862.1| flagellar basal body P-ring protein [Brucella abortus bv. 4 str.
           292]
          Length = 321

 Score =  269 bits (687), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 124/223 (55%), Positives = 176/223 (78%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P    
Sbjct: 99  VARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNST 158

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQG
Sbjct: 159 RSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG 218

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+R
Sbjct: 219 NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAVR 278

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEV 245
            AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+
Sbjct: 279 AADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAEL 321


>gi|256830173|ref|YP_003158901.1| flagellar P-ring protein [Desulfomicrobium baculatum DSM 4028]
 gi|256579349|gb|ACU90485.1| flagellar P-ring protein [Desulfomicrobium baculatum DSM 4028]
          Length = 371

 Score =  269 bits (687), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 146/344 (42%), Positives = 224/344 (65%), Gaps = 8/344 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KD+ S    R N L+GYGLVVGL GTGD   SS FT QSM ++L+N+G+      L  
Sbjct: 31  RLKDIASFGGVRSNDLVGYGLVVGLPGTGDK-SSSQFTIQSMANMLENMGVKVDRAALKP 89

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAVMVT  +P  A PGSR+D +++S+GDASSL GG+L+MT L G DG+IYA++QG++
Sbjct: 90  KNVAAVMVTVKMPASARPGSRLDATVSSVGDASSLLGGVLLMTPLKGIDGSIYALSQGAL 149

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
            V G    G +++  + ++T G+I  GA+VER +P  F +  D+ +QL   DFSTA ++A
Sbjct: 150 AVGGFSAGGDAATATKNVTTVGRIPGGAVVERSVPFSFNEQNDITIQLSVEDFSTAKQVA 209

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIINE 262
           D +N     ++    A A D+ ++++  P+    ++  LM+ +E L V+ D+ A+V+++E
Sbjct: 210 DSLNKAIGGQY----AHAQDASSIRLGVPSQYQGNIVALMASLENLEVQPDSRAKVVVDE 265

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           +TGT+V+G NV ++KV VS+GNL V ++E  QV QP AFS  G T     T++ V + + 
Sbjct: 266 KTGTVVLGANVTLAKVAVSHGNLNVVVSEQPQVSQPGAFSP-GQTAITPATEIGVREEQR 324

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              L+    +  L+ G+N+IG     +ISIL+ +K+AGAL +++
Sbjct: 325 RLILMAGASIQELVDGLNAIGATPRDLISILRTMKSAGALHADL 368


>gi|28897557|ref|NP_797162.1| flagellar basal body P-ring protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153840136|ref|ZP_01992803.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ3810]
 gi|260364615|ref|ZP_05777217.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus K5030]
 gi|260878280|ref|ZP_05890635.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AN-5034]
 gi|260898110|ref|ZP_05906606.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus Peru-466]
 gi|260901958|ref|ZP_05910353.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ4037]
 gi|29611971|sp|Q9X9J4|FLGI2_VIBPA RecName: Full=Flagellar P-ring protein 2; AltName: Full=Basal body
           P-ring protein 2; Flags: Precursor
 gi|28805769|dbj|BAC59046.1| flagellar P-ring protein precursor FlgI [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149746244|gb|EDM57334.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ3810]
 gi|308086128|gb|EFO35823.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus Peru-466]
 gi|308090125|gb|EFO39820.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AN-5034]
 gi|308106774|gb|EFO44314.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ4037]
 gi|308115118|gb|EFO52658.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus K5030]
 gi|328473449|gb|EGF44297.1| flagellar basal body P-ring protein [Vibrio parahaemolyticus 10329]
          Length = 363

 Score =  269 bits (687), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 160/370 (43%), Positives = 231/370 (62%), Gaps = 15/370 (4%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           RI  L+ S + L   +AQ  +RIKDV  +   R NQL+GYGLV GL GTG++   +PFTE
Sbjct: 3   RIVLLLMS-VALFSTAAQA-ARIKDVAQVAGVRSNQLVGYGLVSGLPGTGEA---NPFTE 57

Query: 64  QSMRSLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS  ++LQN GI   PG +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRGG
Sbjct: 58  QSFAAMLQNFGIQLPPGTKPKIKNVAAVMVTAELPPFSKPGQQVDVTVSSIGSAKSLRGG 117

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKK 181
            L+ T L G DG +YAVAQG++VVSG   +G   S + G + T G I +GA VERE+P  
Sbjct: 118 TLLQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPNP 177

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F     +   L   DF+TA R+AD +N++        +A A D+ +V+V  P ++     
Sbjct: 178 FGRGDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDVSQRVA 233

Query: 241 LMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +S +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN
Sbjct: 234 FLSAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPN 293

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           +F S G TV   ++D++V++ KG  F       L+ L+  +N +G     +++ILQ +K 
Sbjct: 294 SF-SGGQTVVVPDSDIEVTEEKGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQ 352

Query: 359 AGALQSEIII 368
           AGA++ ++II
Sbjct: 353 AGAIEGQLII 362


>gi|114046842|ref|YP_737392.1| flagellar basal body P-ring protein [Shewanella sp. MR-7]
 gi|123030763|sp|Q0HX20|FLGI_SHESR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|113888284|gb|ABI42335.1| flagellar P-ring protein [Shewanella sp. MR-7]
          Length = 363

 Score =  268 bits (686), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 161/372 (43%), Positives = 223/372 (59%), Gaps = 18/372 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +I  +A L FSL    E       RIKD+ ++Q  R+NQLIGYGLVVGL GTG+  R   
Sbjct: 5   LILAVAMLAFSLPSQAE-------RIKDIANVQGVRNNQLIGYGLVVGLPGTGEKTR--- 54

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+  ++L+N GI+ P   R   KNVA V V A++P F  PG  +DV+++SLG+A SL
Sbjct: 55  YTEQTFTTMLKNFGINLPDNFRPKIKNVAVVAVHADMPAFIKPGQELDVTVSSLGEAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T L G DGN+YA+AQGS+VVSG    G   S  ++   T G+I NGAIVER +
Sbjct: 115 RGGTLLQTFLKGVDGNVYAIAQGSLVVSGFSADGLDGSKVIQNTPTVGRIPNGAIVERSV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R+AD IN       +RP+    D+ +V+VS P ++  
Sbjct: 175 ATPFSTGDYLTFNLRRSDFSTAQRMADAINDLLGPDMARPL----DATSVQVSAPRDVSQ 230

Query: 238 LTRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E + VE  D  A+VI+N RTGTIV+G NV++    V++G LTV I E  QV 
Sbjct: 231 RVSFLATLENIEVEPADESAKVIVNSRTGTIVVGQNVKLLPAAVTHGGLTVTIAEATQVS 290

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPNA ++  +TVT N+T      N+  F       L+ L+  +N +G     +++IL+ +
Sbjct: 291 QPNALANGQTTVTSNSTINASESNRRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEAL 350

Query: 357 KAAGALQSEIII 368
           K AGAL  E+II
Sbjct: 351 KVAGALHGELII 362


>gi|332704820|ref|ZP_08424908.1| Flagellar P-ring protein [Desulfovibrio africanus str. Walvis Bay]
 gi|332554969|gb|EGJ52013.1| Flagellar P-ring protein [Desulfovibrio africanus str. Walvis Bay]
          Length = 369

 Score =  268 bits (686), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 151/350 (43%), Positives = 223/350 (63%), Gaps = 9/350 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           SAQ  +RIKD+ + +  R NQL+GYGLVVGL GTGD+ R S FT QSM ++L+ +G+   
Sbjct: 24  SAQA-TRIKDIATFKGVRSNQLVGYGLVVGLAGTGDN-RGSAFTIQSMVNMLERMGVRVE 81

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
              L  KNVAAVMVTANLP  + PG+R+D +I+SLGDA SL GG+L++T + G DGN+YA
Sbjct: 82  QENLKPKNVAAVMVTANLPSSSRPGARLDATISSLGDAKSLLGGVLMLTPMRGVDGNVYA 141

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           +AQG + V G    G+++S    I T G I +GA VER++P +F +   + + L   DFS
Sbjct: 142 LAQGPLTVGGYSAGGEAASATSNIPTVGIIPHGATVERQVPFEFNNQDIMTINLNIADFS 201

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPA 256
           T  ++ D IN         P A A D  T+ ++ P     +L  LM+ +E L V  D  A
Sbjct: 202 TTQQVVDSINRT----LGGPYARAADISTIDMTVPERFQGNLVPLMASLENLQVTPDARA 257

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +V+++E+TGT+++G NVR+S+V +S+G+L + I+E+  V QP  F S G TV    T+++
Sbjct: 258 KVVVDEKTGTVIVGQNVRLSRVAISHGSLQIIISESANVSQPQPF-SQGQTVVVPETEIQ 316

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           V +      L++   L  L+ G+NSIG     +ISIL+ +++AGAL +E+
Sbjct: 317 VREENNRLVLMEGATLQELVDGLNSIGATPRDLISILRALRSAGALMAEL 366


>gi|253702429|ref|YP_003023618.1| flagellar basal body P-ring protein [Geobacter sp. M21]
 gi|251777279|gb|ACT19860.1| flagellar P-ring protein [Geobacter sp. M21]
          Length = 398

 Score =  268 bits (686), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 149/346 (43%), Positives = 221/346 (63%), Gaps = 9/346 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+ +    R+NQLIGYGLVVGL G+GDS ++  F  QS+   L+ +GI+     + 
Sbjct: 56  ARIKDIAAFDGVRENQLIGYGLVVGLNGSGDSDQTK-FPVQSLVGALERMGITVNRNDIT 114

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KN+A+VMVTA LPPFA  G+R+DV ++S+GDA SL GG L+M  L GAD  +YAVAQG+
Sbjct: 115 VKNIASVMVTAQLPPFAKQGNRLDVLVSSMGDAKSLAGGTLMMAPLKGADNQVYAVAQGA 174

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+ +     GQ++S M+   T G +  GA++ERE+P      + L L L   DF+TA R+
Sbjct: 175 VLTNSFSYGGQAASAMKNHPTAGTVPGGALIEREIPNVLASRSQLKLNLHQSDFTTASRV 234

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIIN 261
           A  IN     RF   +A   D  +V+++ P      +   ++ +E L V  D  ARV++N
Sbjct: 235 ASAINE----RFQGQVATLTDPGSVQIAVPAEYRNRVVEFVANLERLEVNPDVLARVVMN 290

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           ERTGTIV+G+NVRIS V VS+GNLTV I E+ +V QP A  + G+T     T+L+V++ K
Sbjct: 291 ERTGTIVMGENVRISTVAVSHGNLTVVIKESPKVSQPRAL-AQGTTTVVPRTELRVAEEK 349

Query: 322 GSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            + S++ +  +L  ++  +N++G+    ++ I+Q IKAAGAL +E+
Sbjct: 350 VNLSMVREGANLGEVVRALNTLGVTPRDLLGIMQAIKAAGALNAEL 395


>gi|212634352|ref|YP_002310877.1| flagellar basal body P-ring protein [Shewanella piezotolerans WP3]
 gi|212555836|gb|ACJ28290.1| Flagellar P-ring protein [Shewanella piezotolerans WP3]
          Length = 364

 Score =  268 bits (686), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 158/372 (42%), Positives = 226/372 (60%), Gaps = 14/372 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M  ++A L   L+    + AQ   RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   
Sbjct: 2   MKLKLALLCAILVIASPVHAQ---RIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTR--- 55

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+ +++L+N GI+ P   R   KNVA V V+AN+PPF  PG  +DVS++SLG+A SL
Sbjct: 56  YTEQTFKTMLKNFGINLPDNFRPKIKNVAVVAVSANMPPFIKPGQTLDVSVSSLGEAKSL 115

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVEREL 178
           RGG+L+ T L G DGN+YA+AQGS+VVSG   +GQ  S  ++   T G+I NGAI+ER +
Sbjct: 116 RGGMLLQTFLKGVDGNVYAIAQGSMVVSGFSAEGQDGSKVIQNTPTVGRIPNGAIIERTV 175

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R++D IN       +RP+    D+ +V+VS P ++  
Sbjct: 176 ATPFSTGDYLTFNLRRADFSTAKRLSDAINDLLGPGMARPL----DAASVQVSAPRDVSQ 231

Query: 238 LTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E + VE     A+VI+N RTGTIV+G +V++    V++G LTV I E  QV 
Sbjct: 232 RVSFLATLENIEVEPAAESAKVIVNSRTGTIVVGQDVKLLPAAVTHGGLTVTIAEATQVS 291

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPN F+   + VT ++T     D+   F       L+ L+  +N +G     +++IL+ +
Sbjct: 292 QPNPFAGGQTVVTTDSTIDVAEDDSRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEAL 351

Query: 357 KAAGALQSEIII 368
           K AGAL  E+II
Sbjct: 352 KMAGALHGELII 363


>gi|163802599|ref|ZP_02196491.1| flagellar P-ring protein precursor I [Vibrio sp. AND4]
 gi|159173682|gb|EDP58501.1| flagellar P-ring protein precursor I [Vibrio sp. AND4]
          Length = 363

 Score =  268 bits (686), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 160/370 (43%), Positives = 231/370 (62%), Gaps = 15/370 (4%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           RI  ++ S + L   +AQ  +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFTE
Sbjct: 3   RILLVLLS-VALFATTAQA-ARIKDVAQVAGVRSNQLVGYGLVSGLPGTGES---NPFTE 57

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS  ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRGG
Sbjct: 58  QSFAAMLQNFGIQMPPGTKPKIKNVAAVMVTATLPPFSKPGQQVDVTVSSVGSAKSLRGG 117

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKK 181
            L+ T L G DG +YAVAQG++VVSG   +G   S + G + T G I +GA VERE+P  
Sbjct: 118 TLLQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPNP 177

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F     +   L + DF+TA R+AD +N++        +A A D+ +V+V  P ++     
Sbjct: 178 FGRGDYITFNLLDSDFTTAQRMADSVNNF----LGPQMASAVDATSVRVRAPRDVSQRVA 233

Query: 241 LMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +S +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN
Sbjct: 234 FLSAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPN 293

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
            F S G TV   ++D+++S+ KG  F       L+ L+  +N +G     +++ILQ +K 
Sbjct: 294 GF-SGGQTVVVPDSDIEISEEKGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQ 352

Query: 359 AGALQSEIII 368
           AGA++ ++II
Sbjct: 353 AGAIEGQLII 362


>gi|332994158|gb|AEF04213.1| flagellar basal body P-ring protein [Alteromonas sp. SN2]
          Length = 370

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 164/375 (43%), Positives = 232/375 (61%), Gaps = 16/375 (4%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F +  +  +L+    ++AQ   RIKD+ S+Q  R NQL+GYGLVVGL GTG+    SPF
Sbjct: 3   LFSVVLIALTLVLSSNVNAQ---RIKDLASIQGVRSNQLVGYGLVVGLPGTGEQ---SPF 56

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           TEQS R++L N GIS     +   KNVAAV V A LP F  PG  ID++++S+G+ASSL+
Sbjct: 57  TEQSFRTMLSNFGISLDSNTKPKIKNVAAVAVHAELPAFTKPGQTIDITVSSVGEASSLQ 116

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVK-GQSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+ T L G DG +YAVAQGS+VVSG   + G  S  +    T G+I NGA+VE+ +P
Sbjct: 117 GGTLLQTFLRGVDGKVYAVAQGSLVVSGFGAQGGDGSRIVVNTPTVGRIPNGAMVEQTVP 176

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSY--SLNRFSRPIAEAYDSRTVKVSKPTNI- 236
             F +   L L L  PDFSTA  +AD IN    +       IA   D+ +V+VS P ++ 
Sbjct: 177 SGFANGDSLTLNLHYPDFSTAKALADVINERLGAQPEKGYSIATPIDAASVRVSAPRDVG 236

Query: 237 DLTRLMSEVEMLT-VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                ++ +E       D PARV+IN RTGTIVIG +VR+    +++G LTV I+EN+QV
Sbjct: 237 QRVGFLATLENFEFTPADAPARVVINSRTGTIVIGRDVRLLPAAITHGGLTVTISENQQV 296

Query: 296 VQPNAFSSNGSTV--TQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISIL 353
            QPNAF ++G TV  TQ+  D+ +SD++  FS      L+ L+  +N +G     +++IL
Sbjct: 297 TQPNAF-ADGETVVTTQSIVDVDLSDSR-MFSFEPGVTLDQLVRAVNEVGAAPGDLMAIL 354

Query: 354 QGIKAAGALQSEIII 368
           + ++ AGAL  E++I
Sbjct: 355 EALRQAGALHGELVI 369


>gi|260762846|ref|ZP_05875178.1| flagellar basal body P-ring protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260673267|gb|EEX60088.1| flagellar basal body P-ring protein [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 250

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 176/224 (78%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR 81
            V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P   
Sbjct: 27  AVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNS 86

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
             SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVAQ
Sbjct: 87  TRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQ 146

Query: 142 GSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           G+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA+
Sbjct: 147 GNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTAV 206

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEV 245
           R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+
Sbjct: 207 RAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAEL 250


>gi|113969610|ref|YP_733403.1| flagellar basal body P-ring protein [Shewanella sp. MR-4]
 gi|123325186|sp|Q0HKS1|FLGI_SHESM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|113884294|gb|ABI38346.1| flagellar P-ring protein [Shewanella sp. MR-4]
          Length = 363

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 161/372 (43%), Positives = 222/372 (59%), Gaps = 18/372 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +I  +A L FSL    E       RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   
Sbjct: 5   LILAVAMLAFSLPSQAE-------RIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTR--- 54

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+  ++L+N GI+ P   R   KNVA V V A++P F  PG  +DV+++SLG+A SL
Sbjct: 55  YTEQTFTTMLKNFGINLPDNFRPKIKNVAVVAVHADMPAFIKPGQELDVTVSSLGEAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T L G DGN+YA+AQGS+VVSG    G   S  ++   T G+I NGAIVER +
Sbjct: 115 RGGTLLQTFLKGVDGNVYAIAQGSLVVSGFSADGLDGSKVIQNTPTVGRIPNGAIVERSV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R+AD IN       +RP+    D+ +V+VS P ++  
Sbjct: 175 ATPFSTGDYLTFNLRRSDFSTAQRMADAINDLLGPDMARPL----DATSVQVSAPRDVSQ 230

Query: 238 LTRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E + VE  D  A+VI+N RTGTIV+G NV++    V++G LTV I E  QV 
Sbjct: 231 RVSFLATLENIEVEPADESAKVIVNSRTGTIVVGQNVKLLPAAVTHGGLTVTIAEATQVS 290

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPNA ++  +TVT N+T      N+  F       L+ L+  +N +G     +++IL+ +
Sbjct: 291 QPNALANGQTTVTSNSTINASESNRRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEAL 350

Query: 357 KAAGALQSEIII 368
           K AGAL  E+II
Sbjct: 351 KVAGALHGELII 362


>gi|5361012|gb|AAD42919.1|U12817_13 polar flagellar FlgI homolog [Vibrio parahaemolyticus]
          Length = 363

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 159/370 (42%), Positives = 230/370 (62%), Gaps = 15/370 (4%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           RI  L+ S + L   +AQ  +RIKDV  +   R NQL+GYGLV GL GTG++   +PFTE
Sbjct: 3   RIVLLLMS-VALFSTAAQA-ARIKDVAQVAGVRSNQLVGYGLVSGLPGTGEA---NPFTE 57

Query: 64  QSMRSLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS  ++LQN GI   PG +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRGG
Sbjct: 58  QSFAAMLQNFGIQLPPGTKPKIKNVAAVMVTAELPPFSKPGQQVDVTVSSIGSAKSLRGG 117

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKK 181
            L+ T L G DG +YAVAQG++VVSG   +G   S + G + T G I +GA VERE+P  
Sbjct: 118 TLLQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPNP 177

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F     +   L   DF+TA R+AD +N++        +A A D+ +V+V  P ++     
Sbjct: 178 FGRGDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDVSQRVA 233

Query: 241 LMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +S +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN
Sbjct: 234 FLSAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPN 293

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           +F S G TV   ++D++V++ KG  F       L+  +  +N +G     +++ILQ +K 
Sbjct: 294 SF-SGGQTVVVPDSDIEVTEEKGKMFKFEPGLTLDDFVRAVNEVGAAPSDLMAILQALKQ 352

Query: 359 AGALQSEIII 368
           AGA++ ++II
Sbjct: 353 AGAIEGQLII 362


>gi|118581852|ref|YP_903102.1| flagellar basal body P-ring protein [Pelobacter propionicus DSM
           2379]
 gi|118504562|gb|ABL01045.1| flagellar P-ring protein [Pelobacter propionicus DSM 2379]
          Length = 364

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 155/366 (42%), Positives = 224/366 (61%), Gaps = 8/366 (2%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           +F+    + L   +A    RIKD+ S +  R+NQL+GYGLVVGL GTGDS ++     QS
Sbjct: 3   SFIAACCMLLLLTTAAHAVRIKDLASFEGVRENQLVGYGLVVGLNGTGDSDQAR-LQLQS 61

Query: 66  MRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           + ++L+ +G +    ++  KNVAAVMVTA LPPFA  G+++DV+++SLGD+ S+ GG L+
Sbjct: 62  VATMLERMGSTISASQIKLKNVAAVMVTATLPPFAKQGNQMDVTVSSLGDSKSIAGGTLI 121

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MT L GAD  +YAVAQGSV+ +     GQ+++  +   T G+I +GA+VERELP      
Sbjct: 122 MTPLKGADNQVYAVAQGSVLTNSFAFGGQAATAQKNHPTAGRIPSGALVERELPNTLAGK 181

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMS 243
           + L L L   DF+TA R+A  +N     +F   +A   D   V +  P N    +   ++
Sbjct: 182 SQLRLNLAQADFTTASRVASAVN----GKFGAGVATTGDPGAVIIQIPGNYTSRVIDFVA 237

Query: 244 EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
            VE L V  DT A+V++NERTGTIV+G+ VRIS V VS+GNL++ I E  QV QP   SS
Sbjct: 238 AVETLDVLPDTVAKVVLNERTGTIVMGERVRISTVAVSHGNLSLVIKETLQVSQPAPLSS 297

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G T     T +KV +      L+     +  ++  +N++G+    +I ILQ IKAAGAL
Sbjct: 298 RGETQVVPRTQVKVEEEARRLMLLQQGATIGDVVRALNTLGVTPRDLIGILQAIKAAGAL 357

Query: 363 QSEIII 368
           Q+E++I
Sbjct: 358 QAELVI 363


>gi|88704302|ref|ZP_01102016.1| flagellar P-ring protein FlgI [Congregibacter litoralis KT71]
 gi|88701353|gb|EAQ98458.1| flagellar P-ring protein FlgI [Congregibacter litoralis KT71]
          Length = 379

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 150/349 (42%), Positives = 220/349 (63%), Gaps = 9/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+  +   R NQL+GYGLVVGL G+GD +  +PFT QS++S+L  LG++ P      
Sbjct: 34  RIKDIAGIAGVRSNQLVGYGLVVGLDGSGDQVIQAPFTIQSLKSMLAQLGVNVPANVNPQ 93

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KN+A VMVTA LPPF  PG  IDV+++SL +A SLRGG L+MT L G DG  YA+AQGS
Sbjct: 94  LKNIATVMVTAELPPFTKPGQTIDVTVSSLANAKSLRGGQLLMTPLKGPDGQTYAIAQGS 153

Query: 144 VVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++VSG   +G   SS    + + G+I NGAIVER +P  F     +++ L +PDF+TA R
Sbjct: 154 MIVSGFGAEGSDGSSVTVNVPSAGRIPNGAIVERGVPTPFGTEPVMVMNLNHPDFTTAQR 213

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETD-TPARVII 260
           +A  IN          IA+  D+ +++V  P +  D    +S +E L+V+     A+V++
Sbjct: 214 VAMSINE----SMGEGIAKPLDAVSIEVRAPRDPGDKVAFVSLLENLSVDPGAAAAKVVV 269

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS-D 319
           N R GTIVIGD+VR+ +  V++GNLTV I+EN  V QP AF+  G T    N+++ ++ D
Sbjct: 270 NSRNGTIVIGDSVRVERAAVAHGNLTVTISENINVSQPGAFAGGGQTAITPNSEVSLAED 329

Query: 320 NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           N   F L     L  L++ +N +G     +I+IL+ ++ AGAL++++I+
Sbjct: 330 NARMFLLEPGITLQELVTAVNKVGAAPGDLIAILEALQQAGALRAQLIV 378


>gi|149911698|ref|ZP_01900306.1| flagellar P-ring protein precursor [Moritella sp. PE36]
 gi|149805228|gb|EDM65245.1| flagellar P-ring protein precursor [Moritella sp. PE36]
          Length = 378

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 162/372 (43%), Positives = 231/372 (62%), Gaps = 18/372 (4%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           I  ++F I ++   H       +RIKD+ S+Q  RDNQLIGYGLVVGL GTG+  +S+ F
Sbjct: 19  IVLLSFFIVTINSAH------AARIKDISSVQGVRDNQLIGYGLVVGLPGTGE--KSNAF 70

Query: 62  TEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           + QS +++L N GI+ P G ++  KNVAAV V+A LP F  PG  IDV++ ++G+A SLR
Sbjct: 71  SAQSFKTMLNNFGITMPDGAKVKIKNVAAVAVSAILPAFTKPGQTIDVTVAAIGEAKSLR 130

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELP 179
           GG+L+ T L GADG +YA+AQGS+VV GL V+G+  S  +    T G+I  GAIVERE+ 
Sbjct: 131 GGLLLQTFLKGADGQVYALAQGSLVVGGLGVEGKDGSKVIINTPTVGRISGGAIVEREVA 190

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F D   L   L   DF+ A R+AD IN+      + P+    DS +V+V  P +I   
Sbjct: 191 NPFGDGDYLTFNLHRGDFTNAKRLADSINNLVGPNTAYPM----DSTSVRVLAPRDISQR 246

Query: 239 TRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S +E L ++  D  A++I+N RTGTIVIG NVR+    +++G LTV I E ++V Q
Sbjct: 247 VAYLSTLENLELKMADESAKIIVNSRTGTIVIGQNVRLKPAAITHGGLTVTINETQEVSQ 306

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF +NG TV  N + + V+        +DA   L+ LI  +N +G+    ++SIL+ +
Sbjct: 307 PNAF-ANGETVVTNKSTINVTQEDARMFKLDAGATLDDLIRAVNQVGIAPGDLMSILEAL 365

Query: 357 KAAGALQSEIII 368
           K AGAL  ++II
Sbjct: 366 KDAGALDGQLII 377


>gi|153834468|ref|ZP_01987135.1| flagellar P-ring protein FlgI [Vibrio harveyi HY01]
 gi|156973591|ref|YP_001444498.1| flagellar basal body P-ring protein [Vibrio harveyi ATCC BAA-1116]
 gi|269961603|ref|ZP_06175965.1| flagellar P-ring protein FlgI [Vibrio harveyi 1DA3]
 gi|148869164|gb|EDL68196.1| flagellar P-ring protein FlgI [Vibrio harveyi HY01]
 gi|156525185|gb|ABU70271.1| hypothetical protein VIBHAR_01294 [Vibrio harveyi ATCC BAA-1116]
 gi|269833644|gb|EEZ87741.1| flagellar P-ring protein FlgI [Vibrio harveyi 1DA3]
          Length = 363

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 160/370 (43%), Positives = 230/370 (62%), Gaps = 15/370 (4%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           RI   + S + L   +AQ  +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFTE
Sbjct: 3   RILLALLS-VALFATTAQA-ARIKDVAQVAGVRSNQLVGYGLVSGLPGTGES---NPFTE 57

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS  ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRGG
Sbjct: 58  QSFAAMLQNFGIQMPPGTKPKIKNVAAVMVTATLPPFSKPGQQVDVTVSSIGSAKSLRGG 117

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKK 181
            L+ T L G DG +YAVAQG++VVSG   +G   S + G + T G I +GA VERE+P  
Sbjct: 118 TLLQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPNP 177

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F     +   L + DF+TA R+AD +N++        +A A D+ +V+V  P ++     
Sbjct: 178 FGRGDYITFNLLDSDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDVSQRVA 233

Query: 241 LMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +S +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN
Sbjct: 234 FLSAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPN 293

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
            F S G TV   ++D++V++ KG  F       L+ L+  +N +G     +++ILQ +K 
Sbjct: 294 GF-SGGQTVVVPDSDIEVNEEKGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQ 352

Query: 359 AGALQSEIII 368
           AGA++ ++II
Sbjct: 353 AGAIEGQLII 362


>gi|254230136|ref|ZP_04923531.1| flagellar P-ring protein FlgI [Vibrio sp. Ex25]
 gi|151937329|gb|EDN56192.1| flagellar P-ring protein FlgI [Vibrio sp. Ex25]
          Length = 363

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 158/367 (43%), Positives = 227/367 (61%), Gaps = 14/367 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            LI   + L   +AQ  +RIKDV  +   R NQL+GYGLV GL GTG++   +PFTEQS 
Sbjct: 5   LLILMSVALFSTAAQA-ARIKDVAQVAGVRSNQLVGYGLVSGLPGTGEA---NPFTEQSF 60

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRGG L+
Sbjct: 61  AAMLQNFGIQMPPGTKPKIKNVAAVMVTAELPPFSKPGQQVDVTVSSIGSAKSLRGGTLL 120

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKD 184
            T L G DG +YAVAQG++VVSG   +G   S + G + T G I +GA VERE+P  F  
Sbjct: 121 QTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPNPFGR 180

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMS 243
              +   L   DF+TA R+AD +N++        +A A D+ +V+V  P ++      +S
Sbjct: 181 GDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDVSQRVAFLS 236

Query: 244 EVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN F 
Sbjct: 237 AIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPNGF- 295

Query: 303 SNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S G TV   ++D++VS+ +G  F       L+ L+  +N +G     +++ILQ +K AGA
Sbjct: 296 SGGQTVVVPDSDIEVSEEQGKMFKFEPGLTLDDLVRAVNQVGAAPSDLMAILQALKQAGA 355

Query: 362 LQSEIII 368
           ++ ++II
Sbjct: 356 IEGQLII 362


>gi|114320061|ref|YP_741744.1| flagellar basal body P-ring protein [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226455|gb|ABI56254.1| flagellar P-ring protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 376

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 156/373 (41%), Positives = 228/373 (61%), Gaps = 15/373 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +I  +A ++  + GL +       RIKD+ S+Q  R NQL+GYGLVVGL GTGD    +P
Sbjct: 13  LIGLLAVIVLLMGGLAQ-----AERIKDIASVQGVRSNQLVGYGLVVGLDGTGDQSSQAP 67

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+RS+L   GI+ P    +   NVAAVMVTA LPPFA  G  +D++++SLG+A SL
Sbjct: 68  FTIQSIRSMLAAQGIAIPDNVNMQVDNVAAVMVTAELPPFARQGQTLDITVSSLGNADSL 127

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVEREL 178
           RGG L+MT L GADG +YA+AQG+++V G   +G   S +   I + G I NGA VERE+
Sbjct: 128 RGGTLLMTPLRGADGEVYAMAQGNMLVGGFGAEGADGSRITVNIPSAGTIPNGATVEREV 187

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNID 237
              F    D++L L  PDF+TA R+A+ IN           A+A D+ +++V  P T   
Sbjct: 188 RSPFAQQGDIVLNLNTPDFTTAHRVAEAINET----LGPNTAQAQDAVSIRVQAPQTPNQ 243

Query: 238 LTRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               MS +E + V   + PARVI+N RTG++VIG  V++    +++G+LTV ITE   VV
Sbjct: 244 RVSFMSYLEEIRVTPAEAPARVIVNARTGSVVIGSEVKVRPAAITHGSLTVTITEAPFVV 303

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP+ F + G T+    TD+++ +     F       L+ +++ +N +G     ++SIL+ 
Sbjct: 304 QPDPF-TEGETMVVPQTDIEIEEQANPMFVFGPGTTLDEIVNAVNRVGAAPGDLVSILEA 362

Query: 356 IKAAGALQSEIII 368
           +K AGAL++E+II
Sbjct: 363 LKRAGALRAELII 375


>gi|254445729|ref|ZP_05059205.1| flagellar P-ring protein FlgI [Verrucomicrobiae bacterium DG1235]
 gi|198260037|gb|EDY84345.1| flagellar P-ring protein FlgI [Verrucomicrobiae bacterium DG1235]
          Length = 365

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 154/352 (43%), Positives = 229/352 (65%), Gaps = 15/352 (4%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KD+VS++ GRDNQL+GYGLVVGL G GDS  SSP T  ++ + L+  G++     + S
Sbjct: 22  RVKDLVSVEGGRDNQLVGYGLVVGLAGDGDS--SSPMTINAVANSLRRFGLTVDAEEIKS 79

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           +NVAAVM+TA++PPFA  G+RIDV+++S+GDA SL+GG+L+ T L+GAD  +YAVAQG +
Sbjct: 80  ENVAAVMITADIPPFAREGTRIDVTVSSIGDAESLQGGVLLQTPLMGADEAVYAVAQGQI 139

Query: 145 ---VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
                 G       ++  +   T G I NGAIVERE+  +      + L LRNPD++TA 
Sbjct: 140 AVGGYIGGGGGAGGATVQKNHPTVGSISNGAIVEREIEMEVGKGGFVKLILRNPDYNTAS 199

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR---LMSEVEMLTVETDTPARV 258
           ++A+ IN      F      A D+  V+++ P  I L R    +S V  +++E DTPAR+
Sbjct: 200 KLAEGINVI----FPSSTI-ALDAAAVQITIP-EIYLGREVDFISSVGGISIEPDTPARI 253

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           IINERTGTIV    VR+S V VS+G+L++ I  ++ + QP  FS  G T     T+L+V 
Sbjct: 254 IINERTGTIVATAGVRVSTVAVSHGSLSLTIARSQNISQPGPFSQTGETAVAEGTELEVV 313

Query: 319 DNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +  G+F +I D P +  + + +N++G+ T  ++SILQ +K+AGALQ+E++I+
Sbjct: 314 EELGAFHIIPDYPTIQQVTNALNAMGVSTREMMSILQAMKSAGALQAELVIK 365


>gi|126734124|ref|ZP_01749871.1| flagellar P-ring protein FlgI [Roseobacter sp. CCS2]
 gi|126716990|gb|EBA13854.1| flagellar P-ring protein FlgI [Roseobacter sp. CCS2]
          Length = 368

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 155/372 (41%), Positives = 235/372 (63%), Gaps = 17/372 (4%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           +  +F  + L  ++A    RIKD+V     R N L+GYGLVVGL GTGD LR+SPFTE  
Sbjct: 6   SLCLFVALLLPNLTAANPVRIKDLVEFDGVRSNDLVGYGLVVGLNGTGDGLRNSPFTEDI 65

Query: 66  MRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           + ++L+ LG++  G +    NVAAV+VT  LPPFA  GS +D++++++GDA SL GG L+
Sbjct: 66  LGNVLERLGVNVTGEQFRPNNVAAVLVTGELPPFARAGSALDITVSAIGDADSLLGGTLI 125

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MT +  ADG+IYAVAQG+++  G    G  ++ ++G+ T G I +GA +ERE+   F   
Sbjct: 126 MTPMKAADGDIYAVAQGTIIAGGASAAGDGAAVIQGVPTAGVIPSGATIEREITFDFSSL 185

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMS-- 243
             + + LR PDF+TA RI   IN+     FS  +A   D+ TV++S P     T++ S  
Sbjct: 186 HTIRMALRTPDFTTADRIERAINA----EFSGAVAVMLDAGTVELSIPA----TKMRSPA 237

Query: 244 ----EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
                VE + V+ +  ARV++++R+GTIV+G++VRIS+V VS GNLT++I E   V QPN
Sbjct: 238 HALVRVENIMVQPERRARVVVDQRSGTIVMGEDVRISRVAVSQGNLTLRIQEAPLVAQPN 297

Query: 300 AFSSNGSTVTQNNTDLKVSDNKG-SFSLID-APDLNSLISGMNSIGLKTDGIISILQGIK 357
            F + G TV    TD+ V +  G   + +D    L+ +++G+N++G+    +I IL+ IK
Sbjct: 298 PF-AEGETVIVPRTDVDVIEEPGIGLAEVDGGTSLSEVVAGLNALGVAPRDMIDILKSIK 356

Query: 358 AAGALQSEIIIQ 369
           A+GAL +E I++
Sbjct: 357 ASGALHAEFIVR 368


>gi|91225877|ref|ZP_01260846.1| flagellar P-ring protein precursor I [Vibrio alginolyticus 12G01]
 gi|91189527|gb|EAS75803.1| flagellar P-ring protein precursor I [Vibrio alginolyticus 12G01]
          Length = 363

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 158/367 (43%), Positives = 226/367 (61%), Gaps = 14/367 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+   + L    AQ  +RIKDV  +   R NQL+GYGLV GL GTG++   +PFTEQS 
Sbjct: 5   LLVLMSVALFSTVAQA-ARIKDVAQVAGVRSNQLVGYGLVSGLPGTGEA---NPFTEQSF 60

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRGG L+
Sbjct: 61  AAMLQNFGIQMPPGTKPKIKNVAAVMVTAELPPFSKPGQQVDVTVSSIGSAKSLRGGTLL 120

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKD 184
            T L G DG +YAVAQG++VVSG   +G   S + G + T G I +GA VERE+P  F  
Sbjct: 121 QTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPNPFGR 180

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMS 243
              +   L   DF+TA R+AD +N++        +A A D+ +V+V  P ++      +S
Sbjct: 181 GDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDVSQRVAFLS 236

Query: 244 EVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN F 
Sbjct: 237 AIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPNGF- 295

Query: 303 SNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S G TV   ++DL+VS+ +G  F       L+ L+  +N +G     +++ILQ +K AGA
Sbjct: 296 SGGQTVVVPDSDLEVSEEQGKMFKFEPGLTLDDLVRAVNQVGAAPSDLMAILQALKQAGA 355

Query: 362 LQSEIII 368
           ++ ++II
Sbjct: 356 IEGQLII 362


>gi|269965420|ref|ZP_06179539.1| flagellar P-ring protein FlgI [Vibrio alginolyticus 40B]
 gi|269829899|gb|EEZ84129.1| flagellar P-ring protein FlgI [Vibrio alginolyticus 40B]
          Length = 363

 Score =  265 bits (677), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 158/367 (43%), Positives = 226/367 (61%), Gaps = 14/367 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            LI   + L    AQ  +RIKDV  +   R NQL+GYGLV GL GTG++   +PFTEQS 
Sbjct: 5   LLILMSVALFSTVAQA-ARIKDVAQVAGVRSNQLVGYGLVSGLPGTGEA---NPFTEQSF 60

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRGG L+
Sbjct: 61  AAMLQNFGIQMPPGTKPKIKNVAAVMVTAELPPFSKPGQQVDVTVSSIGSAKSLRGGTLL 120

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKD 184
            T L G DG +YAVAQG++VVSG   +G   S + G + T G I +GA VERE+P  F  
Sbjct: 121 QTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPNPFGR 180

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMS 243
              +   L   DF+TA R+AD +N++        +A A D+ +V+V  P ++      +S
Sbjct: 181 GDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDVSQRVAFLS 236

Query: 244 EVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN F 
Sbjct: 237 AIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPNGF- 295

Query: 303 SNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S G TV   ++D++VS+ +G  F       L+ L+  +N +G     +++ILQ +K AGA
Sbjct: 296 SGGQTVVVPDSDIEVSEEQGKMFKFEPGLTLDDLVRAVNQVGAAPSDLMAILQALKQAGA 355

Query: 362 LQSEIII 368
           ++ ++II
Sbjct: 356 IEGQLII 362


>gi|91204380|emb|CAJ70880.1| strongly similar to flagellar P-ring protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 385

 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 145/363 (39%), Positives = 221/363 (60%), Gaps = 11/363 (3%)

Query: 11  SLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLL 70
           +LI L     Q   RIKD+  +Q  R+NQL GYG+V+GLQGTGD+ +    T Q   ++ 
Sbjct: 28  TLISLFVHHVQAAVRIKDIAYVQGVRENQLYGYGIVIGLQGTGDNSQIFKLTSQMAVNIF 87

Query: 71  QNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLL 130
           + LG+        SKN A VMVT N+P FA PG ++D++++S+GD  SL GG+L+ T+L 
Sbjct: 88  EKLGVLMDEKDFFSKNTAVVMVTTNIPAFARPGDKLDITLSSIGDCKSLEGGVLLQTALQ 147

Query: 131 GADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLIL 190
           GAD  +YAVAQG++ V G  +KG + S  + IST   I NGAIVE+E+   F     L +
Sbjct: 148 GADNEVYAVAQGALTVGGYSIKGDAQSVRKNISTTAHISNGAIVEKEIHTTFLKGQALNI 207

Query: 191 QLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID----LTRLMSEVE 246
            LR+PDF+T+ R+ + IN+   N      + A D+  + +  P        + + +S +E
Sbjct: 208 VLRDPDFTTSTRVTELINNIYPNS-----SVAVDAAVINIRPPQGFQSDETIVKFISTLE 262

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            L ++TD+ A++IINERTGTIV   +VRIS V V++GNL++ I E ++V QPN   + G 
Sbjct: 263 ELYIKTDSVAKIIINERTGTIVADQHVRISTVAVAHGNLSITIKEEKEVSQPNMLGA-GE 321

Query: 307 TVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSE 365
           T     TD++VS+ K   +++ +   ++ +   +N +G+    +ISI Q IK AGAL +E
Sbjct: 322 TRDMARTDIQVSEEKSRLTVLQEGVSISDVARALNVLGVTPRDLISIFQAIKKAGALHAE 381

Query: 366 III 368
           ++I
Sbjct: 382 LVI 384


>gi|116626487|ref|YP_828643.1| flagellar basal body P-ring protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229649|gb|ABJ88358.1| flagellar P-ring protein [Candidatus Solibacter usitatus Ellin6076]
          Length = 367

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 156/347 (44%), Positives = 214/347 (61%), Gaps = 10/347 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +R+KD+V+++  RDNQLIGYGLVVGL GTGD  R + F+ QS+ ++L+ LG+S P   + 
Sbjct: 24  ARLKDLVAIEGVRDNQLIGYGLVVGLAGTGDR-RQALFSAQSLTNMLERLGVSVPPAAIR 82

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
             N AAVMVTA LP FA PG  ID++  ++GDAS+L+GGILV+TSL GADG +YA+AQG 
Sbjct: 83  VNNTAAVMVTATLPAFAQPGMHIDITAAAIGDASNLQGGILVLTSLRGADGLVYAIAQGP 142

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+  G       SS      T G+   G  VER  P     SA + LQ+R+ DF+TA RI
Sbjct: 143 VMTGGFSAGRGGSSQTVNHPTVGRAPAGGTVERVAPSLAPKSA-IRLQIRHSDFTTASRI 201

Query: 204 ADQINSYSLNRFS--RPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTPARVI 259
              +N     RF+  +P+A A +S  V V+ PT     +T  ++E+E L VE D PARV+
Sbjct: 202 VAALN----QRFTGDKPVARAENSGLVTVTVPTGYTARVTDFIAELESLDVEADRPARVV 257

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           INERTGTIVIG +VRI+ V + +GNL+V+I    QV QPNA     + V    T     +
Sbjct: 258 INERTGTIVIGKDVRIAPVAILHGNLSVEIQTTMQVTQPNALGQGTTEVVPQTTMTAKEE 317

Query: 320 NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              S  L     +  L+  + +IG     +I+ILQ +++AGAL +EI
Sbjct: 318 KARSVLLKQGATVEELVRALAAIGSTPRDVIAILQNLRSAGALDAEI 364


>gi|323495373|ref|ZP_08100450.1| flagellar basal body P-ring protein [Vibrio brasiliensis LMG 20546]
 gi|323310296|gb|EGA63483.1| flagellar basal body P-ring protein [Vibrio brasiliensis LMG 20546]
          Length = 365

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 229/373 (61%), Gaps = 14/373 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ +  FL+ + + +   SAQ  +RIKDV  +   R NQL+GYGLV GL GTG+S   +P
Sbjct: 1   MVMKKLFLLITSLLVIATSAQA-ARIKDVAQVAGVRSNQLVGYGLVTGLPGTGES---TP 56

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+QS  ++LQN GI  P G +  SKNVAAV+VTA LP F+  G  IDV+++S+G A SL
Sbjct: 57  FTDQSFNAMLQNFGIQMPPGTKPKSKNVAAVIVTAELPAFSKQGQTIDVTVSSIGSAKSL 116

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVEREL 178
           RGG L+ T L G DG IYAVAQG++VVSG    G   S + G + T G I NGA+VERE+
Sbjct: 117 RGGTLMQTMLKGLDGQIYAVAQGNLVVSGFSATGADGSKIVGNNPTAGMISNGAMVEREI 176

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     +   L   DF+TA R+AD +N++        +A A D+ +VKV  P ++  
Sbjct: 177 PTPFSRGDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVKVRAPRDVTQ 232

Query: 238 LTRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E +     +  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V 
Sbjct: 233 RVAFLSAIENIEFNPAEGSAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVS 292

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPNAF   G TV   +TD++V++ +G  F       L+ L+  +N +G     +++ILQ 
Sbjct: 293 QPNAF-GGGETVVVPDTDIEVTEEQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQA 351

Query: 356 IKAAGALQSEIII 368
           +K AGA++ ++I+
Sbjct: 352 LKQAGAIEGQLIV 364


>gi|304310889|ref|YP_003810487.1| Flagellar P-ring protein [gamma proteobacterium HdN1]
 gi|301796622|emb|CBL44834.1| Flagellar P-ring protein [gamma proteobacterium HdN1]
          Length = 367

 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 149/348 (42%), Positives = 212/348 (60%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           R+KD+V +Q  R+NQLIGYGLVVGL GTGD    +PFT Q+ ++++   GIS P      
Sbjct: 23  RLKDIVDIQGVRENQLIGYGLVVGLNGTGDKTSQTPFTVQTFKNMMAQFGISVPPNLEPK 82

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV V ANLP FA PG +ID++++SLG+A+SLRGG L+MT L GADG +YAVAQG 
Sbjct: 83  LKNVAAVSVNANLPAFAKPGQKIDITVSSLGNATSLRGGTLLMTPLKGADGRVYAVAQGE 142

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G   +G   S +   + + G+I +GA VE   P  F+    L   LRNPDF+TA R
Sbjct: 143 LVVGGFGAEGADGSKITVNVPSAGRIPSGATVEVASPNPFQTGNTLTFNLRNPDFTTARR 202

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-ARVII 260
           I D IN        +  A++ D  +++V+ P +       +S +E L +    P A+VII
Sbjct: 203 ITDSINQM----LGQGTAKSLDGASIQVAAPADPSQKVMFLSVLENLEISPGEPSAKVII 258

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTGTIVIG  V++    +S+GNLTV I+EN QV QPNA     + V   +      +N
Sbjct: 259 NSRTGTIVIGSAVKVFPAAISHGNLTVTISENTQVSQPNALGGGATVVAPQSQVDATQEN 318

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              F       L+ ++  +N +G+    +++IL+ +K AGAL++E+I+
Sbjct: 319 NRMFLFEAGTTLDDIVRAVNRVGVAPGDLMAILEALKQAGALRAELIV 366


>gi|167623365|ref|YP_001673659.1| flagellar basal body P-ring protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167353387|gb|ABZ76000.1| flagellar P-ring protein [Shewanella halifaxensis HAW-EB4]
          Length = 364

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 155/373 (41%), Positives = 226/373 (60%), Gaps = 16/373 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M  ++  L   L+    + AQ   RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   
Sbjct: 2   MKLKLVLLCAMLVLTTPVHAQ---RIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTR--- 55

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+ +++L+N GI+ P   R   KN+A V V+A++PPF  PG  +DV+++SLG+A SL
Sbjct: 56  YTEQTFKTMLKNFGINLPDNFRPKIKNIAVVAVSADMPPFIKPGQTLDVTVSSLGEAKSL 115

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVEREL 178
           RGG+L+ T L G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGAI+ER +
Sbjct: 116 RGGMLLQTFLKGVDGNVYAIAQGSMVVSGFSAEGMDGSKVIQNTPTVGRIPNGAIIERTV 175

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R+AD IN       +RP+    D+ +V+VS P ++  
Sbjct: 176 ATPFSTGDHLTFNLRRADFSTAKRLADSINDLLGPGMARPL----DAASVQVSAPRDVSQ 231

Query: 238 LTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E + VE     A+VI+N RTGTIV+G NV++    V++G LTV I E  QV 
Sbjct: 232 RVSFLATLENIEVEPAAESAKVIVNSRTGTIVVGQNVKLLPAAVTHGGLTVTIAEATQVS 291

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQG 355
           QPN F  NG TV   ++ + V++      + +    L+ L+  +N +G     +++IL+ 
Sbjct: 292 QPNPF-GNGQTVVTTDSTIDVAEEDSRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEA 350

Query: 356 IKAAGALQSEIII 368
           +K AGAL  E+II
Sbjct: 351 LKMAGALHGELII 363


>gi|90408063|ref|ZP_01216234.1| flagellar P-ring protein precursor [Psychromonas sp. CNPT3]
 gi|90310820|gb|EAS38934.1| flagellar P-ring protein precursor [Psychromonas sp. CNPT3]
          Length = 366

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 224/368 (60%), Gaps = 15/368 (4%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           IAFL+    G     A   +RIKD+ S+Q  R NQL+GYGLVVGL GTG+  +SS FTEQ
Sbjct: 9   IAFLLLIFSG-----ASYSARIKDIASVQGVRSNQLVGYGLVVGLPGTGE--KSSKFTEQ 61

Query: 65  SMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           +  ++L+N GI+ P G +L  KNVA V +TA L  FA  G +ID++++++G+A SLRGG 
Sbjct: 62  AFATMLRNFGINIPIGEKLKIKNVAPVAITAELKAFAKRGQKIDITVSAIGEAKSLRGGE 121

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKF 182
           L+ T L G DGN+YA+AQGSVVV GL  +G   S  +    T G+I NGAIVERE+   F
Sbjct: 122 LLQTFLKGVDGNVYAIAQGSVVVGGLGAEGADGSKVVINTPTVGRIANGAIVEREVVSPF 181

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRL 241
                +   L   DF+TA R+AD IN    N      A   D+ +V+V  P NI      
Sbjct: 182 SHGDTITFNLHESDFTTAKRMADTIN----NLVGANTATLLDATSVRVLAPRNISQRVSY 237

Query: 242 MSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           MS +E L  E     A++I+N RTGTIVIG +V++    +++G ++V I+EN+ V QPNA
Sbjct: 238 MSTLENLEFEPARGAAKIIVNSRTGTIVIGQDVKLLPTAITHGGISVTISENKTVTQPNA 297

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            +   + VT N+T    +++   F+      LN L+  +N +GL    +++IL+ +K AG
Sbjct: 298 LAGGKTKVTDNSTITITNEDSRMFTFDTGVSLNDLVRAVNQVGLAPGDLMAILEALKQAG 357

Query: 361 ALQSEIII 368
           ALQ E+II
Sbjct: 358 ALQGELII 365


>gi|294140189|ref|YP_003556167.1| flagellar P-ring protein FlgI [Shewanella violacea DSS12]
 gi|293326658|dbj|BAJ01389.1| flagellar P-ring protein FlgI [Shewanella violacea DSS12]
          Length = 363

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 224/373 (60%), Gaps = 16/373 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M ++  +L+          AQ   RIKD+ ++Q  R NQLIGYG+VVGL GTG+  R   
Sbjct: 1   MKYKFIYLLLLFFVAGPSQAQ---RIKDIANVQGVRHNQLIGYGMVVGLPGTGEKTR--- 54

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+ +++L+N GI+ P   R   KN+A V V A++PPF  PG  +DV+++SLG+A SL
Sbjct: 55  YTEQTFKTMLKNFGINLPDNFRPKIKNIAVVAVHADMPPFIKPGQTLDVTVSSLGEAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T L G DGN+YA+AQGS+VVSG   +G   S  +    T G+I NGAI+ER +
Sbjct: 115 RGGTLIQTFLKGVDGNVYAIAQGSMVVSGFSAEGLDGSKVIRNTPTVGRIPNGAIIERAV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R+AD IN       +RP+    D+ +V+VS P ++  
Sbjct: 175 ATPFSSGDYLTFNLRRADFSTAKRLADAINELLGPGMARPL----DAASVQVSAPRDVSQ 230

Query: 238 LTRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E + VE  D  A+VI+N RTGTIV+G NVR+    V++G LTV I E  QV 
Sbjct: 231 RVSFLATLENIQVEPADESAKVIVNSRTGTIVVGKNVRLLAAAVTHGGLTVTIAEATQVS 290

Query: 297 QPNAFSSNGSTVTQNNT-DLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPNA +   + VT ++T D+  SD +  F       L+ L+  +N +G     +++IL+ 
Sbjct: 291 QPNALAGGQTVVTTDSTIDVNESDRR-MFLFSPGTTLDELVRAVNLVGAAPSDVLAILEA 349

Query: 356 IKAAGALQSEIII 368
           +K AGAL  E+II
Sbjct: 350 LKVAGALHGELII 362


>gi|262276413|ref|ZP_06054222.1| flagellar P-ring protein FlgI [Grimontia hollisae CIP 101886]
 gi|262220221|gb|EEY71537.1| flagellar P-ring protein FlgI [Grimontia hollisae CIP 101886]
          Length = 363

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 156/368 (42%), Positives = 223/368 (60%), Gaps = 13/368 (3%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           ++L   LI L    A   +RIKDV  +   R NQL+GYGLVVGL GTG+S   +PFT+QS
Sbjct: 3   SWLKLFLIALLIAPAAQAARIKDVSEVAGVRSNQLVGYGLVVGLAGTGES---TPFTDQS 59

Query: 66  MRSLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
             ++L+N GI   PG +  +KNVAAV V+A LPPFA  G +ID++++S+G A SLRGG L
Sbjct: 60  FNAMLKNFGIQLPPGTKPKTKNVAAVAVSAELPPFAKQGQKIDITVSSIGSAKSLRGGTL 119

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           V T L G DG +YAVAQG+++V G   +G   SS +    T G++ NGA VE+E+P  F 
Sbjct: 120 VQTFLKGLDGKVYAVAQGNLIVGGFSAEGADGSSIVGNTPTVGRVTNGATVEQEVPSPFG 179

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               +   L   DF+TA R+AD INS+         A A D+ +V+V  P ++      +
Sbjct: 180 RGDHITFNLFESDFTTAQRMADSINSF----LGPNTASAMDAASVRVRAPRDLSQRVAFL 235

Query: 243 SEVEMLT-VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S VE L  V  D  A++I+N RTGTIV+G NVR+    +++G +TV I EN QV QP AF
Sbjct: 236 STVENLEFVPADAAAKIIVNSRTGTIVVGQNVRLRPAAITHGGMTVTINENLQVSQPGAF 295

Query: 302 SSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            S G TV   ++ ++V++  G  F       L+ L+  +N +G     +++ILQ +K AG
Sbjct: 296 -SGGETVVVPDSGVEVTEEDGRMFHFKPGVTLDDLVRAVNGVGAAPSDLMAILQALKQAG 354

Query: 361 ALQSEIII 368
           A+  ++I+
Sbjct: 355 AIDGQLIV 362


>gi|157961175|ref|YP_001501209.1| flagellar basal body P-ring protein [Shewanella pealeana ATCC
           700345]
 gi|157846175|gb|ABV86674.1| flagellar P-ring protein [Shewanella pealeana ATCC 700345]
          Length = 364

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 155/363 (42%), Positives = 223/363 (61%), Gaps = 14/363 (3%)

Query: 12  LIGLHEISAQV-VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLL 70
           L  +  +SA V   RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   +TEQ+ +++L
Sbjct: 9   LCAILALSAPVHAQRIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTR---YTEQTFKTML 65

Query: 71  QNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSL 129
           +N GI+ P   R   KN+A V V+A +PPF  PG  +DV+++SLG+A SLRGG+L+ T L
Sbjct: 66  KNFGINLPDNFRPKIKNIAVVAVSAEMPPFIKPGQTLDVTVSSLGEAKSLRGGMLLQTFL 125

Query: 130 LGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADL 188
            G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGAI+ER +   F     L
Sbjct: 126 KGVDGNVYAIAQGSMVVSGFSAEGMDGSKVVQNTPTVGRIPNGAIIERTVATPFSTGDHL 185

Query: 189 ILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEM 247
              LR  DFSTA R+AD IN       +RP+    D+ +V+VS P ++      ++ +E 
Sbjct: 186 TFNLRRADFSTAKRLADSINDLLGPGMARPL----DAASVQVSAPRDVSQRVSFLATLEN 241

Query: 248 LTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
           + VE     A+VI+N RTGTIV+G NV++    V++G LTV I E  QV QPNAF  NG 
Sbjct: 242 IEVEPAAESAKVIVNSRTGTIVVGQNVKLLPAAVTHGGLTVTIAEATQVSQPNAF-GNGQ 300

Query: 307 TVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSE 365
           TV   ++ + V++      + +    L+ L+  +N +G     +++IL+ +K AGAL  E
Sbjct: 301 TVVTTDSTIDVAEEDSRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEALKMAGALHGE 360

Query: 366 III 368
           +II
Sbjct: 361 LII 363


>gi|224370757|ref|YP_002604921.1| FlgI [Desulfobacterium autotrophicum HRM2]
 gi|223693474|gb|ACN16757.1| FlgI [Desulfobacterium autotrophicum HRM2]
          Length = 378

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 158/371 (42%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           IF + F++FS I     +AQ  +RIKD+ +++  R NQL GYGL+VGL GTGD    + F
Sbjct: 18  IFFLTFVLFSGIK----TAQG-ARIKDLAAIKGIRSNQLTGYGLIVGLDGTGDK-SGADF 71

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T Q++ +++  +GI      L  KN+AAV+VTA++P FA  G++IDV  +S+GDA SL G
Sbjct: 72  TTQALANMMDRMGIHVDKDELSVKNIAAVIVTADIPAFARIGNKIDVVASSIGDAKSLSG 131

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L++T L G DG +YA+AQG V + G+   G   S  +      +I NGA VERE+P  
Sbjct: 132 GTLLLTPLKGVDGQVYALAQGPVTLGGVGAGGARGSTQKNHLQVARIANGASVEREIPVV 191

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID---L 238
                 LIL L NPDF+TA R+AD IN+         +AEA DS  ++++ P N+    +
Sbjct: 192 LDGKKALILSLFNPDFTTAKRVADTINA----SIGDGVAEAVDSSALRLNIPENMQESKV 247

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
              ++++E L++  DT A+V++NE+TGT+VIG+NV IS V V++GNLTV I ++ +V QP
Sbjct: 248 AEFLADIETLSIVPDTRAKVVVNEKTGTVVIGENVTISTVAVAHGNLTVTIKKSSEVSQP 307

Query: 299 NAFSSNGSTVTQNNTDLKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            +F + G T+T +  D+ V +       L     +  L+ G+NSIG+    +I+ILQ IK
Sbjct: 308 ESF-TQGETITTSQRDVAVDEEAVKVMPLPGGATIGELVKGLNSIGVSPRDLITILQSIK 366

Query: 358 AAGALQSEIII 368
           AAGALQ+E+ I
Sbjct: 367 AAGALQAELEI 377


>gi|238782796|ref|ZP_04626825.1| Flagellar P-ring protein [Yersinia bercovieri ATCC 43970]
 gi|238716219|gb|EEQ08202.1| Flagellar P-ring protein [Yersinia bercovieri ATCC 43970]
          Length = 373

 Score =  263 bits (673), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 152/370 (41%), Positives = 230/370 (62%), Gaps = 9/370 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +   ++     LI L    AQ   RI+D+ +LQ  R N L+GYGLVVGL GTGD    +P
Sbjct: 6   LTLCLSLFFTGLIFLVPQDAQA-ERIRDLTTLQGVRSNSLMGYGLVVGLDGTGDQTMQTP 64

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  +NVAAVMVTA LPPF+ PG +IDV ++SLG+A SL
Sbjct: 65  FTTQSLSNMLSQLGITVPPGTNMQLRNVAAVMVTAELPPFSRPGEKIDVVVSSLGNAKSL 124

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  IYA+AQG+++VSG   +   +        G +I  GA VERE+P
Sbjct: 125 RGGTLLMTPLKGVDNQIYALAQGNLLVSGAGAQSGGNRVQVNQLNGARISGGASVEREVP 184

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDL 238
             F +   L LQL   DFS A +++D IN     R    +A A DSRT+K++ PT+    
Sbjct: 185 VSFANENILRLQLNEDDFSVAQKMSDAIN----RRLGGGVAMAEDSRTIKLNAPTDSAAK 240

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R ++EV+ + ++ D   A+VIIN RTG++V+  +V +    V+ G+LTV++++  +V Q
Sbjct: 241 VRFLAEVQDIPIQIDIMDAKVIINSRTGSVVMNRHVVLDACAVAQGDLTVEVSQTNEVSQ 300

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGI 356
           PN   + G TV   NT++ + +  G    ++ + DLN++I  +N++G   + ++SILQ +
Sbjct: 301 PNTPLAGGQTVVTPNTEISIREQNGYLQRVNTSADLNNVIRALNNLGATPNDLMSILQSM 360

Query: 357 KAAGALQSEI 366
           K+AG L++++
Sbjct: 361 KSAGCLRAKL 370


>gi|222053735|ref|YP_002536097.1| flagellar P-ring protein [Geobacter sp. FRC-32]
 gi|221563024|gb|ACM18996.1| flagellar P-ring protein [Geobacter sp. FRC-32]
          Length = 364

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 150/345 (43%), Positives = 217/345 (62%), Gaps = 9/345 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+ +    RDNQL+GYGLVVGL G+GDS ++  F  QS+ + L+ +GI+     +  
Sbjct: 23  RIKDIAAFDGVRDNQLLGYGLVVGLNGSGDSDQTK-FPVQSLVNTLERMGITINRADITV 81

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAVMVTA+LPPFA  G+ +DV ++S+GDA SL GG L+MT L G D  IYAVAQG+V
Sbjct: 82  KNVAAVMVTASLPPFAKQGNTLDVLVSSVGDAKSLAGGTLLMTPLKGGDSQIYAVAQGAV 141

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           + +     GQ++S  +   T G++  GA+VERELP        L L L  PDF+TA RIA
Sbjct: 142 LTNSFSYGGQAASVQKNHPTAGRVPAGALVERELPNVLAGRNVLRLNLHQPDFTTASRIA 201

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIINE 262
             +N     +F   +A   D  +V+++ P          ++E+E L V  D  A+V++NE
Sbjct: 202 AAVNG----KFKAQVASLTDPGSVQLAMPDGFIGRPVEFVAELERLEVTPDVMAKVVLNE 257

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGTIVIG+NVRIS V VS+GNLT+ + E  +V QP    + G T     T +KV + +G
Sbjct: 258 RTGTIVIGENVRISAVAVSHGNLTLYVKETPKVSQPAPLGT-GETKVVPRTSVKVKEERG 316

Query: 323 SFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           S +++    +++ ++  +N++G+    +I I+Q IKAAGAL +E+
Sbjct: 317 SLAIVPQGTNISDVVRALNALGVTPRDLIGIMQAIKAAGALNAEL 361


>gi|327480024|gb|AEA83334.1| flagellar basal body P-ring protein [Pseudomonas stutzeri DSM 4166]
          Length = 375

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 157/358 (43%), Positives = 216/358 (60%), Gaps = 14/358 (3%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
            SA    R+KDV ++   R NQLIGYGLVVGL G+GD    +PFT Q+  ++L   GI  
Sbjct: 24  CSAAQAERLKDVATIHGVRSNQLIGYGLVVGLNGSGDQTTQTPFTVQTFNNMLAQFGIKV 83

Query: 78  P-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
           P GG +  KNVAAV + A LPPFA PG  ID++++S+G+A SLRGG L+M  L G DGN+
Sbjct: 84  PAGGNIQLKNVAAVSIHAELPPFAKPGQTIDITVSSIGNAKSLRGGSLLMAPLKGIDGNV 143

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           YAVAQG++VV G    G   S +   S + G+I  GA VER +P  F     L L L  P
Sbjct: 144 YAVAQGNLVVGGFDASGADGSRITVNSPSAGRIPGGATVERPVPSGFNQGNTLTLNLNRP 203

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR---LMSEVEMLTVET 252
           DF+TA  I DQIN          +A+A D  ++ V+ P  +D ++    +S +E L VE 
Sbjct: 204 DFTTAKNIVDQINDL----LGPGVAQALDGGSISVTAP--LDPSQRVDYLSILENLEVEV 257

Query: 253 DTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
               A+VIIN RTGTIVIG NVR+    V++G+LTV ITE+ QV QP  F S+G TV   
Sbjct: 258 GQAVAKVIINSRTGTIVIGQNVRVQPAAVTHGSLTVTITEDPQVSQPEPF-SDGQTVVVP 316

Query: 312 NTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           N+ +K  +  K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 317 NSKVKAEEEAKPMFKFGPGTTLDEIVRAVNQVGAAPSDLMAILEALKQAGALQADLIV 374


>gi|15606794|ref|NP_214174.1| flagellar basal body P-ring protein [Aquifex aeolicus VF5]
 gi|6225346|sp|O67608|FLGI_AQUAE RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|2984028|gb|AAC07571.1| flagellar P-ring protein FlgI [Aquifex aeolicus VF5]
          Length = 360

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 146/343 (42%), Positives = 218/343 (63%), Gaps = 7/343 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+ +++  R N LIGYGLVVGL+GTGD  +++ FT QS+ ++L+ +GI     R+ 
Sbjct: 22  ARIKDIATIEGNRYNYLIGYGLVVGLKGTGDG-KATQFTVQSLANMLRRMGIPVDPRRIT 80

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA +PP+A  G R DV ++S+GDA SL GG L+MT L G DG +YA+AQG 
Sbjct: 81  VKNVAAVMVTAKVPPYAKAGMRFDVEVSSIGDAKSLEGGTLLMTPLRGPDGKVYAIAQGQ 140

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+V G   +G+ ++ ++ + T G+I NGAI+E++LP    D  ++ + L  PDF+TA  +
Sbjct: 141 VIVGGYEARGRGAAQVKNVPTVGRIPNGAILEKDLPFS-ADFKEVNIYLDEPDFTTAKNV 199

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
            D IN      F + IA+A DS T++V  P        +++VE L V T + A+V+I+ R
Sbjct: 200 QDVIN----RAFGKNIAKAVDSATIRVKIPEGYSPVDFLAKVENLEVSTSSVAKVVIDGR 255

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           +G +++G NV I  V V+ G+L V+I E  +VVQP   S  G T     T++KV + K  
Sbjct: 256 SGIVLLGGNVSIEPVAVAVGSLVVEIKERPEVVQPPPLSP-GETKVVPRTEVKVKEEKKR 314

Query: 324 FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              I    ++ L+  +NSIG     II +LQ IK+AGAL++++
Sbjct: 315 LVQIKGTTVSELVDALNSIGATPREIIQVLQAIKSAGALKAKL 357


>gi|163750566|ref|ZP_02157804.1| flagellar P-ring protein precursor [Shewanella benthica KT99]
 gi|161329721|gb|EDQ00710.1| flagellar P-ring protein precursor [Shewanella benthica KT99]
          Length = 363

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 155/371 (41%), Positives = 226/371 (60%), Gaps = 14/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +  F+ F L+      +Q   RIKD+ ++Q  R NQLIGYG+VVGL GTG+  R   +T
Sbjct: 1   MKYKFITFLLLVFVAAPSQA-QRIKDMANVQGVRHNQLIGYGMVVGLPGTGEKTR---YT 56

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQ+ +++L+N G++ P   R   KNVA V+V A++PPF  PG  IDV+++S+G+A SLRG
Sbjct: 57  EQTFKTMLKNFGVNLPDNFRPKIKNVAVVVVHADMPPFIKPGQTIDVTVSSMGEAKSLRG 116

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DG++YA+AQGS+VVSG   +G   S  M+   T G+I NGAIVER +  
Sbjct: 117 GTLIQTFLKGVDGHVYAIAQGSMVVSGFSAEGLDGSKVMQNTPTVGRIPNGAIVERAVAT 176

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     L   LR  DFSTA R+AD IN       +RP+    D+ +++VS P ++    
Sbjct: 177 PFSSGDYLTFNLRRADFSTAKRLADAINDLLGPGIARPL----DAASIQVSAPRDVSQRV 232

Query: 240 RLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++ +E + VE  +  A++I+N RTGTIV+G NVR+    V++G LTV I E  QV QP
Sbjct: 233 SFLATLENIQVEPAEESAKIIVNSRTGTIVVGKNVRLLPAAVTHGGLTVTIAEATQVSQP 292

Query: 299 NAFSSNGSTVTQNNT-DLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           NA +   + VT ++T D+  SD +  F       L+ L+  +N +G     +++IL+ + 
Sbjct: 293 NALAGGQTVVTSDSTLDVNESDRR-MFMFNPGTTLDELVRAVNLVGAAPSDVLAILEALN 351

Query: 358 AAGALQSEIII 368
            AGALQ E+II
Sbjct: 352 VAGALQGELII 362


>gi|254516993|ref|ZP_05129051.1| flagellar P-ring protein FlgI [gamma proteobacterium NOR5-3]
 gi|219674498|gb|EED30866.1| flagellar P-ring protein FlgI [gamma proteobacterium NOR5-3]
          Length = 370

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 148/349 (42%), Positives = 221/349 (63%), Gaps = 9/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+  +   R NQL+GYGLVVGL G+GD +  +PFT QS++S+L  LG++ P      
Sbjct: 25  RIKDIAGIAGVRANQLVGYGLVVGLDGSGDQVIQAPFTIQSLKSMLAQLGVNVPANVNPQ 84

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KN+A VMVTA LPPF  PG  IDV+++SL +A SLRGG L+MT L G DG  YA+AQGS
Sbjct: 85  LKNIATVMVTAELPPFTKPGQTIDVTVSSLANAKSLRGGQLLMTPLKGPDGETYAIAQGS 144

Query: 144 VVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++VSG   +G   SS    + + G+I NGAIVER +P  F     +++ L +PDF+TA R
Sbjct: 145 MIVSGFGAEGSDGSSVTVNVPSAGRIPNGAIVERGVPSPFGTEPVMVMNLNSPDFTTAQR 204

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETD-TPARVII 260
           +A  IN+      +RP+    D+ +++V  P +  D    +S +E L V+     A+V++
Sbjct: 205 VAMSINASMGEGIARPM----DAVSIEVQAPRDPGDKVAFVSILENLQVDPGAAAAKVVV 260

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS-D 319
           N R GTIVIGD+VR+ +  V++GNLTV I+E+  V QP AF+  G T    ++++ ++ +
Sbjct: 261 NSRNGTIVIGDSVRVERAAVAHGNLTVTISESINVSQPGAFAGGGQTAITPDSEVSLTEE 320

Query: 320 NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           N   F L     L  L+S +N +G     +I+IL+ ++ AGAL++++I+
Sbjct: 321 NSRMFLLEPGITLQELVSAVNKVGAAPGDLIAILEALQQAGALRAQLIV 369


>gi|312882655|ref|ZP_07742392.1| flagellar basal body P-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309369616|gb|EFP97131.1| flagellar basal body P-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 363

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 157/352 (44%), Positives = 220/352 (62%), Gaps = 17/352 (4%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RL 82
           +RIKDV  +   RDNQLIGYGLV GL G+G+S   +PFT+QS  ++LQ+ GI  P G + 
Sbjct: 21  ARIKDVSRVAGVRDNQLIGYGLVTGLPGSGES---TPFTDQSFIAMLQSFGIQLPAGTKP 77

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKN+AAVMVTA LP F   G R+DV+I+S+G A SLRGG L+ T L G DG IYAVAQG
Sbjct: 78  KSKNIAAVMVTAELPAFTKQGQRLDVTISSIGSAKSLRGGTLMQTMLKGLDGQIYAVAQG 137

Query: 143 SVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VVSG    G   S + G +   G I NGAIVERE+P  F     +   L + DF+TA 
Sbjct: 138 NLVVSGFSATGADGSKIVGNNPAAGIISNGAIVEREIPSPFSRGDYITFNLLDSDFTTAQ 197

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR---LMSEVEMLTVE-TDTPAR 257
           R+AD +N++        +A A D+ +VKV  P   DLT+    +S +E L  +  +  A+
Sbjct: 198 RMADTVNNF----LGPQMASALDATSVKVRAPR--DLTQRVAFLSAIENLEFQPANGAAK 251

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           +I+N RTGTI++G +VR+    V++G +T+ I EN  V QPNA    G T    +TD++V
Sbjct: 252 IIVNSRTGTIIVGQHVRLKPTAVTHGGMTITIKENLNVSQPNAL-GGGDTAVVPDTDIEV 310

Query: 318 SDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++ KG  F       LN L+S +N IG     +++ILQ ++ AGA++ ++II
Sbjct: 311 TEKKGKMFKFNTGLTLNDLVSAVNEIGAAPSDLMAILQALEQAGAIEGQLII 362


>gi|121534939|ref|ZP_01666758.1| flagellar P-ring protein [Thermosinus carboxydivorans Nor1]
 gi|121306538|gb|EAX47461.1| flagellar P-ring protein [Thermosinus carboxydivorans Nor1]
          Length = 369

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 219/347 (63%), Gaps = 10/347 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKDV  +Q  R NQL+GYGLVVGL GTGDS ++   T QS+ ++L+  G++    +L +
Sbjct: 29  RIKDVAKVQGVRSNQLVGYGLVVGLAGTGDSTKNM-ATMQSIANMLRTFGVTVTPAQLQA 87

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAVMVTA LPPF  PG  ID++++SLGDA SL+GG L+   L  A+G +YAVAQG +
Sbjct: 88  KNVAAVMVTAVLPPFVKPGDTIDITVSSLGDAKSLQGGTLLQAPLRAANGLVYAVAQGPL 147

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
            + G       +S  +   T G I  GAIVER++P +F     + L L  PDF+TA RIA
Sbjct: 148 SIGGYAAGSGGASQQKNFPTVGTIPGGAIVERDVPVEFTAGGQIALALSQPDFTTASRIA 207

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIINE 262
           + I      RF  PIA A D  TV VS P     D+   ++ +E LT+  DT A+VIINE
Sbjct: 208 EAIA----GRFG-PIAVARDPGTVTVSIPDYYRGDIVGFIAAIEELTIVPDTAAKVIINE 262

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+V+G  V I +V V+ G L+V+IT ++ V QP    S GSTV  + T L+V + K 
Sbjct: 263 RTGTVVMGGQVTIDEVAVAQGGLSVRITRDKAVSQPPPL-SGGSTVVTDKTTLQVDEAKA 321

Query: 323 S-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           S  +L  A  ++ +++ +N+IG     II+ILQ IKAAGAL +++ I
Sbjct: 322 SVVTLPPAASVSDVVAALNAIGATPRDIIAILQAIKAAGALHADLQI 368


>gi|94500245|ref|ZP_01306778.1| Flagellar basal-body P-ring protein [Oceanobacter sp. RED65]
 gi|94427544|gb|EAT12521.1| Flagellar basal-body P-ring protein [Oceanobacter sp. RED65]
          Length = 361

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 158/350 (45%), Positives = 220/350 (62%), Gaps = 15/350 (4%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+ S+   R NQLIGYGLVVGL G+GD    +PFT QS  ++++  GIS P G    
Sbjct: 20  RIKDLTSVAGVRSNQLIGYGLVVGLDGSGDK---APFTNQSFNNMMKEFGISVPPGTDPK 76

Query: 85  -KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV +TA+LPPFA PG  IDV+++S+G+A SLRGG L+ + L GADG +YAVAQG+
Sbjct: 77  LKNVAAVSLTASLPPFAKPGQSIDVTVSSIGNAKSLRGGTLLFSPLKGADGQVYAVAQGN 136

Query: 144 VVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G   +G   SS    + + G+I NGA VER +P  F     LIL L  PDF+TA R
Sbjct: 137 LVVGGFGAEGNDGSSITVNVPSVGRIPNGATVERPVPNAFARGDSLILNLDRPDFTTAKR 196

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET-DTPARVII 260
           +AD IN           A A D+ +V+VS P + +     +S +E LTV   +  A+VII
Sbjct: 197 MADTINDL----LGPETAYAQDATSVRVSAPRDPNQRVSFLSLIENLTVTPGEATAKVII 252

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTGTIVIG +V+I  V V++G+LTV + EN +V QPNA +  G T    N D+ + D 
Sbjct: 253 NSRTGTIVIGKHVKIDPVAVTHGSLTVTVKENIEVNQPNALAG-GETAVVPNADVNI-DE 310

Query: 321 KGSFSLIDAP--DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +G+   +  P   L+ ++  +N +G     +++IL+ +K AGAL +E+I+
Sbjct: 311 EGNPMFVFDPGVSLDEIVKAVNEVGAAPGDLMAILEALKQAGALNAELIV 360


>gi|258592557|emb|CBE68866.1| Flagellar P-ring protein (basal body P-ring protein) [NC10
           bacterium 'Dutch sediment']
          Length = 372

 Score =  262 bits (670), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 150/350 (42%), Positives = 226/350 (64%), Gaps = 12/350 (3%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+  +Q  R+N+L GYGLVVGL GTGD  + + FT Q++ S+L+ LGI+ P  RL 
Sbjct: 29  ARIKDIAKIQGVRENELFGYGLVVGLAGTGDRAQVT-FTIQAVVSMLKKLGITVPAERLT 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LPPFA  GS +DV+++S+GDA++L+GG+L++T L  ADG +YAVAQG+
Sbjct: 88  LKNVAAVMVTAKLPPFAKAGSTLDVTVSSMGDATNLQGGMLLITPLQAADGQVYAVAQGA 147

Query: 144 VVVSGLFVK--GQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           + + G   +  G      +   T G++ NGAIVERE    F  +  L+L L NPDF+TAI
Sbjct: 148 ISIGGFNFEAGGTGEKVQKNHPTVGRVPNGAIVEREPSADFLKAQQLLLVLTNPDFTTAI 207

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVI 259
           R+A  +  +SL   +R    A D+ TV++  P +   +   L++ +E L++  D  A+V+
Sbjct: 208 RMAQAVG-HSLGAETR----AKDASTVEIRVPDSYLANPVELIAAIENLSLVPDMTAKVV 262

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           +NERTGTI++G  VRIS V V++ NL++QI     V QP   S   +TV    T+++  +
Sbjct: 263 VNERTGTIIMGSQVRISTVAVAHSNLSLQIRSELLVSQPAPLSEGKTTVVP-RTEIEARE 321

Query: 320 NKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++   +L+ +   +  +I  +N++ +    +IS+LQ IKAAGALQ E+ I
Sbjct: 322 DRTRVNLMGEGVSIGDVIKALNALAVTPRDMISLLQAIKAAGALQGELQI 371


>gi|254785376|ref|YP_003072805.1| flagellar basal body P-ring protein [Teredinibacter turnerae T7901]
 gi|237684687|gb|ACR11951.1| flagellar P-ring protein FlgI [Teredinibacter turnerae T7901]
          Length = 372

 Score =  262 bits (670), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 143/359 (39%), Positives = 220/359 (61%), Gaps = 16/359 (4%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
            S  V  RIKD+ +++  R NQL+GYGLVVGL G+GD    +PFT QS  ++L+  GI+ 
Sbjct: 21  CSLAVAERIKDITTVEGVRTNQLVGYGLVVGLDGSGDQTNQTPFTTQSFNTMLKQFGITV 80

Query: 78  P-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
           P G     KNVAAV V A LPPF+ PG  IDV+++S+ +A SLRGG+L++T L G DG I
Sbjct: 81  PEGAGFQLKNVAAVAVHAELPPFSKPGQAIDVTVSSIANAKSLRGGVLLLTPLKGIDGRI 140

Query: 137 YAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           YAVAQG+++V G   +GQ  S +   + + G++  GA+VER +P  F  +  ++  L  P
Sbjct: 141 YAVAQGNLIVGGFGAEGQDGSRITVNVPSVGRVPGGAMVERSVPTAFGGNDRIVFNLHTP 200

Query: 196 DFSTAIRIADQINSYSLNRFSRP-IAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLTV 250
           DF+TA R+AD     S+N    P +A   D+ ++ V  P N    +D   L+  +++   
Sbjct: 201 DFTTAKRVAD-----SINELVGPGVATPMDAASIAVQAPQNPAHRVDYLSLLENIDVTPG 255

Query: 251 ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
           E+   A++IIN RTGTIV+G +VR++ V V++G+LTV + E  ++ QPN     G TV  
Sbjct: 256 ESA--AKIIINSRTGTIVVGQHVRVAPVAVTHGSLTVTVREGVEISQPNPL-GEGETVVV 312

Query: 311 NNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            ++ + + +  G  F     P LN ++  +N +G     +++IL+ +K AGAL++EI++
Sbjct: 313 PDSAVSIEEKSGPMFEFSPGPTLNDIVRAVNEVGAAPGDLMAILEALKQAGALKAEIVV 371


>gi|127512283|ref|YP_001093480.1| flagellar basal body P-ring protein [Shewanella loihica PV-4]
 gi|166214839|sp|A3QCM3|FLGI_SHELP RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|126637578|gb|ABO23221.1| flagellar P-ring protein [Shewanella loihica PV-4]
          Length = 363

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 226/373 (60%), Gaps = 20/373 (5%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +I   A ++FS       +A    RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   
Sbjct: 5   LILACALMVFS-------AASSAQRIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTR--- 54

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+ +++L+N GI+ P   R   KNVA V V+A++P F  PG  +DV+++SLG+A SL
Sbjct: 55  YTEQTFKTMLKNFGINLPDNFRPKIKNVAVVAVSADMPAFIKPGQTLDVTVSSLGEAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T L G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGAIVER +
Sbjct: 115 RGGTLLQTFLKGVDGNVYAIAQGSMVVSGFSAEGLDGSKVIQNTPTVGRIPNGAIVERTV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R+AD IN       +RP+    D+ +V+VS P ++  
Sbjct: 175 ATPFSTGDHLTFNLRRADFSTAKRLADAINDLLGPGMARPL----DAASVQVSAPRDVSQ 230

Query: 238 LTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E + VE  +  A+VI+N RTGTIV+G +VR+    V++G LTV I E  QV 
Sbjct: 231 RVSFLATLENIEVEPASESAKVIVNSRTGTIVVGKDVRLLPAAVTHGGLTVTIAEATQVS 290

Query: 297 QPNAFSSNGSTVTQNNT-DLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPN  +   + VT ++T D+  +DN+  F       L+ L+  +N +G     +++IL+ 
Sbjct: 291 QPNPLAGGDTVVTSDSTIDVSEADNR-MFLFNPGTTLDELVRAVNLVGAAPSDVLAILEA 349

Query: 356 IKAAGALQSEIII 368
           +K AGAL  E+II
Sbjct: 350 LKVAGALHGELII 362


>gi|291280517|ref|YP_003497352.1| flagellar P-ring protein FlgI [Deferribacter desulfuricans SSM1]
 gi|290755219|dbj|BAI81596.1| flagellar P-ring protein FlgI [Deferribacter desulfuricans SSM1]
          Length = 362

 Score =  262 bits (669), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 155/366 (42%), Positives = 228/366 (62%), Gaps = 16/366 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L F ++ +   ++    +IKD+  +   RDNQLIGYGLVVGL GTGD    + FT QS+
Sbjct: 4   LLSFLIVIIFAYNSYAYVKIKDIAQVNGIRDNQLIGYGLVVGLNGTGDK-SGTEFTIQSL 62

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
            ++L  +GI+    ++  KNVAAVMVTA LPPFA  G+R+DV+++S+GDA SL GG L+M
Sbjct: 63  VNMLDRMGITVDKDKVKVKNVAAVMVTAKLPPFAKAGTRVDVTVSSIGDAKSLEGGTLLM 122

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L G DG IYAVAQG + V G+ V       ++   T G+I NGA+VERE+P    D+ 
Sbjct: 123 TPLSGPDGKIYAVAQGPLSVGGMNVSSGGGGTVKNHPTVGRIPNGALVEREIPYTL-DNN 181

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSE 244
            + L       S  I+  + IN Y    F + IA A   +T+KV+ P +   +    + +
Sbjct: 182 YITLAFERDSISDLIKAKNAINKY----FRQEIAFADSPKTIKVTIPDSYKNNFYDFLDK 237

Query: 245 VEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           V  + ++ +  ++V+++ERTGTIV+G +VRIS V VS+GNLT++IT   ++ QPN+FS  
Sbjct: 238 VLHIEIDPEPSSKVVVDERTGTIVMGSDVRISTVAVSHGNLTIKITNTVEISQPNSFSQG 297

Query: 305 GSTVTQN-NTDLKVSDNKGSFSLIDAPD---LNSLISGMNSIGLKTDGIISILQGIKAAG 360
            + VT N NT++K  D K    L+  P+   ++ L+  +NS+G+    +I+ILQ IKAAG
Sbjct: 298 TTAVTANQNTEVKEEDAK----LMVIPEGVRISDLVKALNSLGVSPRDLIAILQAIKAAG 353

Query: 361 ALQSEI 366
           ALQ E+
Sbjct: 354 ALQGEL 359


>gi|24374753|ref|NP_718796.1| flagellar basal body P-ring protein [Shewanella oneidensis MR-1]
 gi|62286885|sp|Q8ECA2|FLGI_SHEON RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|24349417|gb|AAN56240.1|AE015761_10 flagellar P-ring protein FlgI [Shewanella oneidensis MR-1]
          Length = 363

 Score =  262 bits (669), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 156/372 (41%), Positives = 223/372 (59%), Gaps = 18/372 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +IF +  L FS+    E       RIKD+ ++Q  R+NQLIGYGLVVGL GTG+    + 
Sbjct: 5   LIFAVFMLAFSMPSQAE-------RIKDIANVQGVRNNQLIGYGLVVGLPGTGEK---TN 54

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+  ++L+N GI+ P   R   KNVA V V A++P F  PG  +DV+++SLG+A SL
Sbjct: 55  YTEQTFTTMLKNFGINLPENFRPKIKNVAVVAVHADMPAFIKPGQELDVTVSSLGEAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T L G DGN+YA+AQGS+VVSG    G   S  ++   T G+I NGAIVER +
Sbjct: 115 RGGTLLQTFLKGVDGNVYAIAQGSLVVSGFSADGLDGSKVIQNTPTVGRIPNGAIVERSV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R+AD IN       +RP+    D+ +++VS P ++  
Sbjct: 175 ATPFSTGDYLTFNLRRSDFSTAQRMADAINDLLGPDMARPL----DATSIQVSAPRDVSQ 230

Query: 238 LTRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E + VE  +  A+VI+N RTGTIV+G NV++    V++G LTV I E  QV 
Sbjct: 231 RVSFLATLENIEVEPAEESAKVIVNSRTGTIVVGQNVKLLPAAVTHGGLTVTIAEATQVS 290

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPNA ++  +TVT N+T      ++  F       L+ L+  +N +G     +++IL+ +
Sbjct: 291 QPNALANGQTTVTSNSTINATESDRRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEAL 350

Query: 357 KAAGALQSEIII 368
           K AGAL  E+II
Sbjct: 351 KVAGALHGELII 362


>gi|49086284|gb|AAT51341.1| PA1084 [synthetic construct]
          Length = 370

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 152/349 (43%), Positives = 214/349 (61%), Gaps = 9/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG--GRL 82
           R+KD+ S+Q  R NQLIGYGLVVGL G+GD    +PFT Q+  ++L   GI  P   G +
Sbjct: 24  RLKDIASIQGVRTNQLIGYGLVVGLSGSGDQTTQTPFTLQTFNNMLAQFGIKVPANVGNV 83

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAV V A+LPPFA PG  IDV+++S+G+A SLRGG L+MT L G DG +YAVAQG
Sbjct: 84  QLKNVAAVSVHADLPPFAKPGQPIDVTVSSIGNAKSLRGGSLLMTPLKGIDGQVYAVAQG 143

Query: 143 SVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VV G   +G+  S +   + + G+I  GA VER +P  F     L L L  PDF+TA 
Sbjct: 144 NLVVGGFDAEGRDGSKITVNVPSAGRIPAGATVERAVPSGFDQGNSLTLNLNRPDFTTAK 203

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET-DTPARVI 259
           RI D+IN          +A A D  +V+VS P + +     +S +E L V+  +  A+VI
Sbjct: 204 RIVDRINEL----LGPGVAHAVDGGSVRVSAPLDPNQRVDYLSILENLDVQPGEAVAKVI 259

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           IN RTGTIVIG NV++S   V++G+LTV ITE+  V QP AFS+  + V   +      +
Sbjct: 260 INSRTGTIVIGQNVKVSPAAVTHGSLTVSITEDPTVSQPGAFSNGQTAVVPRSRVNAEEE 319

Query: 320 NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 320 TKPMFKFGPGTTLDDIVRAVNQVGAAPSDLMAILEALKQAGALQADLIV 368


>gi|126175142|ref|YP_001051291.1| flagellar basal body P-ring protein [Shewanella baltica OS155]
 gi|153001468|ref|YP_001367149.1| flagellar basal body P-ring protein [Shewanella baltica OS185]
 gi|160876199|ref|YP_001555515.1| flagellar basal body P-ring protein [Shewanella baltica OS195]
 gi|217972602|ref|YP_002357353.1| flagellar basal body P-ring protein [Shewanella baltica OS223]
 gi|304409974|ref|ZP_07391593.1| flagellar P-ring protein [Shewanella baltica OS183]
 gi|307302313|ref|ZP_07582071.1| flagellar P-ring protein [Shewanella baltica BA175]
 gi|166214838|sp|A6WQJ7|FLGI_SHEB8 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|189044488|sp|A9KWR8|FLGI_SHEB9 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|254789297|sp|B8E9X6|FLGI_SHEB2 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|125998347|gb|ABN62422.1| flagellar P-ring protein [Shewanella baltica OS155]
 gi|151366086|gb|ABS09086.1| flagellar P-ring protein [Shewanella baltica OS185]
 gi|160861721|gb|ABX50255.1| flagellar P-ring protein [Shewanella baltica OS195]
 gi|217497737|gb|ACK45930.1| flagellar P-ring protein [Shewanella baltica OS223]
 gi|304351383|gb|EFM15782.1| flagellar P-ring protein [Shewanella baltica OS183]
 gi|306914351|gb|EFN44772.1| flagellar P-ring protein [Shewanella baltica BA175]
 gi|315268389|gb|ADT95242.1| flagellar P-ring protein [Shewanella baltica OS678]
          Length = 363

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 155/372 (41%), Positives = 222/372 (59%), Gaps = 18/372 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++  +A L+FSL    E       RIKD+ ++Q  R NQLIGYGLVVGL GTG+    + 
Sbjct: 5   LVLAVAVLVFSLPSQAE-------RIKDIANVQGVRSNQLIGYGLVVGLPGTGEK---TS 54

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+  ++L+N GI+ P   +   KNVA V V A++P F  PG  +DV+++SLG+A SL
Sbjct: 55  YTEQTFMTMLKNFGINLPDNVKPKIKNVAVVAVHADMPAFIKPGQDLDVTVSSLGEAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T L G DGN+YA+AQGS+VVSG    G   S  ++   T G+I NGAIVER +
Sbjct: 115 RGGTLLQTFLKGVDGNVYAIAQGSLVVSGFSADGLDGSKVIQNTPTVGRIPNGAIVERSV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R+AD IN       +RP+    D+ +V+VS P ++  
Sbjct: 175 ATPFSTGDYLTFNLRRSDFSTAQRMADAINELLGPDMARPL----DATSVQVSAPRDVSQ 230

Query: 238 LTRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E L V   +  A+VI+N RTGTIV+G NVR+    +++G +TV I E  QV 
Sbjct: 231 RVSFLATLENLDVIPAEESAKVIVNSRTGTIVVGQNVRLLPAAITHGGMTVTIAEATQVS 290

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPNA ++  +TVT N+T      ++  F       L+ L+  +N +G     +++IL+ +
Sbjct: 291 QPNALANGQTTVTSNSTITATESDRRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEAL 350

Query: 357 KAAGALQSEIII 368
           K AGAL  E+II
Sbjct: 351 KVAGALHGELII 362


>gi|261253610|ref|ZP_05946183.1| flagellar P-ring protein FlgI [Vibrio orientalis CIP 102891]
 gi|260937001|gb|EEX92990.1| flagellar P-ring protein FlgI [Vibrio orientalis CIP 102891]
          Length = 363

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 154/350 (44%), Positives = 217/350 (62%), Gaps = 13/350 (3%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS-TPGGRL 82
           +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+QS  ++LQN GI   PG + 
Sbjct: 21  ARIKDVSQVAGVRSNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQNFGIQMPPGTKP 77

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKNVAAV+VTA LP F+  G  IDV+++S+G A SLRGG L+ T L G DG IYAVAQG
Sbjct: 78  KSKNVAAVIVTAELPAFSKQGQTIDVTVSSIGSAKSLRGGTLMQTMLKGLDGQIYAVAQG 137

Query: 143 SVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VVSG    G   S + G + T G I NGA+VERE+P  F     +   L   DF+TA 
Sbjct: 138 NLVVSGFSATGADGSKIVGNNPTAGMISNGAMVEREIPTPFSRGDYITFNLLESDFTTAQ 197

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDTPARVI 259
           R+AD +N++        +A A D+ +VKV  P +I      +S +E L     +  A++I
Sbjct: 198 RMADAVNNF----LGPQMASAIDATSVKVRAPRDITQRVAFLSAIENLEFNPAEGSAKII 253

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           +N RTGTIV+G +VR+    V++G +TV I EN  V QPNAF   G TV   +TD++V++
Sbjct: 254 VNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPNAF-GGGETVVVPDTDIEVTE 312

Query: 320 NKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            +G  F       L+ L+  +N +G     +++ILQ +K AGA++ ++I+
Sbjct: 313 EQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLIV 362


>gi|295097199|emb|CBK86289.1| Flagellar basal-body P-ring protein [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 371

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 149/349 (42%), Positives = 219/349 (62%), Gaps = 8/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RI+D+ ++Q  R N L+GYGLVVGL GTGD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 27  RIRDLATVQGVRSNSLMGYGLVVGLDGTGDQTMQAPFTGQSLNNMLSQLGITVPAGTNMQ 86

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KN+AAVMVTA LPPFA  G +ID+ ++SLG+A SLRGG L+MT L GAD  IYA+AQG+
Sbjct: 87  LKNIAAVMVTAELPPFARSGDKIDIVVSSLGNAKSLRGGTLLMTPLKGADNQIYAMAQGN 146

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V++SG   +   S        GG+I  GA VERE+P  F     L LQL   DFS A +I
Sbjct: 147 VLISGAGAQAGGSRVQVNQLNGGRISGGATVEREVPNDFATQNTLRLQLNESDFSLAQQI 206

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKV-SKPTNIDLTRLMSEVEMLTVETD-TPARVIIN 261
           +D+IN     R+S   A   D+RTV++ + P      R ++ ++ + +  +   A+VI+N
Sbjct: 207 SDEIN----RRYSGGAAIPEDARTVRLFAPPDGPSRVRFLANIQDIPLRVEIQDAKVIVN 262

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG +V+  +V +    V+YG+LTV++T+N  V QP+     G TV    TD+ V D  
Sbjct: 263 SRTGAVVMNRHVSLDACAVAYGSLTVEVTQNNVVSQPDTPLGGGQTVVVPQTDISVRDRG 322

Query: 322 GSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           GS  S+  + DLN++I  +N++G   + ++SILQ +K AG L++++ ++
Sbjct: 323 GSLQSVRSSTDLNAVIRALNTLGATPNELMSILQSMKNAGCLRAKLEVE 371


>gi|89075499|ref|ZP_01161910.1| flagellar P-ring protein precursor [Photobacterium sp. SKA34]
 gi|89048771|gb|EAR54342.1| flagellar P-ring protein precursor [Photobacterium sp. SKA34]
          Length = 363

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 153/351 (43%), Positives = 221/351 (62%), Gaps = 15/351 (4%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRL 82
           +RIKDV S+   R NQL+GYGLVVGL GTG++   +PFT+QS  ++LQN GI  P G + 
Sbjct: 21  ARIKDVASVAGVRSNQLVGYGLVVGLPGTGET---TPFTDQSFNAMLQNFGIQLPVGTKP 77

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAV V A LPPF   G  IDV+++S+G A SLRGG L+ T L G DG +YA+AQG
Sbjct: 78  KIKNVAAVAVNATLPPFTKQGQSIDVTVSSIGSAKSLRGGTLLQTFLKGLDGKVYAIAQG 137

Query: 143 SVVVSGLFVKGQSSSFMEG-ISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VV G   +G   S + G   T G+I NGA+VE+E+P  F     L   L + DF+TA 
Sbjct: 138 TLVVGGFSAEGADGSKVIGNTPTVGRISNGAMVEQEVPNPFGRGDYLTFNLHDSDFTTAQ 197

Query: 202 RIADQINSYSLNRFSRP-IAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDTPARV 258
           R+AD     S+N+F  P +A A D+ ++KV  P ++      +S VE L  +  +  A++
Sbjct: 198 RMAD-----SINQFLGPQMASAVDATSIKVRAPRDVSQRVAFLSTVENLEFDPAEGSAKI 252

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN-NTDLKV 317
           I+N RTGTIVIG +V++    +++G +TV I EN QV QPNAF+   +TV +N N +++ 
Sbjct: 253 IVNSRTGTIVIGQHVKLKPAAITHGGMTVSIKENPQVSQPNAFAGGETTVVENSNINVQQ 312

Query: 318 SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           SD +  F       L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 313 SDAR-MFKFEPGVSLDELVRAVNQVGAAPSDLMAILQALKQAGAIEGQLII 362


>gi|206889436|ref|YP_002249845.1| flagellar P-ring protein FlgI [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741374|gb|ACI20431.1| flagellar P-ring protein FlgI [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 403

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 149/372 (40%), Positives = 224/372 (60%), Gaps = 16/372 (4%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +  I FLI S       +     RIKD+ S    R+NQL+GYGLVVGL GTGD  +   +
Sbjct: 42  LLFIFFLILSFA-----TTSHAERIKDIASWSGIRENQLVGYGLVVGLNGTGD--KDGTY 94

Query: 62  TEQSMRSLLQNLGISTPGGRLGSK--NVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
             Q + ++L  +GI+     L  K  NVAAVMVTA LP    PG++IDV ++S+GDA SL
Sbjct: 95  LYQPIANMLSRMGITVNVKDLKGKVKNVAAVMVTAKLPTNVKPGTKIDVQVSSIGDAKSL 154

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           +GG L++T L G DG +YA+AQG + + G    G+++  ++     G I  GAIVE+ +P
Sbjct: 155 QGGTLLLTPLTGPDGEVYALAQGPISIGGFIAAGRAAQAIKNHQNVGSIPEGAIVEKAVP 214

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--D 237
                 ++L L L+ PD +TA  IA++IN      +   IA+A D  T+ ++ P+    +
Sbjct: 215 VNLNAKSELQLLLQFPDITTAKNIAEKINEI----YKAGIAKALDPTTISINIPSTYRGN 270

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           +   M+EVE + V TD PARV+INERTGT+VIG +V+IS   +++G LT+ I E  +V+Q
Sbjct: 271 VLDFMAEVEKIEVSTDLPARVVINERTGTVVIGSHVKISPAALAHGGLTITIKETPEVIQ 330

Query: 298 PNAFSSNGS-TVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P   S  GS T T   T+LKV + + S   +    +  L+  +N++G+    +ISILQ +
Sbjct: 331 PPPLSPRGSVTETVPRTELKVEEKQASLVEVQGSTVGELVRALNTLGVTPKDLISILQAL 390

Query: 357 KAAGALQSEIII 368
           K +GAL+++++I
Sbjct: 391 KTSGALKADLVI 402


>gi|146305254|ref|YP_001185719.1| flagellar basal body P-ring protein [Pseudomonas mendocina ymp]
 gi|145573455|gb|ABP82987.1| flagellar P-ring protein [Pseudomonas mendocina ymp]
          Length = 364

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 160/369 (43%), Positives = 229/369 (62%), Gaps = 19/369 (5%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L+F L+    +S + V  + D+V ++  R NQLIGYGLVVGL GTGD      FT QS+ 
Sbjct: 6   LVFLLLSW-PLSTKAVP-LMDLVDIEGIRGNQLIGYGLVVGLDGTGDK-NQVKFTSQSVA 62

Query: 68  SLLQNLGISTPGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           ++++  GI+ P     +L  KNVAAV VTA +PP  SPG  +DV+++SLGDA SLRGG L
Sbjct: 63  NMIKQFGINLPPNVDPKL--KNVAAVTVTAEIPPSYSPGQTVDVTVSSLGDAKSLRGGQL 120

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFK 183
           ++T L G DG IYA+AQG++VV GL   GQS SS     +  G++ NGA VER +P  F 
Sbjct: 121 LLTPLHGVDGEIYALAQGALVVGGLNASGQSGSSVAINSANSGRVPNGATVERMIPSDFS 180

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLM 242
           + A+++L LR P F TA ++ + +N     RF    A A ++  + +  P T+      M
Sbjct: 181 ERAEVMLNLRQPSFQTAAKVVEAVN----GRFGSGTASALNATKIAIRAPITSTQRIGFM 236

Query: 243 SEVEMLTVET--DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           + +E L VE   + P +V+ N RTGT+V+G  VR+    V++G LTV I+EN QV QPNA
Sbjct: 237 AMLEGLEVEEGRERP-KVVFNSRTGTVVVGQGVRVKAAAVAHGTLTVTISENPQVSQPNA 295

Query: 301 FSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           F S G T     +D+ VS +K + F   D   L+S+IS +NS+G   D ++SILQ ++ A
Sbjct: 296 F-SGGQTAVVPRSDVAVSQDKNAMFKWPDGASLDSIISTVNSLGATPDDVMSILQALEQA 354

Query: 360 GALQSEIII 368
           GAL +E+++
Sbjct: 355 GALNAELVV 363


>gi|156976145|ref|YP_001447051.1| flagellar basal body P-ring protein [Vibrio harveyi ATCC BAA-1116]
 gi|156527739|gb|ABU72824.1| hypothetical protein VIBHAR_04916 [Vibrio harveyi ATCC BAA-1116]
          Length = 378

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 158/375 (42%), Positives = 239/375 (63%), Gaps = 18/375 (4%)

Query: 3   FRIAFLIFSLIGLHEIS-AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           F  +FL+   +GL   S A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      F
Sbjct: 12  FFTSFLLALTLGLPATSQAEVEIPIMDLVDVQGIRENQLVGYGLVVGLAGQGDR-NQVKF 70

Query: 62  TEQSMRSLLQNLGIS---TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           T QS+ ++L+  G+    +   +L  +NVA+V VTA++ P A PG  +DV ++S+GDA S
Sbjct: 71  TAQSITNMLRQFGVQIDDSMNPKL--RNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKS 128

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERE 177
           LRGG L++T L G DG +YA+AQGSVVV GL  +G+S S +E    T G+I NGA +ERE
Sbjct: 129 LRGGTLLLTPLRGIDGEVYAIAQGSVVVGGLSAEGKSGSKVEVNTPTAGRIPNGATLERE 188

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI- 236
           +   F    ++ L LR P F+TA  IA +IN    N F   +A+A +   V++  P +  
Sbjct: 189 IETDFNQRDEITLNLRKPSFTTAKNIAREIN----NTFGPNVAKAINKARVEMRAPMDTQ 244

Query: 237 DLTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
               +MS +E ++VE    PAR++ N RTGT+VIG NV++ +  VS+GNLTV+I+E++QV
Sbjct: 245 QRVTMMSMLEEMSVEEGRKPARIVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESQQV 304

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISIL 353
            QPNAF ++G T   + T ++V++ +    +I  P  +LN++++ +NS+G     ++SIL
Sbjct: 305 SQPNAF-ADGETKVVDQTQIEVNEEQAQM-VIWPPGTELNTIVNAVNSLGATPTDLMSIL 362

Query: 354 QGIKAAGALQSEIII 368
           Q +  AGAL +E+++
Sbjct: 363 QALNEAGALNAELVV 377


>gi|15596281|ref|NP_249775.1| flagellar basal body P-ring protein [Pseudomonas aeruginosa PAO1]
 gi|107100529|ref|ZP_01364447.1| hypothetical protein PaerPA_01001554 [Pseudomonas aeruginosa PACS2]
 gi|116049013|ref|YP_792185.1| flagellar basal body P-ring protein [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152988391|ref|YP_001349646.1| flagellar basal body P-ring protein [Pseudomonas aeruginosa PA7]
 gi|218892952|ref|YP_002441821.1| flagellar basal body P-ring protein [Pseudomonas aeruginosa LESB58]
 gi|254234220|ref|ZP_04927543.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           C3719]
 gi|254239442|ref|ZP_04932764.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           2192]
 gi|296390552|ref|ZP_06880027.1| flagellar basal body P-ring protein [Pseudomonas aeruginosa PAb1]
 gi|313106039|ref|ZP_07792298.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           39016]
 gi|14548040|sp|Q9I4P5|FLGI_PSEAE RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|122258121|sp|Q02IQ1|FLGI_PSEAB RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|166988332|sp|A6V9B1|FLGI_PSEA7 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|226701952|sp|B7UXA5|FLGI_PSEA8 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|9947000|gb|AAG04473.1|AE004539_15 flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           PAO1]
 gi|115584234|gb|ABJ10249.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166151|gb|EAZ51662.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           C3719]
 gi|126192820|gb|EAZ56883.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           2192]
 gi|150963549|gb|ABR85574.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           PA7]
 gi|218773180|emb|CAW28992.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           LESB58]
 gi|310878800|gb|EFQ37394.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           39016]
          Length = 369

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 152/349 (43%), Positives = 214/349 (61%), Gaps = 9/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG--GRL 82
           R+KD+ S+Q  R NQLIGYGLVVGL G+GD    +PFT Q+  ++L   GI  P   G +
Sbjct: 24  RLKDIASIQGVRTNQLIGYGLVVGLSGSGDQTTQTPFTLQTFNNMLAQFGIKVPANVGNV 83

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAV V A+LPPFA PG  IDV+++S+G+A SLRGG L+MT L G DG +YAVAQG
Sbjct: 84  QLKNVAAVSVHADLPPFAKPGQPIDVTVSSIGNAKSLRGGSLLMTPLKGIDGQVYAVAQG 143

Query: 143 SVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VV G   +G+  S +   + + G+I  GA VER +P  F     L L L  PDF+TA 
Sbjct: 144 NLVVGGFDAEGRDGSKITVNVPSAGRIPAGATVERAVPSGFDQGNSLTLNLNRPDFTTAK 203

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET-DTPARVI 259
           RI D+IN          +A A D  +V+VS P + +     +S +E L V+  +  A+VI
Sbjct: 204 RIVDRINEL----LGPGVAHAVDGGSVRVSAPLDPNQRVDYLSILENLDVQPGEAVAKVI 259

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           IN RTGTIVIG NV++S   V++G+LTV ITE+  V QP AFS+  + V   +      +
Sbjct: 260 INSRTGTIVIGQNVKVSPAAVTHGSLTVSITEDPIVSQPGAFSNGQTAVVPRSRVNAEEE 319

Query: 320 NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 320 TKPMFKFGPGTTLDDIVRAVNQVGAAPSDLMAILEALKQAGALQADLIV 368


>gi|220934398|ref|YP_002513297.1| flagellar P-ring protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995708|gb|ACL72310.1| flagellar P-ring protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 380

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 149/354 (42%), Positives = 223/354 (62%), Gaps = 10/354 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           A+   R+KD+ S+   R NQL+GYGLVVGL G+GD    +PFT QS++++L  LG++ P 
Sbjct: 31  AKAYERVKDLASVAGVRSNQLVGYGLVVGLDGSGDQTTQAPFTVQSLKNMLGQLGVTVPP 90

Query: 80  G-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
                 +NVAAVM+ A+LPPFA PG  IDV+++S+G+ASSLRGG L+MT L GADG  YA
Sbjct: 91  NVNPQLRNVAAVMIHADLPPFAKPGQMIDVTVSSIGNASSLRGGSLLMTPLKGADGQTYA 150

Query: 139 VAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           +AQG++VV G   +G+  S +   + + G+I NGA VERE+P  F     ++L L  PDF
Sbjct: 151 IAQGNLVVGGFGAEGRDGSRISVNVPSVGRIPNGASVEREVPTAFAQGDSVMLNLHQPDF 210

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP- 255
           +TA R++D IN    +      A A D  +V+VS P +       +S +E LTV    P 
Sbjct: 211 TTANRLSDVIN----DTMGPGTARAVDGSSVRVSAPIDPGQRVAFVSMLENLTVRPGAPA 266

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+VI+N RTGT+VIG NV++    V++G+LTV ITE+  V QP   ++ G TV    TD+
Sbjct: 267 AKVIVNSRTGTVVIGSNVQVMPAAVTHGSLTVTITESFDVSQPAPLAA-GETVVTPRTDI 325

Query: 316 KVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +V++      L      L+ ++  +N +G     +++IL+ ++ AGAL++++I+
Sbjct: 326 EVTEQVNPMFLFGPGVTLDEIVRAVNQVGAAPGDLVAILEALRQAGALRAQLIV 379


>gi|311992303|gb|ADQ26725.1| flagellar P-ring protein [Aeromonas hydrophila]
          Length = 364

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 155/371 (41%), Positives = 222/371 (59%), Gaps = 15/371 (4%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R+  L   L+ L    A   SRIKD+ S++  R NQLIGYGLVVGL GTG+  +S+ FT
Sbjct: 3   LRLVALFCCLLPLGMAHA---SRIKDISSVEGVRSNQLIGYGLVVGLPGTGE--KSNAFT 57

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQ+ R++L N GI  P   +   K+VA V + A+LPPFA PG  IDV+++++G+A SLRG
Sbjct: 58  EQTFRTMLNNFGIKVPDNIKPKIKDVAPVAIHADLPPFAKPGQTIDVTVSAIGEAKSLRG 117

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ + L G DG +YAVAQGS+VV GL  +G   S  +    T G+I NGA VERE+P 
Sbjct: 118 GTLLQSFLKGLDGRVYAVAQGSLVVGGLGAEGADGSKVVINTPTVGRIANGATVEREVPN 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L  PDF+TA R+AD +N           A+A D+ +VKV  P +     
Sbjct: 178 SFSQGDTITFNLNRPDFTTARRLADVVNDL----VGPNTAQALDATSVKVYAPRDPGQRV 233

Query: 240 RLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++ +E L V+     A++I+N RTGTIVIG  VR+    +S+G LTV I EN+QV QP
Sbjct: 234 SYLATIENLEVDPASEAAKIIVNSRTGTIVIGSQVRLKPAAISHGGLTVTIAENQQVSQP 293

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N  S  G T   NN+ + V   +G  F L     L+ L+  +N +G+    +++IL+ ++
Sbjct: 294 NPLSG-GQTAVTNNSTINVQQEQGRMFKLDTGATLDDLVRAVNQVGVAPGDLMAILEALQ 352

Query: 358 AAGALQSEIII 368
            AGA++ +++I
Sbjct: 353 QAGAIEGQLVI 363


>gi|120598236|ref|YP_962810.1| flagellar basal body P-ring protein [Shewanella sp. W3-18-1]
 gi|146293686|ref|YP_001184110.1| flagellar basal body P-ring protein [Shewanella putrefaciens CN-32]
 gi|120558329|gb|ABM24256.1| flagellar P-ring protein [Shewanella sp. W3-18-1]
 gi|145565376|gb|ABP76311.1| flagellar P-ring protein [Shewanella putrefaciens CN-32]
 gi|319427085|gb|ADV55159.1| flagellar P-ring protein [Shewanella putrefaciens 200]
          Length = 363

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 160/372 (43%), Positives = 224/372 (60%), Gaps = 20/372 (5%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           I  +A LIFSL    E       RIKD+ ++Q  R NQLIGYGLVVGL GTG+    + +
Sbjct: 6   IIALAILIFSLPSQAE-------RIKDIANVQGVRSNQLIGYGLVVGLPGTGEK---TNY 55

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           TEQ+  ++L+N GI+ P   R   KNVA V V A++P F  PG  +DV+++SLG+A SLR
Sbjct: 56  TEQTFTTMLKNFGINLPDNFRPKIKNVAVVAVHADMPAFIKPGQELDVTVSSLGEAKSLR 115

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+ T L G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGAIVER + 
Sbjct: 116 GGTLLQTFLKGVDGNVYAIAQGSLVVSGFSAEGLDGSKVIQNTPTVGRIPNGAIVERSVA 175

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     L   LR  DFSTA R+AD IN       +RP+    D+ +V+VS P ++   
Sbjct: 176 TPFSSGDYLTFNLRRADFSTAQRMADAINDLLGPDMARPL----DATSVQVSAPRDVSQR 231

Query: 239 TRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              ++ +E L V   +  A+VI+N RTGTIV+G NV++    +++G LTV I E  QV Q
Sbjct: 232 VSFLATLENLDVIPAEESAKVIVNSRTGTIVVGQNVKLLPAAITHGGLTVTIAEATQVSQ 291

Query: 298 PNAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNA  +NG TV   +T + VS+ ++  F       L+ L+  +N +G     +++IL+ +
Sbjct: 292 PNAL-ANGETVVTADTTIGVSESDRRMFMFSPGTTLDELVRAVNLVGAAPSDVLAILEAL 350

Query: 357 KAAGALQSEIII 368
           K AGAL  E+II
Sbjct: 351 KVAGALHGELII 362


>gi|90579913|ref|ZP_01235721.1| flagellar P-ring protein precursor [Vibrio angustum S14]
 gi|90438798|gb|EAS63981.1| flagellar P-ring protein precursor [Vibrio angustum S14]
          Length = 363

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 231/374 (61%), Gaps = 18/374 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M FR A +I  LI L   S    +RIKDV S+   R NQL+GYGLVVGL GTG++   +P
Sbjct: 1   MNFR-AIIITGLILLS--STVDAARIKDVASVAGVRSNQLVGYGLVVGLPGTGET---TP 54

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+QS  ++LQN GI  P G +   KNVAAV V A LPPF   G  IDV+++S+G A SL
Sbjct: 55  FTDQSFNAMLQNFGIQLPVGTKPKIKNVAAVAVNATLPPFTKQGQSIDVTVSSIGSAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEG-ISTGGKIVNGAIVEREL 178
           RGG L+ T L G DG +YA+AQG++VV G   +G   S + G   T G+I NGA+VE+E+
Sbjct: 115 RGGTLLQTFLKGLDGKVYAIAQGTLVVGGFSAEGADGSKVIGNTPTVGRISNGAMVEQEV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRP-IAEAYDSRTVKVSKPTNI- 236
           P  F     L   L + DF+TA R+AD     S+N+F  P +A A D+ ++KV  P ++ 
Sbjct: 175 PNPFGRGDYLTFNLYDSDFTTAQRMAD-----SINQFLGPQMASAVDATSIKVRAPRDVS 229

Query: 237 DLTRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                +S VE L  +  +  A++I+N RTGTIVIG +V++    +++G +TV I EN QV
Sbjct: 230 QRVAFLSTVENLEFDPAEGSAKIIVNSRTGTIVIGQHVKLKPAAITHGGMTVSIKENPQV 289

Query: 296 VQPNAFSSNGSTVTQN-NTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQ 354
            QPNAF+   +TV +N N +++ SD +  F       L+ L+  +N +G     +++ILQ
Sbjct: 290 SQPNAFAGGETTVVENSNINVQESDAR-MFKFEPGVSLDELVRAVNQVGAAPSDLMAILQ 348

Query: 355 GIKAAGALQSEIII 368
            +K AGA++ ++II
Sbjct: 349 ALKQAGAIEGQLII 362


>gi|117619793|ref|YP_857339.1| flagellar basal body P-ring protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|166214830|sp|A0KM38|FLGI_AERHH RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|117561200|gb|ABK38148.1| flagellar P-ring protein FlgI [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 365

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 155/371 (41%), Positives = 222/371 (59%), Gaps = 15/371 (4%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R+  L   L+ L    A   SRIKD+ S++  R NQLIGYGLVVGL GTG+  +S+ FT
Sbjct: 4   LRLVALFCCLLPLGMAHA---SRIKDISSVEGVRSNQLIGYGLVVGLPGTGE--KSNAFT 58

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQ+ R++L N GI  P   +   K+VA V + A+LPPFA PG  IDV+++++G+A SLRG
Sbjct: 59  EQTFRTMLNNFGIKVPDNIKPKIKDVAPVAIHADLPPFAKPGQTIDVTVSAIGEAKSLRG 118

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ + L G DG +YAVAQGS+VV GL  +G   S  +    T G+I NGA VERE+P 
Sbjct: 119 GTLLQSFLKGLDGRVYAVAQGSLVVGGLGAEGADGSKVVINTPTVGRIANGATVEREVPN 178

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L  PDF+TA R+AD +N           A+A D+ +VKV  P +     
Sbjct: 179 SFSQGDTITFNLNRPDFTTARRLADVVNDL----VGPNTAQALDATSVKVYAPRDPGQRV 234

Query: 240 RLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++ +E L V+     A++I+N RTGTIVIG  VR+    +S+G LTV I EN+QV QP
Sbjct: 235 SYLATIENLEVDPASEAAKIIVNSRTGTIVIGSQVRLKPAAISHGGLTVTIAENQQVSQP 294

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N  S  G T   NN+ + V   +G  F L     L+ L+  +N +G+    +++IL+ ++
Sbjct: 295 NPLSG-GQTAVTNNSTINVQQEQGRMFKLDTGATLDDLVRAVNQVGVAPGDLMAILEALQ 353

Query: 358 AAGALQSEIII 368
            AGA++ +++I
Sbjct: 354 QAGAIEGQLVI 364


>gi|262404536|ref|ZP_06081091.1| flagellar P-ring protein FlgI [Vibrio sp. RC586]
 gi|262349568|gb|EEY98706.1| flagellar P-ring protein FlgI [Vibrio sp. RC586]
          Length = 361

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 156/362 (43%), Positives = 225/362 (62%), Gaps = 14/362 (3%)

Query: 12  LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
           L+ L   SAQ  +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+QS  ++LQ
Sbjct: 8   LMMLLASSAQA-ARIKDVAQVAGVRSNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQ 63

Query: 72  NLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLL 130
           N GI   PG +  +KNVAAV+VTA+LP F+  G  ID++++S+G A SLRGG L+ T L 
Sbjct: 64  NFGIQLPPGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQTFLK 123

Query: 131 GADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLI 189
           G DG +YAVAQG++VVSG    G   S + G + T G I +GAIVERE+P  F     + 
Sbjct: 124 GLDGEVYAVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYIT 183

Query: 190 LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEML 248
             L   DF+TA R+AD +N +        +A A D+ ++KV  P ++      +S +E L
Sbjct: 184 FNLFESDFTTAQRLADAVNQF----LGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENL 239

Query: 249 TVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGST 307
              T ++ A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA  + G T
Sbjct: 240 EFNTAESAAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNAL-AGGQT 298

Query: 308 VTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           V   N+ ++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++ ++
Sbjct: 299 VVTPNSSIEVTEKQGKMFKLEPGVTLDELVRAVNEVGAAPSDLMAILQALKQAGAIEGQL 358

Query: 367 II 368
           II
Sbjct: 359 II 360


>gi|82702457|ref|YP_412023.1| flagellar basal body P-ring protein [Nitrosospira multiformis ATCC
           25196]
 gi|115311524|sp|Q2Y9E0|FLGI_NITMU RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|82410522|gb|ABB74631.1| Flagellar P-ring protein [Nitrosospira multiformis ATCC 25196]
          Length = 377

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 153/369 (41%), Positives = 217/369 (58%), Gaps = 14/369 (3%)

Query: 7   FLIF-SLIGLHEISAQV-VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           F  F +  GL   S  V   RIKD+ S+Q  R NQLIGYGLVVGL GTGD    +PFT Q
Sbjct: 15  FAFFCAWAGLWTFSLPVQAERIKDLASIQGIRPNQLIGYGLVVGLDGTGDQTVQTPFTIQ 74

Query: 65  SMRSLLQNLGISTPGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           S+ ++L  LGI+ P G   RL  +NVAAVMVTA LPP A PG  IDV+++S+G+A SLRG
Sbjct: 75  SLNNMLMQLGINVPPGTNMRL--RNVAAVMVTAALPPLAQPGQAIDVTVSSMGNARSLRG 132

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L G DG +Y VAQG+++V G+      S         G+I  GA VER +P  
Sbjct: 133 GTLLMTPLKGIDGQVYGVAQGNLLVGGIGAAASGSKVQVNHLNAGRIPGGATVERAVPVA 192

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTR 240
              +  + L+L   DFSTA RI D +N+    RF    A A D R ++V  P   D    
Sbjct: 193 LGQNDMIRLELNTIDFSTAKRIVDAVNT----RFGMGTAAALDGRAIQVRTPPESDQRVA 248

Query: 241 LMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            ++E+E L +     PARVI+N RTG++V+     + +  +++GNLTV I+    + QP 
Sbjct: 249 FLAEMESLAINPAQMPARVIVNSRTGSVVMNQAATVDQCAIAHGNLTVVISTEPVISQPG 308

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
            FSS G TV    + +++    G  ++++   L  ++  +N+IG     +++ILQ +K+A
Sbjct: 309 PFSS-GRTVQAQRSTIEIKQESGMLTMVEGASLAEVVKALNAIGATPQDLLAILQAMKSA 367

Query: 360 GALQSEIII 368
           GAL++E+ I
Sbjct: 368 GALRAELEI 376


>gi|254227987|ref|ZP_04921417.1| flagellar P-ring protein FlgI [Vibrio sp. Ex25]
 gi|262396031|ref|YP_003287884.1| flagellar P-ring protein FlgI [Vibrio sp. Ex25]
 gi|151939483|gb|EDN58311.1| flagellar P-ring protein FlgI [Vibrio sp. Ex25]
 gi|262339625|gb|ACY53419.1| flagellar P-ring protein FlgI [Vibrio sp. Ex25]
          Length = 370

 Score =  259 bits (663), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 158/375 (42%), Positives = 235/375 (62%), Gaps = 18/375 (4%)

Query: 3   FRIAFLIFSLIGLHEIS-AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           F  +FL+   +GL   S A+V   I D+V ++  R+NQL+GYGLVVGL G GD      F
Sbjct: 4   FLTSFLLVLTLGLPTTSHAEVEIPIMDLVDVRGIRENQLVGYGLVVGLAGQGDR-NQVKF 62

Query: 62  TEQSMRSLLQNLGIS---TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           T QS+ ++L+  G+    +   +L  +NVA+V VTA + P A PG  +DV ++S+GDA S
Sbjct: 63  TSQSITNMLRQFGVQIDDSMNPKL--RNVASVSVTATVDPMAGPGQTLDVVVSSIGDAKS 120

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERE 177
           LRGG L++T L G DG +YA+AQG+VVV GL  +G+S S +E    T G++ NGA +ERE
Sbjct: 121 LRGGTLLLTPLRGIDGEVYAIAQGNVVVGGLSAEGRSGSKVEVNTPTAGRVPNGATLERE 180

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           +   F    ++ L LR P F+TA  IA +IN    N F   +A A +   + +  P +  
Sbjct: 181 IKTDFNQRDEVTLNLRKPSFTTAKNIAREIN----NTFGPNVAVAINKARIDMRAPKDTQ 236

Query: 238 LTRLMSEV--EMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
              +M  +  EM  VE   PAR++ N RTGT+VIG +V++S+  VS+GNLTV+I+E++QV
Sbjct: 237 QRVVMMSMLEEMSVVEGRKPARIVFNSRTGTVVIGKSVKVSEAAVSHGNLTVRISESQQV 296

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISIL 353
            QPNAF +NG T   N TDL V+++     +I  P  +LN++++ +NS+G     ++SIL
Sbjct: 297 SQPNAF-ANGDTKVVNQTDLDVNEDLAQM-VIWPPGTELNTIVTAVNSLGATPTDLMSIL 354

Query: 354 QGIKAAGALQSEIII 368
           Q +  AGAL +E+++
Sbjct: 355 QALSEAGALNAELVV 369


>gi|197335118|ref|YP_002156696.1| flagellar P-ring protein FlgI [Vibrio fischeri MJ11]
 gi|197316608|gb|ACH66055.1| flagellar P-ring protein FlgI [Vibrio fischeri MJ11]
          Length = 365

 Score =  259 bits (663), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 227/366 (62%), Gaps = 14/366 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           ++F+ + L  IS    +RIKDV  +   R NQLIGYGLV GL GTG+S   +PFT+QS  
Sbjct: 8   VLFTWLCL-SISTAHAARIKDVAEVAGVRSNQLIGYGLVSGLPGTGES---TPFTDQSFN 63

Query: 68  SLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++LQN GI   PG +  +KNVAAVMVTA LPPF+  G  +DV+++S+G A SLRGG L+ 
Sbjct: 64  AMLQNFGIQLPPGTKPKTKNVAAVMVTATLPPFSKQGQVVDVTVSSVGSAKSLRGGTLLQ 123

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDS 185
           T L G DG  YA+AQG+++VSG    G   S + G + T G+I  GA+VERE+P  F   
Sbjct: 124 TFLKGLDGKTYAIAQGNLIVSGFSATGADGSKIVGNNPTVGRISGGAMVEREVPSPFGRG 183

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSE 244
             +   L   DF+TA R+AD +N++        +A A D+ +V+V  P +I      +S 
Sbjct: 184 DFITFNLLESDFTTAQRMADAVNNF----LGPNMASAVDATSVRVRAPRDISQRVAFLSA 239

Query: 245 VEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           VE +  +  D  A++I+N RTGTIV+G +V++    V++G +TV I EN QV QP  F S
Sbjct: 240 VENVDFDPADGSAKIIVNSRTGTIVVGKHVKLKPAAVTHGGMTVAIKENLQVSQPGPF-S 298

Query: 304 NGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           +G TV   ++D++V++ +G  F       L+ L+  +N +G     +++ILQ +K AGA+
Sbjct: 299 DGQTVVTPDSDIEVTEEQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAGAI 358

Query: 363 QSEIII 368
           + ++II
Sbjct: 359 EGQLII 364


>gi|239817161|ref|YP_002946071.1| flagellar P-ring protein [Variovorax paradoxus S110]
 gi|239803738|gb|ACS20805.1| flagellar P-ring protein [Variovorax paradoxus S110]
          Length = 377

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 153/369 (41%), Positives = 218/369 (59%), Gaps = 14/369 (3%)

Query: 9   IFSLIGLHEISAQVVS------RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           + SLIG   + A  +       R+K++ S+Q  RDN LIGYGL+VGL GTGD    +PFT
Sbjct: 13  VRSLIGFAALCAITLCSPAQAERLKELASIQGVRDNPLIGYGLMVGLDGTGDQTMQTPFT 72

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+ ++LQ LGI+ P G  +  KNVAAVMVTA LP FA PG  IDV+++S+G+A SLRG
Sbjct: 73  TQSLNNMLQQLGITIPQGVNMQLKNVAAVMVTATLPSFARPGQNIDVTVSSMGNAKSLRG 132

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L G DG +YA+AQG++VV G       S       + G+I  GA+VER +   
Sbjct: 133 GTLLMTPLKGVDGQVYAIAQGNMVVGGAGASANGSKAQVNQLSSGRIPAGALVERSVEAP 192

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL 241
                   L+L   DF T    AD IN     +F    A+A D+R ++V  P   +    
Sbjct: 193 VGGEGSFTLELNRSDFGTVQLAADAIN----RQFGAGTAQALDARVIQVQAPAPQERVGF 248

Query: 242 MSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           ++ +E L V  T   ARV++N RTG++V+   VR++   V++GNL+V I  +  V QPNA
Sbjct: 249 LARLESLEVTPTQAVARVVVNARTGSVVMNQAVRVNDCAVAHGNLSVVINTDPVVSQPNA 308

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           FS  GSTV    + + +S   G+  ++     L  +I G+NS+G     ++SILQ +K+A
Sbjct: 309 FSG-GSTVVGQTSQISISQGGGALQMVRGGASLADVIKGLNSLGANPQDLVSILQAMKSA 367

Query: 360 GALQSEIII 368
           GAL++E+ I
Sbjct: 368 GALRAELEI 376


>gi|311694365|gb|ADP97238.1| flagellar P-ring protein precursor I [marine bacterium HP15]
          Length = 365

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 148/369 (40%), Positives = 231/369 (62%), Gaps = 18/369 (4%)

Query: 8   LIFSLIGLHEISAQVVS-RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           +I  ++ L  +SA V++ R+KD+  ++  R+NQL+GYGLVVGL GTGD    +PFT Q+ 
Sbjct: 6   VIVWVLALAVVSAPVLADRLKDLSRIKGVRNNQLVGYGLVVGLDGTGDK---APFTNQTF 62

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           R+++   G++ P G      NVAAV V+A LPPFA  G  ID++++S+G+A SLRGG L+
Sbjct: 63  RNMMNQFGVTLPEGVNPNLANVAAVTVSATLPPFAKAGQEIDITVSSIGNADSLRGGTLL 122

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKD 184
           MTSL GADG +YA+AQGS+VV G   +GQ  S +   + + G+I NGA +ERE+   F  
Sbjct: 123 MTSLKGADGQVYAMAQGSLVVGGFGAQGQDGSRITVNVPSVGRIPNGATIEREVASPFSQ 182

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSE 244
              +   L  PDF+TA R+ + +N    +R    +A A+D+ ++ V  P   D ++ +S 
Sbjct: 183 GDTITFHLLRPDFTTARRVVEAVN----DRLGPDMAYAHDATSISVRAPR--DPSQRVSF 236

Query: 245 VEML-TVETDT---PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           + +L  +E D     A+V+IN RTGTIV+G NV++S   V++GNLTV I EN  V QPN 
Sbjct: 237 LSILENIEVDPAQDAAKVVINSRTGTIVVGQNVQVSAAAVTHGNLTVTIQENPNVEQPNP 296

Query: 301 FSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           F+  G T  + ++ + +++     F    A  LN ++  +N +G     ++++L+ +K A
Sbjct: 297 FAG-GDTAIEQDSQIAITEEPARMFKFGPAVTLNEIVQAVNQVGAAPGDVMAVLEALKQA 355

Query: 360 GALQSEIII 368
           GAL++E+I+
Sbjct: 356 GALRAELIV 364


>gi|332305619|ref|YP_004433470.1| flagellar P-ring protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172948|gb|AEE22202.1| flagellar P-ring protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 370

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 165/381 (43%), Positives = 229/381 (60%), Gaps = 29/381 (7%)

Query: 5   IAFLIFSLIGLHEISAQVVS------RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS 58
           + FL+F LI    ISA V++      RIKD+ S+Q  R NQL+GYGLVVGL GTG+    
Sbjct: 1   MKFLLFILI----ISAVVIAPIGQAQRIKDLASVQGVRSNQLVGYGLVVGLPGTGEQ--- 53

Query: 59  SPFTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           SPFTEQS R++L N GIS     +   KNVAAV V A LPPF  PG  IDV+++S+G+A+
Sbjct: 54  SPFTEQSFRTMLTNFGISLDSSLKPKIKNVAAVAVHAELPPFLKPGQTIDVTVSSVGEAA 113

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSS-FMEGISTGGKIVNGAIVER 176
           SLRGG L+ T L G DG +YAVAQGS+VVSG   +G   S  +    T G+I NGA++ER
Sbjct: 114 SLRGGTLLQTFLKGLDGKVYAVAQGSLVVSGFGAQGADGSRIVANTPTVGRIANGALIER 173

Query: 177 ELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRF-SRP-----IAEAYDSRTVKV 230
            +P  F  +  L L L  PDFSTA  +AD IN     R  + P     IA   D+ +V+V
Sbjct: 174 AVPSGFMQNDFLTLNLNYPDFSTAKILADTIN----QRLGADPDKGYIIATPVDAASVRV 229

Query: 231 SKPTNI-DLTRLMSEVEMLT-VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQ 288
           S P ++      ++ +E    +    PAR++IN RTGTIVIG +VR+    +++G LTV 
Sbjct: 230 SAPRDVGQRVGFLATLENFEFMPAKAPARIVINSRTGTIVIGQDVRLLPAAITHGGLTVT 289

Query: 289 ITENEQVVQPNAFSSNGSTVT-QNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTD 347
           I+EN+QV QPN      + VT Q+  D+ + D +  F       L+ L+  +N +G    
Sbjct: 290 ISENQQVSQPNPLGQGETVVTDQSIIDVNLDDTR-MFKFDPGVTLDQLVRAVNEVGAAPG 348

Query: 348 GIISILQGIKAAGALQSEIII 368
            +++IL+ +  AGALQ E+++
Sbjct: 349 DLMAILEALSEAGALQGELVV 369


>gi|149188070|ref|ZP_01866365.1| flagellar P-ring protein precursor I [Vibrio shilonii AK1]
 gi|148838058|gb|EDL55000.1| flagellar P-ring protein precursor I [Vibrio shilonii AK1]
          Length = 363

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 155/367 (42%), Positives = 227/367 (61%), Gaps = 14/367 (3%)

Query: 8   LIFSLIGLHEISAQV-VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
             F L+GL   +A V  +RIKDV  +   R NQL+GYGLV GL GTG+    +PFTEQS 
Sbjct: 4   FTFLLLGLCFAAASVQAARIKDVAEVAGVRSNQLVGYGLVTGLPGTGEK---TPFTEQSF 60

Query: 67  RSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           RS+L+  GI  P G +   KNVAAV+VTA LP F+ PG R+DV+++S+G A SLRGG L+
Sbjct: 61  RSMLEKFGIQMPIGFKPKFKNVAAVIVTAELPAFSKPGQRVDVTVSSIGAAKSLRGGTLM 120

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKD 184
            T L G DG +YAVAQG++VVSG   +G   S + G +   G I +GA VERE+P  F  
Sbjct: 121 QTFLQGLDGEVYAVAQGNLVVSGFSAEGLDGSKIVGNNPVVGMISSGATVEREIPSPFSR 180

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMS 243
              +   L   DF+TA  +A+ IN +   + + P+    DS +V+V  P ++      +S
Sbjct: 181 GDYITFNLLQSDFTTAQNMANAINDFLGPQMASPL----DSTSVRVRAPRDLSQRVAFLS 236

Query: 244 EVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            VE +  +T D+ A++I+N RTGTIV+G +V++    V++G +TV I EN +V QPNAF 
Sbjct: 237 AVENVEFDTADSGAKIIVNSRTGTIVVGKHVKLKPAAVTHGGMTVAIKENLKVSQPNAF- 295

Query: 303 SNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
             G TV   N+D++V++  G  F+      L+ L+  +N +G     +++ILQ +K AGA
Sbjct: 296 GGGDTVVVPNSDIQVTEGSGKMFNFQPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAGA 355

Query: 362 LQSEIII 368
           ++ ++I+
Sbjct: 356 IEGQLIV 362


>gi|153831661|ref|ZP_01984328.1| flagellar P-ring protein FlgI [Vibrio harveyi HY01]
 gi|148872171|gb|EDL70988.1| flagellar P-ring protein FlgI [Vibrio harveyi HY01]
          Length = 373

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 158/375 (42%), Positives = 238/375 (63%), Gaps = 18/375 (4%)

Query: 3   FRIAFLIFSLIGLHEIS-AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           F  +FL+   +GL   S A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      F
Sbjct: 7   FFTSFLLALTLGLPATSQAEVEIPIMDLVDVQGIRENQLVGYGLVVGLAGQGDR-NQVKF 65

Query: 62  TEQSMRSLLQNLGIS---TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           T QS+ ++L+  G+    +   +L  +NVA+V VTA++ P A PG  +DV ++S+GDA S
Sbjct: 66  TAQSITNMLRQFGVQIDDSMNPKL--RNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKS 123

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERE 177
           LRGG L++T L G DG +YA+AQGSVVV GL  +G+S S +E    T G+I NGA +ERE
Sbjct: 124 LRGGTLLLTPLRGIDGEVYAIAQGSVVVGGLSAEGKSGSKVEVNTPTAGRIPNGATLERE 183

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI- 236
           +   F    ++ L LR P F+TA  IA +IN    N F   +A+A +   V++  P +  
Sbjct: 184 IETDFNQRDEITLNLRKPSFTTAKNIAREIN----NTFGPNVAKAINKARVEMRAPMDTQ 239

Query: 237 DLTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
               +MS +E ++VE    PAR++ N RTGT+VIG NV++ +  VS+GNLTV+I+E++QV
Sbjct: 240 QRVTMMSMLEEMSVEEGRKPARIVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESQQV 299

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISIL 353
            QPNAF ++G T   + T + V++ +    +I  P  +LN++++ +NS+G     ++SIL
Sbjct: 300 SQPNAF-ADGETKVVDQTQIDVNEEQAQM-VIWPPGTELNTIVNAVNSLGATPTDLMSIL 357

Query: 354 QGIKAAGALQSEIII 368
           Q +  AGAL +E+++
Sbjct: 358 QALNEAGALNAELVV 372


>gi|59712477|ref|YP_205253.1| flagellar basal body P-ring protein [Vibrio fischeri ES114]
 gi|75431558|sp|Q5E3N1|FLGI_VIBF1 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|59480578|gb|AAW86365.1| flagellar basal body P ring protein flgI [Vibrio fischeri ES114]
          Length = 373

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 227/366 (62%), Gaps = 14/366 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           ++F+ + L  IS    +RIKDV  +   R NQLIGYGLV GL GTG+S   +PFT+QS  
Sbjct: 16  VLFTWLCL-SISTAHAARIKDVAEVAGVRSNQLIGYGLVSGLPGTGES---TPFTDQSFN 71

Query: 68  SLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++LQN GI   PG +  +KNVAAVMVTA LPPF+  G  +DV+++S+G A SLRGG L+ 
Sbjct: 72  AMLQNFGIQLPPGTKPKTKNVAAVMVTATLPPFSKQGQVVDVTVSSVGSAKSLRGGTLLQ 131

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDS 185
           T L G DG  YA+AQG+++VSG    G   S + G + T G+I  GA+VERE+P  F   
Sbjct: 132 TFLKGLDGKTYAIAQGNLIVSGFSATGADGSKIVGNNPTVGRISGGAMVEREVPSPFGRG 191

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSE 244
             +   L   DF+TA R+AD +N++        +A A D+ +V+V  P +I      +S 
Sbjct: 192 DFITFNLLESDFTTAQRMADAVNNF----LGPNMASAVDATSVRVRAPRDISQRVAFLSA 247

Query: 245 VEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           VE +  +  D  A++I+N RTGTIV+G +V++    V++G +TV I EN QV QP  F S
Sbjct: 248 VENVDFDPADGSAKIIVNSRTGTIVVGKHVKLKPAAVTHGGMTVAIKENLQVSQPGPF-S 306

Query: 304 NGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           +G TV   ++D++V++ +G  F       L+ L+  +N +G     +++ILQ +K AGA+
Sbjct: 307 DGQTVVTPDSDIEVTEEQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAGAI 366

Query: 363 QSEIII 368
           + ++II
Sbjct: 367 EGQLII 372


>gi|258404730|ref|YP_003197472.1| flagellar P-ring protein [Desulfohalobium retbaense DSM 5692]
 gi|257796957|gb|ACV67894.1| flagellar P-ring protein [Desulfohalobium retbaense DSM 5692]
          Length = 369

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 147/366 (40%), Positives = 223/366 (60%), Gaps = 10/366 (2%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           A L+  L  +  + A   +RIKD+  L+  R NQ++GYGLVVGL  TGDS   + FT+++
Sbjct: 10  AILVLCLAMVWTLPA-TAARIKDIADLKGVRTNQILGYGLVVGLNDTGDS-SGTGFTKET 67

Query: 66  MRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           + ++L+ L IS+    +   NVAAVMVTA LPPF   GS +DV ++S+GDA SL GG L+
Sbjct: 68  LANMLERLNISSNREDINVGNVAAVMVTAELPPFVKTGSPVDVLVSSIGDAESLSGGTLL 127

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
            T L G DG +YAVAQG + V G+ V GQ+    +   T G++ +GA VERE+P  F   
Sbjct: 128 QTPLSGPDGKVYAVAQGPLSVGGISVSGQAGQVQKNHPTVGRVPDGATVEREVPYSFPQK 187

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMS 243
             L   ++  DF+T  RI   IN      + +  A A DS + +V  P     +  + ++
Sbjct: 188 GPLTYHIQESDFTTISRITSVIN----EEYGQKTAHAMDSASFRVRIPDAFAENRVKFIA 243

Query: 244 EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           ++E LTV+ D+ ARV++NERTGTIV+G +VR+ KV V++GNL + + E  QV QP  F S
Sbjct: 244 DLERLTVQPDSKARVVVNERTGTIVMGQDVRLDKVAVAHGNLKLMVREMPQVSQPQPF-S 302

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G T T   T+++V + +    +++   ++  + + +N+IG     +I+I Q IKAAGAL
Sbjct: 303 QGETTTVPRTEVQVEEEEARLMVMNKGVNIGDVAAALNAIGATPRDLIAIFQAIKAAGAL 362

Query: 363 QSEIII 368
            +E+++
Sbjct: 363 HAELVL 368


>gi|296103607|ref|YP_003613753.1| Flagellar P-ring protein 1, flgI [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058066|gb|ADF62804.1| Flagellar P-ring protein 1, flgI [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 375

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 147/366 (40%), Positives = 228/366 (62%), Gaps = 10/366 (2%)

Query: 7   FLIFSLIGLHEISAQVVS--RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           FL   L G+     +VV   RI+D+ ++Q  R N L+GYGL+VGL GTGD    +PFT Q
Sbjct: 11  FLSILLYGMTLAVPKVVHAERIRDLATVQGVRSNSLMGYGLIVGLDGTGDQTMQAPFTGQ 70

Query: 65  SMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           S+ ++L  LGI+ P G  +  KN+AAVMVTA LPPFA PG ++D+ ++S+G+A SLRGG 
Sbjct: 71  SLNNMLSQLGITVPPGTNMQLKNIAAVMVTAELPPFARPGDKLDIVVSSVGNAKSLRGGT 130

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L+MT L GAD  IYA+AQG++++SG   +   S        GG+I  GA VERE+P  F 
Sbjct: 131 LLMTPLKGADNQIYAIAQGNILISGAGAQAGGSRVQVNQLNGGRISGGATVEREVPNDFA 190

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKV-SKPTNIDLTRLM 242
             + + LQL   DFS A +I+D IN     R+S   A   D+RTV++ + P      R +
Sbjct: 191 TQSIVRLQLNETDFSLAQQISDAIN----QRYSGGAALPEDARTVRLFAPPDGPSRVRFL 246

Query: 243 SEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           ++++ + +  +   A+VI+N RTG++V+  +V +    V++G+LTV++ +N  + QP+  
Sbjct: 247 ADIQDIPLRVNVQDAKVIVNSRTGSVVMNRHVSLDACAVAHGSLTVEVMQNNIISQPDTP 306

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
              G TV    TD+ V D+ GS   +  + DLN++I  +NS+G   + ++S+LQ +K+AG
Sbjct: 307 FGGGETVVVPQTDISVRDSGGSLQHVRSSTDLNAVIRALNSLGATPNELMSVLQAMKSAG 366

Query: 361 ALQSEI 366
            L++++
Sbjct: 367 CLRAKL 372


>gi|26991072|ref|NP_746497.1| flagellar basal body P-ring protein [Pseudomonas putida KT2440]
 gi|148546711|ref|YP_001266813.1| flagellar basal body P-ring protein [Pseudomonas putida F1]
 gi|38372199|sp|Q88ES0|FLGI_PSEPK RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|24986106|gb|AAN69961.1|AE016634_10 flagellar P-ring protein precursor FlgI [Pseudomonas putida KT2440]
 gi|148510769|gb|ABQ77629.1| flagellar P-ring protein [Pseudomonas putida F1]
 gi|313497766|gb|ADR59132.1| FlgI [Pseudomonas putida BIRD-1]
          Length = 369

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 151/374 (40%), Positives = 223/374 (59%), Gaps = 13/374 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F +  LI + + L    A    R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MFNVRQLIATTLLLSCAFAAQAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LPPFA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPAGSGNVQLKNVAAVSVHADLPPFAKPGQVVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVEREL 178
           RGG L+MT L G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +
Sbjct: 121 RGGSLLMTPLKGIDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN--- 235
           P  F     L L L  PDF+TA RI D++N          +A+A D  +V+VS P +   
Sbjct: 181 PSGFNQGNTLTLNLNRPDFTTAKRIVDKVNDL----LGPGVAQAVDGGSVRVSAPMDPSQ 236

Query: 236 -IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQ 294
            +D   ++  +E+   +    A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  
Sbjct: 237 RVDYLSILENLEIDPGQAV--AKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPI 294

Query: 295 VVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQ 354
           V QP AFS+  + V   +      + K  F       L+ ++  +N +G     +++IL+
Sbjct: 295 VSQPGAFSNGQTAVVPRSRVNAEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILE 354

Query: 355 GIKAAGALQSEIII 368
            +K AGALQ+++I+
Sbjct: 355 ALKQAGALQADLIV 368


>gi|2920802|gb|AAC33161.1| FlgI [Vibrio cholerae]
          Length = 361

 Score =  258 bits (660), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 154/355 (43%), Positives = 222/355 (62%), Gaps = 14/355 (3%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS-T 77
           SAQ  +RIKDV  +   R+NQL+GYGLV GL GTG+S   +PFT+QS  ++LQ+ GI   
Sbjct: 15  SAQA-ARIKDVAQVAGVRNNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQSFGIQLP 70

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
           PG +  +KNVAAV+VTA+LP F+  G  ID++++S+G A SLRGG L+ T L G DG +Y
Sbjct: 71  PGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQTFLKGLDGQVY 130

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           AVAQG++VVSG    G   S + G + T G I +GAIVERE+P  F     +   L   D
Sbjct: 131 AVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFARGDYITFNLFESD 190

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDT 254
           F+TA R+AD +N +        +A A D+ ++KV  P ++      +S +E L     D+
Sbjct: 191 FTTAQRLADAVNQF----LGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPADS 246

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA    G TV   NT+
Sbjct: 247 AAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNALGG-GQTVVVPNTE 305

Query: 315 LKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 306 IEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLII 360


>gi|209695758|ref|YP_002263688.1| flagellar basal body P-ring protein [Aliivibrio salmonicida
           LFI1238]
 gi|226701940|sp|B6EJG1|FLGI_ALISL RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|208009711|emb|CAQ80015.1| flagellar P-ring protein 2 precursor (basal body P-ring protein 2)
           [Aliivibrio salmonicida LFI1238]
          Length = 373

 Score =  258 bits (660), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 226/366 (61%), Gaps = 14/366 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           LI + + L   +AQ  +RIKDV  +   R NQLIGYGLV GL GTG+S   +PFT+QS  
Sbjct: 16  LILTWLCLSISTAQA-ARIKDVSEVAGVRSNQLIGYGLVSGLPGTGES---TPFTDQSFN 71

Query: 68  SLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++LQN GI   PG +  +KNVAAVMVT  LP FA  G  +D++++S+G A SLRGG L+ 
Sbjct: 72  AMLQNFGIQLPPGTKPKTKNVAAVMVTTTLPAFAKQGQVVDITVSSVGSAKSLRGGTLLQ 131

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDS 185
           T L G DG  YA+AQG+++VSG    G   S + G + T G+I  GA+VERE+P  F   
Sbjct: 132 TFLKGLDGKTYAIAQGNLIVSGFSATGADGSKIVGNNPTVGRISGGAMVEREVPSPFGRG 191

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSE 244
             +   L + DF+TA R+AD +N++        +A A D+ +V+V  P +I      +S 
Sbjct: 192 DFITFNLLDSDFTTAQRMADAVNNF----LGPNMASAVDATSVRVRAPRDISQRVAFLSA 247

Query: 245 VEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           VE +  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN+QV QP  F  
Sbjct: 248 VENVNFDPADGSAKIIVNSRTGTIVVGKHVRLRAAAVTHGGMTVAIKENQQVSQPGPF-G 306

Query: 304 NGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           NG TV   ++D++V++ +G  F       L+ L+  +N +G     +++ILQ +K AGA+
Sbjct: 307 NGKTVVTQDSDIEVTEKQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAGAI 366

Query: 363 QSEIII 368
           + ++II
Sbjct: 367 EGQLII 372


>gi|289523329|ref|ZP_06440183.1| flagellar P-ring protein FlgI [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503021|gb|EFD24185.1| flagellar P-ring protein FlgI [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 374

 Score =  258 bits (660), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 153/380 (40%), Positives = 222/380 (58%), Gaps = 24/380 (6%)

Query: 2   IFRIAFLIFSLIGL----------HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQG 51
           ++++ F    + G+           E++  V  R+KD+  ++  R NQL G GLVVGL G
Sbjct: 5   LYKVVFCFLCVFGILGAILVESEASELAPSV--RLKDLAVVEGARSNQLTGIGLVVGLPG 62

Query: 52  TGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSIN 111
           TGD    S    + +R++ +  G+S     + S+NVAAV VT NLPPF   G  +DV ++
Sbjct: 63  TGDR---SGMATRMIRNMAEQYGLSLGTREIRSRNVAAVTVTCNLPPFTREGQTVDVLVS 119

Query: 112 SLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNG 171
           +LGDA SL GG+L+ T L  A+GN+YAVAQG V   G  V G ++     I+T G+I  G
Sbjct: 120 TLGDAKSLDGGVLLQTPLKAANGNVYAVAQGPVTTGGFAVGGAATQVSRNITTTGRIPGG 179

Query: 172 AIVERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVS 231
           AIVER++P ++   + L L LR PDF+TA R+A  IN    N+F + IA   D+  V+V+
Sbjct: 180 AIVERDVPMEYASDSKLSLLLRQPDFTTAQRLALSIN----NKFGQ-IAVPLDAARVEVA 234

Query: 232 KPTNIDL--TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQI 289
            P          ++ +E L V  D+ ARV++NERTGT+V+G NV+IS V VS+GNLTV +
Sbjct: 235 FPPAYAQYPASFVASLEQLEVRPDSVARVVVNERTGTVVMGGNVKISAVAVSHGNLTVAV 294

Query: 290 TENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDG 348
            E  QVVQP  F + G T     T++ V + +G   S+     +  L+  +NSIG     
Sbjct: 295 AEAPQVVQPEPF-AGGQTAVVPRTEIAVEEQQGRVISMPATATVTELVDALNSIGATPRD 353

Query: 349 IISILQGIKAAGALQSEIII 368
           +I+ILQ I  AGAL  E+++
Sbjct: 354 VITILQAINEAGALHGELVV 373


>gi|302343760|ref|YP_003808289.1| flagellar P-ring protein [Desulfarculus baarsii DSM 2075]
 gi|301640373|gb|ADK85695.1| flagellar P-ring protein [Desulfarculus baarsii DSM 2075]
          Length = 368

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 145/344 (42%), Positives = 218/344 (63%), Gaps = 7/344 (2%)

Query: 27  KDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKN 86
           KD+ S+   R NQLIGYGLV+GL GTGD   ++ FT Q + ++L  +G+      +  KN
Sbjct: 29  KDMASIHGVRGNQLIGYGLVMGLNGTGDKAATT-FTVQGLSNMLNRMGVKVSPDNVKVKN 87

Query: 87  VAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVV 146
           VAAVMVTA LP FA  GSRIDV+++S+GD+ SL GG LVMT L   DGNIYAVAQG V V
Sbjct: 88  VAAVMVTAELPAFARAGSRIDVTLSSIGDSDSLAGGTLVMTPLRAVDGNIYAVAQGPVSV 147

Query: 147 SGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADQ 206
            G    GQ+++  +   T G+I +GA++EREL ++F ++  + + LR PDF+ A R+A  
Sbjct: 148 GGFTAGGQAATVSKNHPTVGRIPSGAVIERELTERFGENPRISINLRVPDFTVAARVAQS 207

Query: 207 INSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVEMLTVETDTPARVIINERTG 265
           I S       R    A D  T++++ P + ++   LM+ +E L +E D  ++V+++ERTG
Sbjct: 208 IQSEIPTLAPR----AVDPSTIEITLPASGLENVALMARLENLEIEPDMSSKVVVDERTG 263

Query: 266 TIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFS 325
           T+V+G+ VRIS V V+ G L++ +TE+  V Q   F+  G TV   +TD+ V + K   +
Sbjct: 264 TVVMGEGVRISTVAVASGALSISVTESADVSQALPFAPGGETVVVPSTDVTVGEQKAPLA 323

Query: 326 LI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++     +  ++S +N++G     +I ILQ I+AAGALQ+++ I
Sbjct: 324 VVRSGVSIGQVVSALNALGATPRDLIVILQAIEAAGALQAKLEI 367


>gi|269103186|ref|ZP_06155883.1| flagellar P-ring protein FlgI [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163084|gb|EEZ41580.1| flagellar P-ring protein FlgI [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 377

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 148/350 (42%), Positives = 217/350 (62%), Gaps = 13/350 (3%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS-TPGGRL 82
           +RIKDV  +   R NQLIGYGLVVGL G+G++   +PFT+QS  ++L+N GI   PG + 
Sbjct: 35  ARIKDVSEVAGVRSNQLIGYGLVVGLAGSGET---TPFTDQSFNTMLKNFGIQLPPGTKP 91

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            +KNVAAV+V A LP FA  G  +D++++S+G A SL GG L+ T L G DG IYAVAQG
Sbjct: 92  KTKNVAAVVVNATLPAFAKQGQHVDITVSSIGSAKSLHGGTLLQTFLKGLDGKIYAVAQG 151

Query: 143 SVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VV G  ++G   S  +    T G+I NGA VE+E+   F     L   L + DF+TA 
Sbjct: 152 TLVVGGFSIEGADGSKIVSNTPTVGRISNGATVEQEIASPFGRGDYLTFNLFDSDFTTAQ 211

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVET-DTPARVI 259
           R+AD +N +        +A A D+ +++V  P ++      +S +E L  ET D+ A++I
Sbjct: 212 RMADAVNQF----LGPDMASAIDATSIRVRAPRDVSQRVAFLSTIENLEFETADSAAKII 267

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           +N RTGTIV+G +VR+    +++G +TV I EN QV QPNAF S G TV   N+D+ V++
Sbjct: 268 VNSRTGTIVVGQHVRLKPAAITHGGMTVTIKENAQVSQPNAF-SQGQTVVTPNSDINVTE 326

Query: 320 -NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            N   F       L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 327 KNARMFVFQPGVTLDDLVRAVNQVGAGPSDVMAILQALKQAGAIEGQLII 376


>gi|293605007|ref|ZP_06687403.1| flagellar P-ring protein FlgI [Achromobacter piechaudii ATCC 43553]
 gi|292816612|gb|EFF75697.1| flagellar P-ring protein FlgI [Achromobacter piechaudii ATCC 43553]
          Length = 369

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 151/348 (43%), Positives = 214/348 (61%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R +PFT+QS+ ++L  LGI+ P G  + 
Sbjct: 25  RLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTPFTQQSLTNMLSQLGITVPAGSNMQ 84

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVT  LP FA PG  +DV ++S+G+A SLRGG L+MT L GAD  +YA+AQG+
Sbjct: 85  LKNVAAVMVTTTLPAFARPGQTLDVVVSSMGNAKSLRGGTLLMTPLKGADSQVYAIAQGN 144

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       SS       GG+I  GAIVER +P  F     + ++L N DF TA  +
Sbjct: 145 ILVGGAGASAGGSSVQINQLNGGRISAGAIVERGVPTTFSRDGYIHVELNNTDFGTAQNV 204

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVEMLTV-ETDTPARVIIN 261
           A  +N     +F +  A A D R V+V  P       R +S+VE L V    T A+VIIN
Sbjct: 205 AQALN----RKFGQGTATALDGRVVQVRTPMEQASQARFLSQVEDLQVARAPTVAKVIIN 260

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+   V I +  V++GNL+V I    QV QP+   + G TV   NT ++V  + 
Sbjct: 261 ARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVSQPDTPFTEGQTVVVPNTQIEVRQDN 320

Query: 322 GSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           GS   +  + +L  ++ G+N++G     +++ILQ +K AGAL++E+ I
Sbjct: 321 GSLQRVSTSANLADVVKGLNALGATPQDLLAILQAMKTAGALRAELEI 368


>gi|323498416|ref|ZP_08103412.1| flagellar basal body P-ring protein [Vibrio sinaloensis DSM 21326]
 gi|323316489|gb|EGA69504.1| flagellar basal body P-ring protein [Vibrio sinaloensis DSM 21326]
          Length = 363

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 151/350 (43%), Positives = 217/350 (62%), Gaps = 13/350 (3%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS-TPGGRL 82
           +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+QS  ++LQ+ GI   PG + 
Sbjct: 21  ARIKDVAQVAGVRSNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQSFGIQLPPGTKP 77

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            +KNVAAV+VTA LP F+  G  IDV+++S+G A SLRGG L+ T L G DG +YAVAQG
Sbjct: 78  KTKNVAAVIVTAELPAFSKQGQTIDVTVSSIGSAKSLRGGTLMQTMLKGLDGQVYAVAQG 137

Query: 143 SVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VVSG    G   S + G + T G I NGA+VERE+P  F     +   L   DF+TA 
Sbjct: 138 NLVVSGFSATGADGSKIVGNNPTAGMISNGAMVEREIPSPFGRGDYITFNLLESDFTTAQ 197

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDTPARVI 259
           R+AD +N++        +A A D+ ++KV  P +I      +S +E L     +  A++I
Sbjct: 198 RMADAVNNF----LGPQMASAVDATSIKVRAPRDISQRVAFLSAIENLEFNPAEGSAKII 253

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           +N RTGTIV+G +VR+    V++G +TV I EN  V QPNAF   G TV   +TD++V++
Sbjct: 254 VNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPNAF-GGGETVVVPDTDIQVTE 312

Query: 320 NKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            +G  F       L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 313 EQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLII 362


>gi|153213605|ref|ZP_01948878.1| flagellar P-ring protein FlgI [Vibrio cholerae 1587]
 gi|153825355|ref|ZP_01978022.1| flagellar P-ring protein FlgI [Vibrio cholerae MZO-2]
 gi|153829338|ref|ZP_01982005.1| flagellar P-ring protein FlgI [Vibrio cholerae 623-39]
 gi|183179569|ref|ZP_02957780.1| flagellar P-ring protein FlgI [Vibrio cholerae MZO-3]
 gi|229513837|ref|ZP_04403299.1| flagellar P-ring protein FlgI [Vibrio cholerae TMA 21]
 gi|229522142|ref|ZP_04411559.1| flagellar P-ring protein FlgI [Vibrio cholerae TM 11079-80]
 gi|229524188|ref|ZP_04413593.1| flagellar P-ring protein FlgI [Vibrio cholerae bv. albensis VL426]
 gi|229528802|ref|ZP_04418192.1| flagellar P-ring protein FlgI [Vibrio cholerae 12129(1)]
 gi|262191685|ref|ZP_06049861.1| flagellar P-ring protein FlgI [Vibrio cholerae CT 5369-93]
 gi|297580839|ref|ZP_06942764.1| flagellar P-ring protein FlgI [Vibrio cholerae RC385]
 gi|124115804|gb|EAY34624.1| flagellar P-ring protein FlgI [Vibrio cholerae 1587]
 gi|148875179|gb|EDL73314.1| flagellar P-ring protein FlgI [Vibrio cholerae 623-39]
 gi|149741039|gb|EDM55108.1| flagellar P-ring protein FlgI [Vibrio cholerae MZO-2]
 gi|183012980|gb|EDT88280.1| flagellar P-ring protein FlgI [Vibrio cholerae MZO-3]
 gi|229332576|gb|EEN98062.1| flagellar P-ring protein FlgI [Vibrio cholerae 12129(1)]
 gi|229337769|gb|EEO02786.1| flagellar P-ring protein FlgI [Vibrio cholerae bv. albensis VL426]
 gi|229341067|gb|EEO06072.1| flagellar P-ring protein FlgI [Vibrio cholerae TM 11079-80]
 gi|229349018|gb|EEO13975.1| flagellar P-ring protein FlgI [Vibrio cholerae TMA 21]
 gi|262032424|gb|EEY50986.1| flagellar P-ring protein FlgI [Vibrio cholerae CT 5369-93]
 gi|297534665|gb|EFH73501.1| flagellar P-ring protein FlgI [Vibrio cholerae RC385]
 gi|327484712|gb|AEA79119.1| Flagellar P-ring protein FlgI [Vibrio cholerae LMA3894-4]
          Length = 361

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 154/355 (43%), Positives = 222/355 (62%), Gaps = 14/355 (3%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS-T 77
           SAQ  +RIKDV  +   R+NQL+GYGLV GL GTG+S   +PFT+QS  ++LQ+ GI   
Sbjct: 15  SAQA-ARIKDVAQVAGVRNNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQSFGIQLP 70

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
           PG +  +KNVAAV+VTA+LP F+  G  ID++++S+G A SLRGG L+ T L G DG +Y
Sbjct: 71  PGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQTFLKGLDGQVY 130

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           AVAQG++VVSG    G   S + G + T G I +GAIVERE+P  F     +   L   D
Sbjct: 131 AVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYITFNLFESD 190

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDT 254
           F+TA R+AD +N +        +A A D+ ++KV  P ++      +S +E L     D+
Sbjct: 191 FTTAQRLADAVNQF----LGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPADS 246

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA    G TV   NT+
Sbjct: 247 AAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLSVSQPNAL-GGGQTVVVPNTE 305

Query: 315 LKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 306 IEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLII 360


>gi|15642192|ref|NP_231824.1| flagellar basal body P-ring protein [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121586253|ref|ZP_01676043.1| flagellar P-ring protein FlgI [Vibrio cholerae 2740-80]
 gi|121726533|ref|ZP_01679782.1| flagellar P-ring protein FlgI [Vibrio cholerae V52]
 gi|147674065|ref|YP_001217710.1| flagellar basal body P-ring protein [Vibrio cholerae O395]
 gi|153817090|ref|ZP_01969757.1| flagellar P-ring protein FlgI [Vibrio cholerae NCTC 8457]
 gi|153820873|ref|ZP_01973540.1| flagellar P-ring protein FlgI [Vibrio cholerae B33]
 gi|227082317|ref|YP_002810868.1| flagellar P-ring protein FlgI [Vibrio cholerae M66-2]
 gi|229507730|ref|ZP_04397235.1| flagellar P-ring protein FlgI [Vibrio cholerae BX 330286]
 gi|229512075|ref|ZP_04401554.1| flagellar P-ring protein FlgI [Vibrio cholerae B33]
 gi|229519211|ref|ZP_04408654.1| flagellar P-ring protein FlgI [Vibrio cholerae RC9]
 gi|229607234|ref|YP_002877882.1| flagellar basal body P-ring protein [Vibrio cholerae MJ-1236]
 gi|254849322|ref|ZP_05238672.1| flagellar P-ring protein precursor [Vibrio cholerae MO10]
 gi|255747108|ref|ZP_05421053.1| flagellar P-ring protein FlgI [Vibrio cholera CIRS 101]
 gi|262161348|ref|ZP_06030458.1| flagellar P-ring protein FlgI [Vibrio cholerae INDRE 91/1]
 gi|262167781|ref|ZP_06035483.1| flagellar P-ring protein FlgI [Vibrio cholerae RC27]
 gi|298500429|ref|ZP_07010234.1| flagellar P-ring protein FlgI [Vibrio cholerae MAK 757]
 gi|14548044|sp|Q9KQ14|FLGI_VIBCH RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|172047625|sp|A5F677|FLGI_VIBC3 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|254789299|sp|C3LPJ7|FLGI_VIBCM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|9656749|gb|AAF95338.1| flagellar P-ring protein FlgI [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121549519|gb|EAX59545.1| flagellar P-ring protein FlgI [Vibrio cholerae 2740-80]
 gi|121630986|gb|EAX63365.1| flagellar P-ring protein FlgI [Vibrio cholerae V52]
 gi|126512358|gb|EAZ74952.1| flagellar P-ring protein FlgI [Vibrio cholerae NCTC 8457]
 gi|126521665|gb|EAZ78888.1| flagellar P-ring protein FlgI [Vibrio cholerae B33]
 gi|146315948|gb|ABQ20487.1| flagellar P-ring protein FlgI [Vibrio cholerae O395]
 gi|227010205|gb|ACP06417.1| flagellar P-ring protein FlgI [Vibrio cholerae M66-2]
 gi|227014089|gb|ACP10299.1| flagellar P-ring protein FlgI [Vibrio cholerae O395]
 gi|229343900|gb|EEO08875.1| flagellar P-ring protein FlgI [Vibrio cholerae RC9]
 gi|229352040|gb|EEO16981.1| flagellar P-ring protein FlgI [Vibrio cholerae B33]
 gi|229355235|gb|EEO20156.1| flagellar P-ring protein FlgI [Vibrio cholerae BX 330286]
 gi|229369889|gb|ACQ60312.1| flagellar P-ring protein FlgI [Vibrio cholerae MJ-1236]
 gi|254845027|gb|EET23441.1| flagellar P-ring protein precursor [Vibrio cholerae MO10]
 gi|255735510|gb|EET90910.1| flagellar P-ring protein FlgI [Vibrio cholera CIRS 101]
 gi|262023846|gb|EEY42545.1| flagellar P-ring protein FlgI [Vibrio cholerae RC27]
 gi|262028659|gb|EEY47313.1| flagellar P-ring protein FlgI [Vibrio cholerae INDRE 91/1]
 gi|297541122|gb|EFH77176.1| flagellar P-ring protein FlgI [Vibrio cholerae MAK 757]
          Length = 361

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 154/355 (43%), Positives = 222/355 (62%), Gaps = 14/355 (3%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS-T 77
           SAQ  +RIKDV  +   R+NQL+GYGLV GL GTG+S   +PFT+QS  ++LQ+ GI   
Sbjct: 15  SAQA-ARIKDVAQVAGVRNNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQSFGIQLP 70

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
           PG +  +KNVAAV+VTA+LP F+  G  ID++++S+G A SLRGG L+ T L G DG +Y
Sbjct: 71  PGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQTFLKGLDGQVY 130

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           AVAQG++VVSG    G   S + G + T G I +GAIVERE+P  F     +   L   D
Sbjct: 131 AVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYITFNLFESD 190

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDT 254
           F+TA R+AD +N +        +A A D+ ++KV  P ++      +S +E L     D+
Sbjct: 191 FTTAQRLADAVNQF----LGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPADS 246

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA    G TV   NT+
Sbjct: 247 AAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNALGG-GQTVVVPNTE 305

Query: 315 LKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 306 IEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLII 360


>gi|260774942|ref|ZP_05883843.1| flagellar P-ring protein FlgI [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609197|gb|EEX35355.1| flagellar P-ring protein FlgI [Vibrio coralliilyticus ATCC BAA-450]
          Length = 363

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 152/350 (43%), Positives = 218/350 (62%), Gaps = 13/350 (3%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS-TPGGRL 82
           +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+QS  ++L+N GI   PG + 
Sbjct: 21  ARIKDVSQVAGVRSNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLENFGIQLPPGTKP 77

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            SKNVAAV+VTA+L  F+  G  IDV+++S+G A SLRGG L+ T L G DG IYAVAQG
Sbjct: 78  KSKNVAAVIVTADLAAFSKQGQTIDVTVSSIGSAKSLRGGTLMQTMLKGLDGQIYAVAQG 137

Query: 143 SVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VVSG    G   S + G + T G I NGAIVERE+P  F     +   L   DF+TA 
Sbjct: 138 NLVVSGFSATGADGSKIVGNNPTAGMISNGAIVEREIPSPFGRGDYITFNLLESDFTTAQ 197

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDTPARVI 259
           R+AD +N++        +A+A D+ +VKV  P +I      +S +E L     +  A++I
Sbjct: 198 RMADAVNNF----LGPQMAQAIDATSVKVRAPRDISQRVSFLSAIENLEFNPAEGSAKII 253

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           +N RTGTIV+G +VR+    +++G +TV I EN  V QPNAF   G TV   +TD++V++
Sbjct: 254 VNSRTGTIVVGKHVRLKPAAITHGGMTVAIKENLNVSQPNAF-GGGETVVTPDTDIEVTE 312

Query: 320 NKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            +G  F       L+ L+  +N +G     +++ILQ +K AGA++ ++I+
Sbjct: 313 EQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLIV 362


>gi|117919776|ref|YP_868968.1| flagellar basal body P-ring protein [Shewanella sp. ANA-3]
 gi|166214840|sp|A0KUU3|FLGI_SHESA RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|117612108|gb|ABK47562.1| flagellar P-ring protein [Shewanella sp. ANA-3]
          Length = 363

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 225/373 (60%), Gaps = 20/373 (5%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +I  +A L+ SL    E       RIKD+ ++Q  R NQLIGYGLVVGL GTG+    + 
Sbjct: 5   LIVALAMLVLSLPSQAE-------RIKDIANVQGVRSNQLIGYGLVVGLPGTGEK---TN 54

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+  ++L+N GI+ P   R   KNVA V V A++P F  PG ++DV+++SLG+A SL
Sbjct: 55  YTEQTFTTMLKNFGINLPDNFRPKIKNVAVVAVHADMPAFIKPGQQLDVTVSSLGEAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T L G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGAIVER +
Sbjct: 115 RGGTLLQTFLKGVDGNVYAIAQGSLVVSGFSAEGLDGSKVIQNTPTVGRIPNGAIVERSV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R+AD IN       +RP+    D+ +V+VS P ++  
Sbjct: 175 ATPFSSGDYLTFNLRRADFSTAQRMADAINDLLGPDMARPL----DATSVQVSAPRDVSQ 230

Query: 238 LTRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E L V   +  A+VI+N RTGTIV+G +V++    V++G LTV I E  QV 
Sbjct: 231 RVSFLATLENLDVIPAEESAKVIVNSRTGTIVVGQHVKLLPAAVTHGGLTVTIAEATQVS 290

Query: 297 QPNAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPNA  +NG TV   NT + V++ ++  F       L+ L+  +N +G     +++IL+ 
Sbjct: 291 QPNAL-ANGETVVTANTTIGVNESDRRMFMFSPGTTLDELVRAVNLVGAAPSDVLAILEA 349

Query: 356 IKAAGALQSEIII 368
           +K AGAL  E+II
Sbjct: 350 LKVAGALHGELII 362


>gi|126668562|ref|ZP_01739516.1| flagellar P-ring protein precursor I [Marinobacter sp. ELB17]
 gi|126626967|gb|EAZ97610.1| flagellar P-ring protein precursor I [Marinobacter sp. ELB17]
          Length = 384

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 145/369 (39%), Positives = 222/369 (60%), Gaps = 19/369 (5%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L  +L+ L   S  +  R+KD+  ++  RDNQL+GYGLVVGL G+GD    +PFT Q+ R
Sbjct: 26  LAIALMALMVASPVMADRLKDLARIKGVRDNQLVGYGLVVGLAGSGDK---APFTNQTFR 82

Query: 68  SLLQNLGISTPGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           +++   G++ P G   +L   NVAAV V A +PPFA PG +ID++++S+G+A SLRGG L
Sbjct: 83  NMMNQFGVTLPQGVDPKLA--NVAAVTVNATIPPFAKPGQQIDITVSSIGNAKSLRGGTL 140

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           +MT+L GADGN+YA+AQGS++V G   +G   S     I + G+I NGA VERE+   F 
Sbjct: 141 LMTTLKGADGNVYALAQGSLIVGGFGAEGLDGSRITVNIPSAGRIPNGATVEREVVSPFN 200

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLT 239
           +   +   L   DF+TA R+ + IN          +A A+D+ +V V  P +    +   
Sbjct: 201 NGDTVTFNLLRSDFTTARRVVEAING----NLGPDMAYAHDATSVSVRAPRDASQRVSFL 256

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            ++  +E+   E    A+V+IN RTGTIV+G NV++S   V++G+LTV I EN  VVQPN
Sbjct: 257 SILENIEVNPAEA--AAKVVINSRTGTIVVGQNVKVSAAAVTHGSLTVIIQENPNVVQPN 314

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
             ++  + V Q++      D    F    A  LN ++  +N +G     ++++L+ +K A
Sbjct: 315 PLAAGNTEVVQDSQIAVTEDPARMFKFGPAVTLNEIVQAVNQVGAAPGDVMAVLEALKQA 374

Query: 360 GALQSEIII 368
           GAL++E+I+
Sbjct: 375 GALRAELIV 383


>gi|146307865|ref|YP_001188330.1| flagellar basal body P-ring protein [Pseudomonas mendocina ymp]
 gi|145576066|gb|ABP85598.1| flagellar P-ring protein [Pseudomonas mendocina ymp]
          Length = 386

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 151/348 (43%), Positives = 209/348 (60%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLG 83
           R+KD+ S+Q  R NQLIGYGLVVGL G+GD    +PFT Q+  ++L   GI  P GG + 
Sbjct: 42  RLKDLASIQGVRSNQLIGYGLVVGLNGSGDQTTQTPFTVQTFNNMLAQFGIKVPPGGNVQ 101

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV V A LP FA PG  ID++I+S+G+A SLRGG L+MT L G DGN+YA+AQG+
Sbjct: 102 LKNVAAVSVHAELPAFAKPGQTIDITISSIGNAKSLRGGSLLMTPLKGIDGNVYAIAQGN 161

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G    G   S +   + + G+I  GA VER +P  F     L L L  PDF+TA  
Sbjct: 162 LVVGGFDASGADGSRITVNVPSAGRIPGGATVERPVPSGFDQGNYLTLNLNRPDFTTAKN 221

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVETDTP-ARVII 260
           I DQIN          +A+A D  +++VS P + +     +S +E L V+     A+VII
Sbjct: 222 IVDQINDL----LGPGVAQAIDGGSIRVSAPLDPNQRVDYLSILENLEVQAGQAVAKVII 277

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTGTIVIG NVR+    V++G+LTV ITE+  V QP AFS   + V   +      + 
Sbjct: 278 NSRTGTIVIGQNVRVQPAAVTHGSLTVTITEDPIVSQPEAFSGGQTAVVPRSRVGAEEET 337

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 338 KPMFKFGPGTSLDEIVRAVNQVGAAPSDLMAILEALKQAGALQADLIV 385


>gi|163803173|ref|ZP_02197056.1| flagellar P-ring protein precursor [Vibrio sp. AND4]
 gi|159173073|gb|EDP57906.1| flagellar P-ring protein precursor [Vibrio sp. AND4]
          Length = 373

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 156/375 (41%), Positives = 239/375 (63%), Gaps = 18/375 (4%)

Query: 3   FRIAFLIFSLIGLHEIS-AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           F  +FL+   +GL   S A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      F
Sbjct: 7   FFSSFLLAMALGLPATSQAEVEIPIMDLVDVQGIRENQLVGYGLVVGLAGQGDR-NQVKF 65

Query: 62  TEQSMRSLLQNLGIS---TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           T QS+ ++L+  G+    +   +L  +NVA+V VTA++ P A PG  +DV ++S+GDA S
Sbjct: 66  TAQSITNMLRQFGVQIDDSMNPKL--RNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKS 123

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERE 177
           LRGG L++T L G DG +YA+AQGSVVV GL  +G+S S +E    T G+I NGA +ERE
Sbjct: 124 LRGGTLLLTPLRGIDGEVYAIAQGSVVVGGLSAEGKSGSKVEVNTPTAGRIPNGATIERE 183

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI- 236
           +   F    ++ L LR P F+TA  IA +IN    N F   +A+A +   V++  P +  
Sbjct: 184 IETDFNQRDEITLNLRKPSFTTAKNIARKIN----NTFGPNVAKAINKARVEMRAPMDTQ 239

Query: 237 DLTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
               +MS +E ++VE    PAR++ N RTGT+VIG NV++ +  VS+GNLTV+++E++QV
Sbjct: 240 QRVTMMSMLEEMSVEEGRKPARIVFNARTGTVVIGKNVKVGEAAVSHGNLTVRVSESQQV 299

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISIL 353
            QPNAF ++G T   + + + V++++    +I  P  +LN++++ +NS+G     ++SIL
Sbjct: 300 SQPNAF-ADGKTEVVDQSQIDVNEDQAKM-VIWPPGTELNTIVNAVNSLGATPTDLMSIL 357

Query: 354 QGIKAAGALQSEIII 368
           Q +  AGAL +E+++
Sbjct: 358 QALNEAGALNAELVV 372


>gi|330445352|ref|ZP_08309004.1| flagellar P-ring family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489543|dbj|GAA03501.1| flagellar P-ring family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 363

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 159/375 (42%), Positives = 231/375 (61%), Gaps = 20/375 (5%)

Query: 1   MIFR-IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           M FR I  L F L+     S+   +RIKDV S+   R NQL+GYGLVVGL GTG++   +
Sbjct: 1   MNFRTIILLGFVLLS----SSANAARIKDVSSVAGVRSNQLVGYGLVVGLPGTGET---T 53

Query: 60  PFTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           PFT+QS  ++LQN GI  P G +   KNVAAV V A LPPF   G  ID++++S+G A S
Sbjct: 54  PFTDQSFNAMLQNFGIQLPVGTKPKIKNVAAVAVNATLPPFTKQGQTIDITVSSIGSAKS 113

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEG-ISTGGKIVNGAIVERE 177
           LRGG L+ T L G DG +YA+AQG++VV G   +G   S + G   T G+I NGA+VE+E
Sbjct: 114 LRGGTLLQTFLKGLDGKVYAIAQGTLVVGGFSAEGADGSKVIGNTPTVGRISNGAMVEQE 173

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRP-IAEAYDSRTVKVSKPTNI 236
           +P  F     L   L + DF+TA R+AD     S+N+F  P +A A D+ ++KV  P ++
Sbjct: 174 VPNPFGRGDYLTFNLHDSDFTTAQRMAD-----SINQFLGPNMASAVDATSIKVRAPRDV 228

Query: 237 -DLTRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQ 294
                 +S VE +  +  +  A++I+N RTGTIVIG +V++    +++G +TV I EN +
Sbjct: 229 SQRVAFLSTVENIEFDPAEGSAKIIVNSRTGTIVIGQHVKLKPAAITHGGMTVSIKENPK 288

Query: 295 VVQPNAFSSNGSTVTQN-NTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISIL 353
           V QPNAF+   +TV QN N  ++ SD++  F       L+ L+  +N +G     +++IL
Sbjct: 289 VSQPNAFAGGETTVVQNSNITVEESDSR-MFKFEPGVTLDELVRAVNQVGAAPSDLMAIL 347

Query: 354 QGIKAAGALQSEIII 368
           Q +K AGA++ ++II
Sbjct: 348 QALKQAGAIEGQLII 362


>gi|317406197|gb|EFV86446.1| flagellar P-ring protein [Achromobacter xylosoxidans C54]
          Length = 378

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 214/348 (61%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R +PFT+QS+ ++L  LGI+ P G  + 
Sbjct: 34  RLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTPFTQQSLTNMLSQLGITVPAGSNMQ 93

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVT  LP FA PG  +DV ++S+G+A SLRGG L+MT L GAD  +YA+AQG+
Sbjct: 94  LKNVAAVMVTTTLPAFARPGQTLDVVVSSMGNAKSLRGGTLLMTPLKGADSQVYAIAQGN 153

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       SS       GG+I  GAIVER +P  F     + L++ N DF TA  +
Sbjct: 154 ILVGGAGASAGGSSVQINQLNGGRISGGAIVERGVPTTFARDGYIYLEMNNTDFGTAQNV 213

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVEMLTV-ETDTPARVIIN 261
            + +N     +F +  A A D R V+V  P       R +S+VE L V    T A+VIIN
Sbjct: 214 VNALN----RKFGQGTATALDGRVVQVRTPMEQASQARFLSQVEDLQVTRAPTVAKVIIN 269

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+   V I +  V++GNL+V I    QV QP+   + G TV   NT ++V  + 
Sbjct: 270 ARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVSQPDTPFTEGQTVVVPNTQIEVRQDN 329

Query: 322 GSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           GS   +  + +L  ++ G+N++G     +++ILQ +K AGAL++E+ I
Sbjct: 330 GSLQRVTTSANLADVVKGLNALGATPQDLLAILQAMKTAGALRAELEI 377


>gi|119775446|ref|YP_928186.1| flagellar basal body P-ring protein [Shewanella amazonensis SB2B]
 gi|166214837|sp|A1S810|FLGI_SHEAM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|119767946|gb|ABM00517.1| flagellar P-ring protein FlgI [Shewanella amazonensis SB2B]
          Length = 363

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 149/348 (42%), Positives = 211/348 (60%), Gaps = 11/348 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+ ++Q  R NQLIGYGLVVGL GTG+    + +TEQ+  ++L+N GI+ P   +  
Sbjct: 22  RIKDIAAVQGVRSNQLIGYGLVVGLPGTGEK---ANYTEQTFTTMLKNFGINLPTNVKPK 78

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVA V V A++PPF  PG  +DV+++S+G+A SLRGG L+ T L G DGNIYA+AQGS
Sbjct: 79  IKNVAVVAVHADMPPFIKPGQTLDVTVSSIGEAKSLRGGTLLQTFLKGVDGNIYAIAQGS 138

Query: 144 VVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VVSG   +G   S  ++   T G+I NGA+VER +P  F     L   L   DFSTA R
Sbjct: 139 MVVSGFSAEGLDGSKVIQNTPTVGRIPNGALVERAVPSAFAHGDFLTFNLHRADFSTAKR 198

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDTPARVII 260
           +AD IN    +     +A A D+ +V+V  P +       ++ +E + VE  D  A+VI+
Sbjct: 199 MADAIN----DLLGPEMARALDAASVQVYAPRDASQRVSFLATLENVEVEPADESAKVIV 254

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTGTIV+G NV++    V++G LTV I EN+QV QPNA +   + VT  +T      N
Sbjct: 255 NSRTGTIVVGQNVKLLPAAVTHGGLTVTIAENQQVSQPNALAGGDTVVTNQSTIDASQAN 314

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              F       L+ L+  +N +G     +++IL+ +K AGAL  E+I+
Sbjct: 315 SRMFLFNPGTSLDELVRAVNLVGAAPSDVLAILEALKMAGALHGELIV 362


>gi|89056667|ref|YP_512118.1| flagellar basal body P-ring protein [Jannaschia sp. CCS1]
 gi|88866216|gb|ABD57093.1| flagellar P-ring protein FlgI [Jannaschia sp. CCS1]
          Length = 367

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 153/367 (41%), Positives = 227/367 (61%), Gaps = 11/367 (2%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           FL+  +     ++  +  RIKD+V     R N L+GYGL+VGL GTGD LR++PFTE+ M
Sbjct: 8   FLVACIFATAAVATPI--RIKDLVEFDGVRGNDLVGYGLIVGLNGTGDGLRNAPFTEEIM 65

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
            ++L+ LG++  G +   +NVAAV+VTA LPPF+  G +ID++++++GDA SL GG LVM
Sbjct: 66  VNVLERLGVNVTGEQFRPQNVAAVIVTATLPPFSRQGGQIDITVSAIGDAESLLGGTLVM 125

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L  ADG IYAVAQG+V+  G    G  +  ++G+ T G I  GA VERE+   F   +
Sbjct: 126 TPLTAADGEIYAVAQGAVIAGGASAGGDGAEIIQGVPTAGVIPAGARVEREVEFDFASMS 185

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTV--KVSKPTNIDLTRLMSE 244
            + L LR PDF+TA RI   IN+     F R +A   DS TV   +S          ++ 
Sbjct: 186 QIRLALRTPDFTTAARIEVAINT----EFGRGVASMLDSGTVLLDISATRAPSPAHALTR 241

Query: 245 VEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           VE + V  +T ARV++++R+GTIV+G++VRIS+V V+ GNLT++I E    VQPN F + 
Sbjct: 242 VENILVVPETRARVVVDQRSGTIVMGEDVRISRVAVAQGNLTLRIQEEPIAVQPNPF-AE 300

Query: 305 GSTVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           G TV    T+  +++  G+    L     L+ ++  +N++G+    +I IL  I+AAGAL
Sbjct: 301 GETVILPRTNAGLAEEAGTGLAELSGGTSLSEVVGALNALGVSPRDMIDILSSIEAAGAL 360

Query: 363 QSEIIIQ 369
            +E I++
Sbjct: 361 HAEFIVR 367


>gi|119503648|ref|ZP_01625731.1| flagellar P-ring protein precursor I [marine gamma proteobacterium
           HTCC2080]
 gi|119460710|gb|EAW41802.1| flagellar P-ring protein precursor I [marine gamma proteobacterium
           HTCC2080]
          Length = 373

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 147/349 (42%), Positives = 212/349 (60%), Gaps = 9/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG-GRLG 83
           RIKD+  L+  R NQL+G+GL+VGL G+GD +  +PFT Q+ RS+LQ  G++ P      
Sbjct: 28  RIKDLAMLEGARTNQLVGFGLIVGLDGSGDQVTQTPFTLQAARSMLQQFGVNVPANSNPQ 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L+MT L   +G +Y VAQGS
Sbjct: 88  TKNVAAVMVTATLPPFAKPGQTIDVTVSSLGNAKSLRGGELLMTQLKAGNGEVYVVAQGS 147

Query: 144 VVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++VSG   +G   SS      + G+I NG IVERE+      +  +   L +PDFSTA  
Sbjct: 148 LIVSGFGAEGADGSSISLNTKSAGRIPNGGIVEREVLTPLHGAGPITFNLHSPDFSTASN 207

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLMSEVEMLTVE-TDTPARVII 260
           +A  IN +         A A D+ +V+V  P   D     ++E+E + V+     A+VI+
Sbjct: 208 MAAAINGF----MGPGTASALDAVSVRVVAPAEPDAKVAYVAELENIQVQRAAASAKVIV 263

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD- 319
           N R+GTIVIG  V +    V++GNLTV + E+ +V QP  FS  G TV    +++ + D 
Sbjct: 264 NARSGTIVIGAEVMVKTAAVAHGNLTVSVDESVEVSQPGPFSRVGETVVTTQSEVNIEDE 323

Query: 320 NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           N   F L D   L  +++ +N +G     +I+IL+ ++ AGAL +++II
Sbjct: 324 NLRMFLLNDGVSLQEIVTAINRVGAAPGDLIAILEALQQAGALSAQLII 372


>gi|170722887|ref|YP_001750575.1| flagellar basal body P-ring protein [Pseudomonas putida W619]
 gi|169760890|gb|ACA74206.1| flagellar P-ring protein [Pseudomonas putida W619]
          Length = 369

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 153/374 (40%), Positives = 223/374 (59%), Gaps = 13/374 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F +  LI + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MFNVRQLIAATLLLSCAFGAHAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LPPFA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPAGSGNVQLKNVAAVSVHADLPPFAKPGQVVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVEREL 178
           RGG L+MT L G DGN+YAVAQG++VV G   +G+  S +   + + G+I  GA VER +
Sbjct: 121 RGGSLLMTPLKGIDGNVYAVAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL 238
           P  F     L L L  PDF+TA RI D++N          +A+A D  +V+VS P  +D 
Sbjct: 181 PSGFNQGNTLTLNLNRPDFTTAKRIVDKVNEL----LGPGVAQAVDGGSVRVSAP--MDP 234

Query: 239 TRLMSEVEML-TVETD---TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQ 294
           T+ +  + +L  +E D     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  
Sbjct: 235 TQRVDYLSILENLEIDPGQAVAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPI 294

Query: 295 VVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQ 354
           V QP  FS+  + V   +      + K  F       L+ ++  +N +G     +++IL+
Sbjct: 295 VSQPGPFSNGETAVVPRSRVNAQQEAKPMFKFGPGTTLDEIVRAVNQVGAAPSDLMAILE 354

Query: 355 GIKAAGALQSEIII 368
            +K AGALQ+++I+
Sbjct: 355 ALKQAGALQADLIV 368


>gi|192360563|ref|YP_001982396.1| flagellar basal body P-ring protein [Cellvibrio japonicus Ueda107]
 gi|190686728|gb|ACE84406.1| flagellar P-ring protein FlgI [Cellvibrio japonicus Ueda107]
          Length = 378

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 152/364 (41%), Positives = 218/364 (59%), Gaps = 15/364 (4%)

Query: 13  IGLHEIS-AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
           I L  IS A    RIKD+ S+   R NQL+GYGLVVGL GTGD    SPFT QS  S+L+
Sbjct: 21  IALFAISVAAQAERIKDIASVAGVRANQLVGYGLVVGLDGTGDQTTQSPFTVQSFNSMLK 80

Query: 72  NLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLL 130
             GI+ P G R+  KNVAAVMV A LP FA PG  +D++++S+ +A SLRGG L+MT L 
Sbjct: 81  QFGITVPEGARMQMKNVAAVMVQAELPAFAKPGQTLDITVSSISNAKSLRGGSLLMTPLK 140

Query: 131 GADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLI 189
           G DG +YAVAQG++VV GL   G   S +   + + G+I  GA+VER +   F     ++
Sbjct: 141 GLDGKVYAVAQGNLVVGGLSATGADGSRITVNVPSAGRIPGGALVERMVETNFTAGQPIV 200

Query: 190 LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLTRLMSEV 245
             L   DF+TA R+A  IN +     +RP+    D+ +V V  P N    +D   ++  +
Sbjct: 201 FNLNRADFTTANRLAQAINKFLGPDTARPL----DAVSVMVDSPQNPAQRVDFIAMLENL 256

Query: 246 EMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
           E+   E    ARVIIN RTGTIV+G NVR+S V V++G+LTV + E+  V QPN     G
Sbjct: 257 EVTPGEEA--ARVIINSRTGTIVVGKNVRVSPVAVTHGSLTVTVAESLTVSQPNPL-GQG 313

Query: 306 STVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
           +TV   +T++   +     F       L+ ++  +N++G     +++IL+ +K AGAL++
Sbjct: 314 TTVVVPSTNITAEEKTNPMFKFAPGASLDDIVRSVNNVGASPSDLMAILEALKQAGALKA 373

Query: 365 EIII 368
           E+++
Sbjct: 374 ELVV 377


>gi|258621053|ref|ZP_05716087.1| flagellar P-ring protein FlgI [Vibrio mimicus VM573]
 gi|258625281|ref|ZP_05720189.1| flagellar P-ring protein FlgI [Vibrio mimicus VM603]
 gi|258582454|gb|EEW07295.1| flagellar P-ring protein FlgI [Vibrio mimicus VM603]
 gi|258586441|gb|EEW11156.1| flagellar P-ring protein FlgI [Vibrio mimicus VM573]
          Length = 361

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 154/355 (43%), Positives = 221/355 (62%), Gaps = 14/355 (3%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS-T 77
           SAQ  +RIKDV  +   R+NQL+GYGLV GL GTG+S   +PFT+QS  ++LQN GI   
Sbjct: 15  SAQA-ARIKDVAQVAGVRNNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQNFGIQLP 70

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
           PG +  +KNVAAV+VTA+LP F+  G  IDV+++S+G A SLRGG L+ T L G DG +Y
Sbjct: 71  PGTKPKTKNVAAVIVTADLPAFSKQGQTIDVTVSSIGSAKSLRGGTLMQTFLKGLDGQVY 130

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           AVAQG++VVSG    G   S + G + T G I +GAIVERE+P  F     +   L   D
Sbjct: 131 AVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYITFNLFESD 190

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDT 254
           F+TA R+AD +N +        +A A D+ ++KV  P ++      +S +E L     D+
Sbjct: 191 FTTAQRLADAVNQF----LGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPADS 246

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA    G TV   ++ 
Sbjct: 247 AAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNALGG-GQTVVTPDSS 305

Query: 315 LKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 306 IEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLII 360


>gi|153837076|ref|ZP_01989743.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ3810]
 gi|260365776|ref|ZP_05778272.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus K5030]
 gi|260880698|ref|ZP_05893053.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AN-5034]
 gi|260897696|ref|ZP_05906192.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus Peru-466]
 gi|260899393|ref|ZP_05907788.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ4037]
 gi|90112108|sp|Q87JI2|FLGI1_VIBPA RecName: Full=Flagellar P-ring protein 1; AltName: Full=Basal body
           P-ring protein 1; Flags: Precursor
 gi|149749664|gb|EDM60409.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ3810]
 gi|308086214|gb|EFO35909.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus Peru-466]
 gi|308092366|gb|EFO42061.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AN-5034]
 gi|308109308|gb|EFO46848.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ4037]
 gi|308115027|gb|EFO52567.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus K5030]
 gi|328470105|gb|EGF41016.1| flagellar basal body P-ring protein [Vibrio parahaemolyticus 10329]
          Length = 373

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 230/373 (61%), Gaps = 14/373 (3%)

Query: 3   FRIAFLIFSLIGLHEIS-AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           F  +FL+   +GL   S A+V   I D+V ++  R+NQL+GYGLVVGL G GD      F
Sbjct: 7   FFSSFLLALTLGLPATSQAEVEIPIMDLVDVRGIRENQLVGYGLVVGLAGQGDR-NQVKF 65

Query: 62  TEQSMRSLLQNLGISTPGGRLGS-KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +DV ++S+GDA SLR
Sbjct: 66  TSQSITNMLRQFGVQIDDSMDPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YA+AQGSVVV GL  +G+S S +E    T G++ NGA +ERE+ 
Sbjct: 126 GGTLLLTPLRGIDGEVYAIAQGSVVVGGLSAEGKSGSKVEVNTPTAGRVPNGATLEREIK 185

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT 239
             F    ++ L LR P F+TA  IA +IN    N F   +A A +   V +  P +    
Sbjct: 186 TDFNQRDEITLNLRKPSFTTAKNIAREIN----NTFGPNVAVAINKARVDMRAPKDTQQR 241

Query: 240 RLMSEV--EMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            +M  +  EM  VE   PAR++ N RTGT+VIG NV++ +  VS+GNLTV+I+E+E+V Q
Sbjct: 242 VIMMSMLEEMSVVEGRKPARIVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESEKVSQ 301

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISILQG 355
           PNAF ++G T   N TD+ V++      +I  P  +LN+++  +NS+G     ++SILQ 
Sbjct: 302 PNAF-ADGETKVVNQTDIDVNEELAQM-VIWPPGTELNTIVDAVNSLGATPTDLMSILQA 359

Query: 356 IKAAGALQSEIII 368
           +  AGAL +E+++
Sbjct: 360 LNEAGALNAELVV 372


>gi|254508445|ref|ZP_05120565.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus 16]
 gi|219548655|gb|EED25660.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus 16]
          Length = 363

 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 150/350 (42%), Positives = 218/350 (62%), Gaps = 13/350 (3%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS-TPGGRL 82
           +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+QS  ++LQ+ GI   PG + 
Sbjct: 21  ARIKDVAQVAGVRSNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQSFGIQLPPGTKP 77

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            +KNVAAV+VTA LP F+  G  IDV+++S+G A SLRGG L+ T + G DG +YAVAQG
Sbjct: 78  KTKNVAAVIVTAELPAFSKQGQTIDVTVSSIGSAKSLRGGTLMQTMMKGLDGQVYAVAQG 137

Query: 143 SVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VVSG    G   S + G + T G I NGA+VERE+P  F     +   L   DF+TA 
Sbjct: 138 NLVVSGFSATGADGSKIVGNNPTAGMISNGAMVEREIPTPFGRGDYITFNLLESDFTTAQ 197

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDTPARVI 259
           R+AD +N++   + + P+    D+ +VKV  P +I      +S +E L     +  A++I
Sbjct: 198 RMADAVNNFLGPQMASPV----DATSVKVRAPRDISQRVAFLSAIENLEFNPAEGSAKII 253

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           +N RTGTIV+G +VR+    V++G +TV I EN  V QPNAF   G TV   +TD++V++
Sbjct: 254 VNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPNAF-GGGETVVVPDTDIQVTE 312

Query: 320 NKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            +G  F       L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 313 EQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLII 362


>gi|114562346|ref|YP_749859.1| flagellar basal body P-ring protein [Shewanella frigidimarina NCIMB
           400]
 gi|114333639|gb|ABI71021.1| flagellar P-ring protein [Shewanella frigidimarina NCIMB 400]
          Length = 368

 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 150/351 (42%), Positives = 215/351 (61%), Gaps = 17/351 (4%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+ S+Q  R NQL+GYGLVVGL GTG+  R   +TEQ+ R++L+N GI+ P   R  
Sbjct: 27  RIKDIASIQGVRSNQLVGYGLVVGLPGTGEKTR---YTEQTFRTMLKNFGINLPDSVRPN 83

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           SKNVA V V A +P F  PG  +D++++SLG+A SLRGG L+ T L G DGN+YA+AQGS
Sbjct: 84  SKNVAVVAVHAEMPAFIKPGQNLDITVSSLGEAKSLRGGTLLQTFLKGVDGNVYAIAQGS 143

Query: 144 VVVSGLFVKGQSSSF-MEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++VSG   +G   S  ++   T G+I +GAIVER +   F     L   LR  DFSTA R
Sbjct: 144 LIVSGFSAEGLDGSMVIQNTPTVGRIPSGAIVERSVISPFASGDYLTFNLRRSDFSTAKR 203

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLTVETDTPARV 258
            AD IN    +     +A+A D+ +++VS P +    +    ++  +E++  E    A+V
Sbjct: 204 TADAIN----DLLGPDMAKAIDATSIQVSAPRDASQRVSFLSVLENIEVIPAEES--AKV 257

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           I+N RTGTIV+G NV++    V++G LTV I E  QV QPNA  + G TV   N+ + VS
Sbjct: 258 IVNSRTGTIVVGQNVKLLPAAVTHGGLTVTIAEATQVSQPNAL-AGGDTVVTTNSTIDVS 316

Query: 319 D-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + ++  F       L+ L+  +N +G     +++IL+ +K AGAL  E+II
Sbjct: 317 EKDRRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEALKMAGALHGELII 367


>gi|91792668|ref|YP_562319.1| flagellar basal body P-ring protein [Shewanella denitrificans
           OS217]
 gi|91714670|gb|ABE54596.1| flagellar P-ring protein [Shewanella denitrificans OS217]
          Length = 366

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 148/348 (42%), Positives = 211/348 (60%), Gaps = 11/348 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   +TEQ+ R++L+N GI+ P   R  
Sbjct: 25  RIKDMANVQGVRSNQLIGYGLVVGLPGTGEKTR---YTEQTFRTMLKNFGINLPDSVRPN 81

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           SKNVA V V A +P F  PG  +DV+++SLG+A SLRGG L+ T + G DGN+YA+AQGS
Sbjct: 82  SKNVAVVAVHAEMPAFIKPGQNLDVTVSSLGEAKSLRGGTLLQTFMKGVDGNVYAIAQGS 141

Query: 144 VVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VVSG   +G   S  ++   T G+I NGAI+ER +P  F     L   L   DFSTA  
Sbjct: 142 LVVSGFSAEGLDGSRVIQNTPTVGRIPNGAIIERSVPSPFASGDHLTFNLHRADFSTAKN 201

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDTPARVII 260
           + D IN    +     +A+A D+ +++VS P +       ++ +E + V   D  A+VI+
Sbjct: 202 MVDAIN----DLLGPGMAKAIDASSIQVSAPRDASQRVSYLATLENIEVTIADESAKVIV 257

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTGTIV+G NV++    V++G LTV I E+ QV QPNA +   + VT N+T      +
Sbjct: 258 NSRTGTIVVGQNVQLLPAAVTHGGLTVTIAESTQVTQPNALAGGETAVTANSTIDVAEQD 317

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +  F       L+ L+  +N +G     +++IL+ +K AGAL  E+II
Sbjct: 318 RRMFMFSPGTTLDELVRAVNLVGAAPSDVLAILEALKMAGALHGELII 365


>gi|28900126|ref|NP_799781.1| flagellar basal body P-ring protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|28808409|dbj|BAC61614.1| putative flagellar P-ring protein [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 378

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 230/373 (61%), Gaps = 14/373 (3%)

Query: 3   FRIAFLIFSLIGLHEIS-AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           F  +FL+   +GL   S A+V   I D+V ++  R+NQL+GYGLVVGL G GD      F
Sbjct: 12  FFSSFLLALTLGLPATSQAEVEIPIMDLVDVRGIRENQLVGYGLVVGLAGQGDR-NQVKF 70

Query: 62  TEQSMRSLLQNLGISTPGGRLGS-KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +DV ++S+GDA SLR
Sbjct: 71  TSQSITNMLRQFGVQIDDSMDPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLR 130

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YA+AQGSVVV GL  +G+S S +E    T G++ NGA +ERE+ 
Sbjct: 131 GGTLLLTPLRGIDGEVYAIAQGSVVVGGLSAEGKSGSKVEVNTPTAGRVPNGATLEREIK 190

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT 239
             F    ++ L LR P F+TA  IA +IN    N F   +A A +   V +  P +    
Sbjct: 191 TDFNQRDEITLNLRKPSFTTAKNIAREIN----NTFGPNVAVAINKARVDMRAPKDTQQR 246

Query: 240 RLMSEV--EMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            +M  +  EM  VE   PAR++ N RTGT+VIG NV++ +  VS+GNLTV+I+E+E+V Q
Sbjct: 247 VIMMSMLEEMSVVEGRKPARIVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESEKVSQ 306

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISILQG 355
           PNAF ++G T   N TD+ V++      +I  P  +LN+++  +NS+G     ++SILQ 
Sbjct: 307 PNAF-ADGETKVVNQTDIDVNEELAQM-VIWPPGTELNTIVDAVNSLGATPTDLMSILQA 364

Query: 356 IKAAGALQSEIII 368
           +  AGAL +E+++
Sbjct: 365 LNEAGALNAELVV 377


>gi|89092140|ref|ZP_01165095.1| flagellar P-ring protein precursor [Oceanospirillum sp. MED92]
 gi|89083875|gb|EAR63092.1| flagellar P-ring protein precursor [Oceanospirillum sp. MED92]
          Length = 362

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 143/349 (40%), Positives = 218/349 (62%), Gaps = 13/349 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           R+KD+VS+   R NQL+GYGLVVGL GTGD    + FT Q+ R++L N G++ P      
Sbjct: 21  RLKDMVSISGVRSNQLVGYGLVVGLDGTGDK---TAFTSQTFRNMLNNFGVAIPSTTNPS 77

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           SKN+AAV + A+LP F+ PG +ID++++++GDA SLRGG L+M+ + GADG +YAVAQG+
Sbjct: 78  SKNIAAVAIHADLPAFSKPGQKIDITVSAIGDAKSLRGGSLLMSPMKGADGQVYAVAQGN 137

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VVSG  V+G   S +   + + G+I NGA VER +P  F     L+L L +PDF+T+ R
Sbjct: 138 LVVSGFGVQGADGSRLSLNVPSVGRIPNGATVERAVPSGFTQGDSLVLNLHSPDFTTSRR 197

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVE-TDTPARVII 260
           +A+QIN          +A + D+ +++V  P + +     +S +E L VE     A+V+I
Sbjct: 198 VAEQINHL----LGPDMAASMDATSIRVRAPRDPNQRVSFLSVLENLNVEPAKDAAKVVI 253

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTGTI+IG NV ++ V +++G LTV I E   V QPN     G TV    T ++V + 
Sbjct: 254 NSRTGTIIIGQNVSVAPVAITHGGLTVAIAEELNVDQPNPL-GQGQTVVTPRTGIEVDEG 312

Query: 321 KGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G  F      +L  ++  +N +G     +++IL+ +K AGAL++E+++
Sbjct: 313 SGHMFEFAPGANLQDIVEAVNQVGAAPGDLMAILEALKQAGALKAELVV 361


>gi|109899398|ref|YP_662653.1| flagellar basal body P-ring protein [Pseudoalteromonas atlantica
           T6c]
 gi|122971713|sp|Q15R89|FLGI_PSEA6 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|109701679|gb|ABG41599.1| flagellar P-ring protein [Pseudoalteromonas atlantica T6c]
          Length = 370

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 156/357 (43%), Positives = 215/357 (60%), Gaps = 23/357 (6%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+ S+Q  R NQL+GYGLVVGL GTG+    SPFTEQS R++L N GIS     +  
Sbjct: 23  RIKDLASVQGVRSNQLVGYGLVVGLPGTGEQ---SPFTEQSFRTMLSNFGISLDSSLKPK 79

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV V A LPPF  PG  IDV+++S+G+A+SLRGG L+ T L G DG +YAVAQGS
Sbjct: 80  IKNVAAVAVHAELPPFLKPGQTIDVTVSSVGEAASLRGGTLLQTFLKGLDGKVYAVAQGS 139

Query: 144 VVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VVSG   +G   S  +    T G+I NGA++ER +P  F  +  L L L  PDFSTA  
Sbjct: 140 MVVSGFGAEGADGSKIVANTPTVGRIANGALIERAVPSGFMQNDFLTLNLNYPDFSTAKI 199

Query: 203 IADQINSYSLNRF-SRP-----IAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLTVET 252
           +AD IN     R  + P     IA   D+ +V+VS P +    +     +   E +  + 
Sbjct: 200 LADTIN----QRLGADPDKGYVIATPIDAASVRVSAPRDVGQRVGFLATLENFEFMPAK- 254

Query: 253 DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT-QN 311
             PAR++IN RTGTIVIG +VR+    +++G LTV I+EN+QV QPN      + VT Q+
Sbjct: 255 -APARIVINSRTGTIVIGQDVRLLPAAITHGGLTVTISENQQVTQPNPLGQGDTVVTDQS 313

Query: 312 NTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             D+ + D +  F       L+ L+  +N +G     +++IL+ +  AGALQ E+++
Sbjct: 314 IIDVNLDDTR-MFKFDPGVTLDQLVRAVNEVGAAPGDLMAILEALSEAGALQGELVV 369


>gi|254225805|ref|ZP_04919410.1| flagellar P-ring protein FlgI [Vibrio cholerae V51]
 gi|125621711|gb|EAZ50040.1| flagellar P-ring protein FlgI [Vibrio cholerae V51]
          Length = 361

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 153/355 (43%), Positives = 221/355 (62%), Gaps = 14/355 (3%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS-T 77
           SAQ  +RIKDV  +   R+NQL+GYGLV GL GTG+S   +PFT+QS  ++LQN GI   
Sbjct: 15  SAQA-ARIKDVAQVAGVRNNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQNFGIQLP 70

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
           PG +  +KNVAAV+VTA+LP F+  G  IDV+++S+G A SLRGG L+ T + G DG +Y
Sbjct: 71  PGTKPKTKNVAAVIVTADLPAFSKQGQTIDVTVSSIGSAKSLRGGTLMQTFMKGLDGQVY 130

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           AVAQG++VVSG    G   S + G + T G I +GAIVERE+P  F     +   L   D
Sbjct: 131 AVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYITFNLFESD 190

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDT 254
           F+TA R+AD +N +        +A A D+ ++KV  P ++      +S +E L     D+
Sbjct: 191 FTTAQRLADAVNQF----LGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPADS 246

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA    G TV   ++ 
Sbjct: 247 AAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNALGG-GQTVVTPDSS 305

Query: 315 LKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 306 IEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLII 360


>gi|255021358|ref|ZP_05293406.1| Flagellar P-ring protein flgI [Acidithiobacillus caldus ATCC 51756]
 gi|254969221|gb|EET26735.1| Flagellar P-ring protein flgI [Acidithiobacillus caldus ATCC 51756]
          Length = 381

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 148/372 (39%), Positives = 227/372 (61%), Gaps = 13/372 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +  RI  L+ +L+G   I+      ++++VS+   R NQL+GYGLVVGL GTGD     P
Sbjct: 14  LALRI-LLLGALVGFG-IAPVAAETVRNLVSVGGVRSNQLVGYGLVVGLNGTGDQATQVP 71

Query: 61  FTEQSMRSLLQNLGISTP---GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           +T QS+ ++ Q LGI+ P      L  K+VAAV+VTA+LPPFA PG  I+V+++++G+AS
Sbjct: 72  YTTQSLLNMFQRLGINLPPSVATNLQPKDVAAVIVTAHLPPFAQPGQTINVTVSAVGNAS 131

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SL GG L+MT L GADG  YAVAQG+++VSG       +S    ++T G I NGA VER 
Sbjct: 132 SLAGGTLLMTPLKGADGQTYAVAQGNIIVSGFGASANGNSTQVNVTTAGTIPNGANVERA 191

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           +   F     L LQL  P F+TA RIAD IN     R    +A+A ++  V+V  P + +
Sbjct: 192 VASGFDQPGPLQLQLHTPSFTTAARIADVIN----QRLGYGVAQAVNAGVVQVQAPADPN 247

Query: 238 L-TRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                +S +E L+V+ + P A+V+++ R+GT+V+G NV +    V++GNL+V I++   V
Sbjct: 248 ARVNFLSIIENLSVDPEAPIAKVVVDARSGTVVLGQNVTLGACAVAHGNLSVTISQKYLV 307

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQ 354
            QPN   + G T    +T++KV   +    + +    L +++  +N++G     +I+ILQ
Sbjct: 308 SQPNPLGA-GQTAVVPDTNVKVKQPQAKLLMFEPGVTLEAVVRALNAVGASPSDLIAILQ 366

Query: 355 GIKAAGALQSEI 366
            +KAAGAL +++
Sbjct: 367 AMKAAGALHAQL 378


>gi|90021851|ref|YP_527678.1| flagellar basal body P-ring protein [Saccharophagus degradans 2-40]
 gi|89951451|gb|ABD81466.1| flagellar P-ring protein [Saccharophagus degradans 2-40]
          Length = 379

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 147/361 (40%), Positives = 222/361 (61%), Gaps = 12/361 (3%)

Query: 12  LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
           L G H  SA+   RIKD+ S++  R NQL+GYGLVVGL GTGD    +PFT QS +++L+
Sbjct: 26  LFGSHA-SAE---RIKDLTSVEGVRSNQLVGYGLVVGLDGTGDQTNQTPFTTQSFQAMLK 81

Query: 72  NLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLL 130
             GI+  PG +   KNVAAV + A LP FA PG  ID++++S+ +A SLRGG L++  L 
Sbjct: 82  QFGITIPPGAKFQLKNVAAVAIHAELPAFAKPGQTIDITVSSIANAKSLRGGSLLLAPLR 141

Query: 131 GADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLI 189
           G DGN+YAVAQG+++V G   +G+  S +   + + G+I  GA+VER +  +F     ++
Sbjct: 142 GLDGNVYAVAQGNLIVGGFGGEGRDGSKITVNVPSVGRIPGGAMVERAVATRFGGDDRIV 201

Query: 190 LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEML 248
             L  PDF+TA R+AD IN    +     +A   D+ ++ V  P N       +S +E L
Sbjct: 202 FNLHTPDFTTAKRLADTIN----DMLGPEVAMPMDAASIAVRAPQNPAQRVEFLSLLENL 257

Query: 249 TVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGST 307
           T+   ++ A++IIN RTGTIV+G +VR+S V V++G+LTV + E+ +  QPNAF    + 
Sbjct: 258 TLTPGNSSAKIIINSRTGTIVVGQHVRVSPVAVTHGSLTVTVKEDVEASQPNAFGGGETV 317

Query: 308 VTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEII 367
           V  N+    V +N   F     P LN ++  +N +G     +++IL+ +K AGAL++EI+
Sbjct: 318 VVPNSRVEVVEENGPMFKFSPGPTLNDIVRAVNEVGAAPGDLMAILEALKQAGALKAEIV 377

Query: 368 I 368
           +
Sbjct: 378 V 378


>gi|85712258|ref|ZP_01043309.1| flagellar P-ring protein precursor [Idiomarina baltica OS145]
 gi|85693885|gb|EAQ31832.1| flagellar P-ring protein precursor [Idiomarina baltica OS145]
          Length = 366

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 160/372 (43%), Positives = 222/372 (59%), Gaps = 19/372 (5%)

Query: 7   FLIFSLIGLHEISAQVV-----SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           FL   L+GL  I  Q+V     SRIKD+ S+   R NQLIGYGLVVGL GTG+    +PF
Sbjct: 3   FLKVMLLGL-AIMGQLVLPVQASRIKDIASVAGIRSNQLIGYGLVVGLPGTGEQ---TPF 58

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T+Q+ R++L N GI+ P G R    NVAAV V A +P FA PG +IDV+++S+G A SL 
Sbjct: 59  TDQTFRTMLGNFGINVPQGQRPKINNVAAVAVHAEIPAFAKPGQKIDVTVSSVGSADSLT 118

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+ T L GA+G +YAVAQGS++V GL  +G   S  +    T G+I  GAIVERE+P
Sbjct: 119 GGTLLQTFLKGANGEVYAVAQGSLIVGGLGAEGSDGSKIVINTPTVGRIPGGAIVEREIP 178

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F         L + DF+TA R+A+ IN          +A+A D+ +++V  P ++   
Sbjct: 179 TAFAQGDYFTFNLHDSDFTTAKRVANTINGL----VGEGMAQAIDATSIRVKAPRDLSQR 234

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              MS +E L VE     A++IIN RTGTIV+G NV +    V++GN+ V ITE+ QV Q
Sbjct: 235 VSYMSTLENLQVEQAMAAAKIIINARTGTIVVGQNVELRPAAVAHGNMQVTITEDMQVDQ 294

Query: 298 PNAFSSNGSTVT-QNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PN F    + VT Q+  D++  D +  F       LN L+  +N +G     II++L+ +
Sbjct: 295 PNPFGQGDTAVTPQSVVDIQQEDAR-MFVFNPGTTLNDLVRAVNQVGAAPGDIIAVLEAL 353

Query: 357 KAAGALQSEIII 368
           K AGA+  E+I+
Sbjct: 354 KQAGAISGELIV 365


>gi|289549015|ref|YP_003474003.1| flagellar P-ring protein [Thermocrinis albus DSM 14484]
 gi|289182632|gb|ADC89876.1| flagellar P-ring protein [Thermocrinis albus DSM 14484]
          Length = 361

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 152/357 (42%), Positives = 232/357 (64%), Gaps = 8/357 (2%)

Query: 10  FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSL 69
           F+L+ L  ++    ++I+D+ +++  R N L+GYGLVVGL+GTGD  +S+ FT +S+ ++
Sbjct: 10  FTLLILL-VTVSFAAKIRDIATVEGNRSNYLVGYGLVVGLKGTGDG-KSTLFTVRSIANM 67

Query: 70  LQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSL 129
           LQ +G+S    R+  KNVAAVMVTA LPP+A PG RIDV ++S+GDA SL GG L++T L
Sbjct: 68  LQRMGVSVDPRRMTVKNVAAVMVTAKLPPYAKPGMRIDVEVSSIGDAKSLEGGTLLLTPL 127

Query: 130 LGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLI 189
           +G DG IYA+AQG VVVSG   +G ++  ++ + T G+I NGAIVER L    +D  ++ 
Sbjct: 128 VGPDGQIYALAQGQVVVSGYEARGAAARQVQNVPTVGRIPNGAIVERGLSYP-QDVREIN 186

Query: 190 LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLT 249
           L L N  FS A +I D IN+    RF   +A+A D+ TV++  P  +D+   +++VE L 
Sbjct: 187 LYLDNASFSLAKKIQDIINA----RFQAQVAQAVDASTVRLKIPEGMDMVSFLAQVEDLD 242

Query: 250 VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
           ++    A+V+I+ R+GT+++G +V I+ V V+ G LTV + E  +VVQP    S G TV 
Sbjct: 243 IDVPAVAKVVIDSRSGTVLLGGDVTIAPVSVTVGTLTVTVKEAPEVVQPPPL-SRGETVV 301

Query: 310 QNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              T+LKV + +     +    ++ L+  +N IG     II+ILQ +KAAGAL++++
Sbjct: 302 VPRTELKVEEKERRIMELRGATVSQLVESLNRIGATPREIIAILQAMKAAGALRAKL 358


>gi|330501141|ref|YP_004378010.1| flagellar basal body P-ring protein [Pseudomonas mendocina NK-01]
 gi|328915427|gb|AEB56258.1| flagellar basal body P-ring protein [Pseudomonas mendocina NK-01]
          Length = 364

 Score =  256 bits (653), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 156/351 (44%), Positives = 217/351 (61%), Gaps = 17/351 (4%)

Query: 26  IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---RL 82
           + D+V ++  R NQLIGYGLVVGL GTGD  +   FT QS+ ++++  GI+ P     +L
Sbjct: 22  LMDLVDIEGIRGNQLIGYGLVVGLDGTGDKNQVR-FTSQSVANMIKQFGINLPPNVDPKL 80

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAV VTA +PP  SPG  +DV++ SLGDA SLRGG L+MT L G DG  YA+AQG
Sbjct: 81  --KNVAAVTVTAEIPPSYSPGQSVDVTVASLGDAKSLRGGQLLMTPLQGVDGETYALAQG 138

Query: 143 SVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           +VVV GL   GQS SS     +  G++ NGA VER +P  F    +++L LR P F TA 
Sbjct: 139 AVVVGGLNATGQSGSSVAINSANSGRVPNGATVERMIPSDFSTRDEVMLNLRQPSFQTAA 198

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVEMLTVET--DTPARV 258
           ++ + +N     RF    A A +S  + +  P T+      M+ +E L VE   + P +V
Sbjct: 199 KVVEAVNG----RFGSGTASALNSTKIAIRAPITSTQRIGFMAMLEGLEVEEGRERP-KV 253

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           + N RTGT+V+G  VR+    V++G LTV I+EN QV QPNAF S G T     +D+ VS
Sbjct: 254 VFNSRTGTVVVGQGVRVKAAAVAHGTLTVTISENPQVSQPNAF-SGGQTAVVPRSDVAVS 312

Query: 319 DNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            +K + F   D   L+S+I+ +NS+G   D ++SILQ ++ AGAL +E+I+
Sbjct: 313 QDKNAMFKWPDGASLDSIINTVNSLGATPDDVMSILQALEQAGALNAELIV 363


>gi|332187875|ref|ZP_08389608.1| flagellar P-ring family protein [Sphingomonas sp. S17]
 gi|332012036|gb|EGI54108.1| flagellar P-ring family protein [Sphingomonas sp. S17]
          Length = 365

 Score =  255 bits (652), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 151/373 (40%), Positives = 219/373 (58%), Gaps = 14/373 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQV-VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           MIFR    + +L+    I+A     RIKD+   Q  R NQL GYG+VVGL GTGD   + 
Sbjct: 1   MIFR---FLLALLATFAIAAPAQADRIKDLGGFQGIRSNQLTGYGVVVGLPGTGDD--NL 55

Query: 60  PFTEQSMRSLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
            +T QS+++++   G+   P    G KN A VMVTA LPPFA PG ++D+++ S+G A S
Sbjct: 56  EYTVQSLKAVVSRFGLQLPPNANPGMKNAAVVMVTAELPPFAKPGQKLDITVASMGKAKS 115

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERE 177
           LRGG L++T L GADG IYA+AQG++ V GL  +G   S  +  + + G+I  GA VER 
Sbjct: 116 LRGGSLILTPLQGADGQIYAMAQGNLAVGGLGAEGADGSKIVVNVPSAGRIPEGATVERA 175

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           +   F+ +  L   L   DF+TA  +A  IN+    R    IA+A D+ +V V  P   D
Sbjct: 176 VATGFESAPMLTFNLARADFTTAQNVAQAINA----RLGMGIAQAMDAVSVAVRAPMGAD 231

Query: 238 L-TRLMSEVEML-TVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
           +   LMSE+E L  V  + PA+VI+N RTGT+VI   VR+    V++G LTV+I EN++V
Sbjct: 232 VRATLMSEIENLDVVSAEPPAKVIVNARTGTVVINSAVRVGPAAVTHGKLTVKIDENQRV 291

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
            QP   S   + VT  +      + +  F L   P L  ++  +N+IG     +++IL+ 
Sbjct: 292 SQPAPLSGGQTVVTPKSGVAVEEERRPMFLLNPGPKLADVVKAVNAIGAAPSDLVAILEA 351

Query: 356 IKAAGALQSEIII 368
           +K AGAL++E+I+
Sbjct: 352 LKEAGALKAELIV 364


>gi|238796908|ref|ZP_04640412.1| Flagellar P-ring protein [Yersinia mollaretii ATCC 43969]
 gi|238719168|gb|EEQ10980.1| Flagellar P-ring protein [Yersinia mollaretii ATCC 43969]
          Length = 373

 Score =  255 bits (652), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 147/346 (42%), Positives = 213/346 (61%), Gaps = 8/346 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RI+D+ ++Q  R N L+GYGLVVGL G+GD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 29  RIRDLTTIQGIRSNSLMGYGLVVGLDGSGDQTMQTPFTTQSLSNMLSQLGITVPAGTNMQ 88

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVT  LPPFA PG +IDV ++SLG+A SLRGG L+MT L G D  IYA+AQG+
Sbjct: 89  LKNVAAVMVTTELPPFARPGEKIDVVVSSLGNAKSLRGGTLLMTPLKGVDNQIYALAQGN 148

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++VSG   +   S        G +I  GA VERE+P  F     L LQL   DFS A ++
Sbjct: 149 LLVSGSGAQAGGSRVQVNQLNGARISGGATVEREVPVSFASENILRLQLNEDDFSLAQQV 208

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVETDT-PARVIIN 261
           +D+IN     R     A A DSRT+K+  P +     R ++ V+ + ++     A+VIIN
Sbjct: 209 SDEIN----RRLGGSTAMAEDSRTIKLFAPADSAGKVRFLANVQNIPIKVGVMDAKVIIN 264

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+  +V +    VS G+LTV+I++  +V QP+     G TV   NT + V +  
Sbjct: 265 SRTGSVVMNRHVVLEACAVSQGDLTVEISQTNEVSQPDTPLGGGQTVVTPNTQISVREQN 324

Query: 322 GSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           G    +  + DLNS++  +NS+G   + ++SILQ +K+AG L++++
Sbjct: 325 GHLQQVKTSADLNSVVRALNSLGATPNDLMSILQSMKSAGCLRAKL 370


>gi|261211318|ref|ZP_05925606.1| flagellar P-ring protein FlgI [Vibrio sp. RC341]
 gi|260839273|gb|EEX65899.1| flagellar P-ring protein FlgI [Vibrio sp. RC341]
          Length = 361

 Score =  255 bits (652), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 154/362 (42%), Positives = 225/362 (62%), Gaps = 14/362 (3%)

Query: 12  LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
           L+ L   SAQ  +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+QS  ++LQ
Sbjct: 8   LMMLLASSAQA-ARIKDVAQVAGVRSNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQ 63

Query: 72  NLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLL 130
           + GI   PG +  +KNVAAV+VTA+LP F+  G  ID++++S+G A SLRGG L+ T L 
Sbjct: 64  SFGIQLPPGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQTFLK 123

Query: 131 GADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLI 189
           G DG +YAVAQG++VVSG    G   S + G + T G I +GAIVERE+P  F     + 
Sbjct: 124 GLDGQVYAVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYIT 183

Query: 190 LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEML 248
             L   DF+TA R+AD +N +   + + P+    D+ ++KV  P ++      +S +E L
Sbjct: 184 FNLFESDFTTAQRLADAVNQFLGPQMASPV----DAASIKVRAPRDLSQRVAFLSAIENL 239

Query: 249 TVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGST 307
              T ++ A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA    G T
Sbjct: 240 EFNTAESSAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNAL-GGGQT 298

Query: 308 VTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           V   N+ ++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++ ++
Sbjct: 299 VVTPNSSIEVTEKQGKMFKLEPGVTLDDLVRAINEVGAAPSDLMAILQALKQAGAIEGQL 358

Query: 367 II 368
           II
Sbjct: 359 II 360


>gi|92114094|ref|YP_574022.1| flagellar basal body P-ring protein [Chromohalobacter salexigens
           DSM 3043]
 gi|123084032|sp|Q1QW35|FLGI_CHRSD RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|91797184|gb|ABE59323.1| flagellar P-ring protein [Chromohalobacter salexigens DSM 3043]
          Length = 369

 Score =  255 bits (652), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 145/365 (39%), Positives = 224/365 (61%), Gaps = 11/365 (3%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           +  L GL    AQ   RI+D+ S    R+NQL+GYGLVVGL GTGD    +PFT Q++ +
Sbjct: 10  VLLLCGLCAAPAQA-ERIRDLASFAGVRENQLVGYGLVVGLDGTGDQTTQTPFTGQTLIN 68

Query: 69  LLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +L  LG+S P G  +  +NVAAVMVTA LPPFA  G  +DV+++S+G+A SLRGG L+MT
Sbjct: 69  MLSQLGVSIPEGTNMQLRNVAAVMVTAQLPPFARQGQEMDVTVSSMGNADSLRGGTLLMT 128

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF-KDSA 186
            L G DGN+YA+AQG++++ G+  +   SS     +  G+I  GA VE+E+  +  +   
Sbjct: 129 PLRGVDGNVYAMAQGNLLIGGVGAQQAGSSVQVNHTAAGRIPGGATVEQEVALQLGRADG 188

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEV 245
            L L L   DF+TA R+ + IN      F  P+A A D R ++++ P++ +     M+ +
Sbjct: 189 TLDLYLNESDFTTAQRVVEAIN----RDFGSPVAAAMDGRLIRLNAPSDSNSRVNFMARI 244

Query: 246 EMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           + L V  +  PA+VI+N RTG++V+   V + +  V++GNL+V I  N QV QPN     
Sbjct: 245 QNLDVTPNQGPAKVIVNSRTGSVVLNREVTLDRAAVAHGNLSVTIDSNPQVSQPNPLGE- 303

Query: 305 GSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G TV   + D+ +    G+  +++ + DL  +++ +N++G     ++SILQ +K+AGAL 
Sbjct: 304 GETVVVPDADISIQQEGGALQMVNTSADLMDVVNALNALGASPQDLMSILQALKSAGALN 363

Query: 364 SEIII 368
           +E+ I
Sbjct: 364 AELEI 368


>gi|182412218|ref|YP_001817284.1| flagellar P-ring protein [Opitutus terrae PB90-1]
 gi|177839432|gb|ACB73684.1| flagellar P-ring protein [Opitutus terrae PB90-1]
          Length = 378

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 151/369 (40%), Positives = 232/369 (62%), Gaps = 16/369 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           +++ +++GL   ++   SR+KD+  ++ GRDNQ++GYG+V GL G GDS  ++  T +S+
Sbjct: 18  WILTAILGLLCSASGHASRVKDLTLVEGGRDNQIVGYGIVAGLAGDGDS--NAQATLRSV 75

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
            ++LQ  G+      + +KN AAVMVTA++ PF  PGSRIDV++ SLGDA SL+GG+L+ 
Sbjct: 76  ANILQRYGVVVSPTDIKAKNAAAVMVTADIGPFLKPGSRIDVNVASLGDAKSLQGGVLLQ 135

Query: 127 TSLLGADGNIYAVAQGSV---VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           T L+G DG +YAVAQG+V      G       ++  +   T G I NG IVERE+   F 
Sbjct: 136 TPLIGGDGKVYAVAQGAVAVGGFLGGAGGAGGATVQKNHPTVGVISNGGIVEREIAATFV 195

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI---DLTR 240
               L L L NPDF++A R+AD IN          +A A D+ T+ VS P N    D+  
Sbjct: 196 RDNQLRLLLHNPDFTSAARMADAINGK-----WPAMASAVDAATIAVSLPANYAGQDVA- 249

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
            ++++ M+ V  DT ARV+INERTGTIV    VR+S+V ++ G+LT+ ++ N    QPNA
Sbjct: 250 FIADLGMIEVVPDTLARVVINERTGTIVATSTVRLSQVAIALGSLTITVSSNMGASQPNA 309

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           F + G TV   +T   V++ KG F+++ + P +  L + +N++G+ T  +++I Q +K +
Sbjct: 310 FGA-GQTVPLQSTQTNVNEVKGGFTVLNEPPTIERLAAALNALGVSTREMMAIFQSLKRS 368

Query: 360 GALQSEIII 368
           GALQ+E++I
Sbjct: 369 GALQAELVI 377


>gi|120554037|ref|YP_958388.1| flagellar basal body P-ring protein [Marinobacter aquaeolei VT8]
 gi|166988331|sp|A1TZN2|FLGI_MARAV RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|120323886|gb|ABM18201.1| flagellar P-ring protein [Marinobacter aquaeolei VT8]
          Length = 365

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 149/370 (40%), Positives = 227/370 (61%), Gaps = 19/370 (5%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           FL++ L      +  +  R+KD+  ++  R+NQL+GYGLVVGL GTGD    +PFT Q+ 
Sbjct: 6   FLVWILALTVGAAPVMADRLKDLSRIKGVRNNQLVGYGLVVGLDGTGDK---APFTNQTF 62

Query: 67  RSLLQNLGISTPGGRLGSK--NVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           R+++   GI+ P G +  K  NVAAV V+A LP FA  G  +D++++S+G+A SLRGG L
Sbjct: 63  RNMMNQFGITLPDG-VNPKLANVAAVTVSATLPAFAKAGQELDITVSSIGNADSLRGGTL 121

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFK 183
           +MT L GADG +YA+AQGS+VV G   +GQ  S +   + + G+I NGA +ERE+   F 
Sbjct: 122 LMTPLKGADGQVYAMAQGSLVVGGFGAQGQDGSRITVNVPSVGRIPNGATIEREVESPFN 181

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMS 243
               +   L   DF+TA R+ + IN     R    +A A+D+ ++ V  P   D ++ +S
Sbjct: 182 RGDTITFNLLRSDFTTARRVVEAING----RLGPDMAYAHDATSISVRAPR--DPSQRVS 235

Query: 244 EVEML-TVETDTP---ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            + +L  +E D     ARV+IN RTGTIV+G NV++S   +++GNLTV I EN +VVQPN
Sbjct: 236 FLSILENIEVDPAQEAARVVINSRTGTIVVGQNVKVSPAAITHGNLTVTIQENPEVVQPN 295

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
             +  G T  Q NT + V+++    F    A  LN ++  +N +G     ++++L+ +K 
Sbjct: 296 PLAQ-GDTAVQQNTQIAVTEDPARMFQFGPATTLNEIVQAVNQVGAAPGDVMAVLEALKQ 354

Query: 359 AGALQSEIII 368
           AGAL++E+I+
Sbjct: 355 AGALRAELIV 364


>gi|226944496|ref|YP_002799569.1| flagellar basal body P-ring protein [Azotobacter vinelandii DJ]
 gi|226719423|gb|ACO78594.1| Flagellar P-ring protein [Azotobacter vinelandii DJ]
          Length = 385

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 144/356 (40%), Positives = 221/356 (62%), Gaps = 12/356 (3%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           +A    +++D+      R+N L+GYGLVVGL GTGD    +PFTEQ + ++L  LGI+ P
Sbjct: 35  AAAPAEQVRDIADFAGVRNNVLVGYGLVVGLDGTGDQTTQTPFTEQGLTNMLSQLGITVP 94

Query: 79  GG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
            G  +  +NVAAVMVT +LPPFA PG ++DV ++S+G+A SLRGG L+MT L G DG  Y
Sbjct: 95  SGSNMQMRNVAAVMVTTSLPPFARPGQQVDVVVSSIGNARSLRGGTLLMTPLKGMDGETY 154

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS-ADLILQLRNPD 196
           A+AQG+++V G+  +   SS       GG+I  GA+VERE+P     S  +L L LR+PD
Sbjct: 155 ALAQGNLLVGGVGAQANGSSVQINQQAGGRIARGALVEREVPLMLGGSRGELDLYLRSPD 214

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVE--MLTVETD 253
           F+TA R+   IN    N F R +A A D   V++  P++  +    M+ VE   +T   +
Sbjct: 215 FATARRVVLAIN----NEFGRTVASAQDGGLVRLQGPSSPNERVNFMARVEGVQVTPMAE 270

Query: 254 TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
            P +VI+N RTG +V+   V++ +  V++GNL++ I  + +V QP  F S G TV   N+
Sbjct: 271 RP-KVIVNSRTGAVVLNGAVKLHRAAVAHGNLSIVIDTDNRVSQPEPF-SRGQTVVAPNS 328

Query: 314 DLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           D+ +    G+  L++ + DL  ++  +N++G     ++SIL+ +KAAG+L++E+ I
Sbjct: 329 DISIEQEGGALHLVEGSADLMDVVKALNALGATPQDLMSILEALKAAGSLRAELEI 384


>gi|311105939|ref|YP_003978792.1| flagellar P-ring protein [Achromobacter xylosoxidans A8]
 gi|310760628|gb|ADP16077.1| flagellar P-ring protein [Achromobacter xylosoxidans A8]
          Length = 378

 Score =  255 bits (651), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 151/348 (43%), Positives = 212/348 (60%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R +PFT+QS+ ++L  LGI+ P G  + 
Sbjct: 34  RLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTPFTQQSLTNMLSQLGITVPAGSNMQ 93

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVT  LP FA PG  +DV ++S+G+A SLRGG L+MT L GAD  +YA+AQG+
Sbjct: 94  LKNVAAVMVTTTLPAFARPGQTLDVVVSSMGNAKSLRGGTLLMTPLKGADSQVYAIAQGN 153

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       SS       GG+I  GAIVER +P  F     + ++L N DF TA  +
Sbjct: 154 ILVGGAGASAGGSSVQINQLNGGRISAGAIVERGVPTTFSRDGYIHVELNNTDFGTAQNV 213

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVEMLTV-ETDTPARVIIN 261
           A  +N     +F    A A D R V+V  P       R +S+VE L V    T A+VIIN
Sbjct: 214 AMALN----RKFGAGTATALDGRVVQVRTPMEQASQARFLSQVEDLQVARAPTVAKVIIN 269

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+   V I +  V++GNL+V I    QV QP+   + G TV   NT ++V    
Sbjct: 270 ARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVSQPDTPFTEGQTVVVPNTQIEVRQEN 329

Query: 322 GSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           GS   +  + +L  ++ G+N++G     +++ILQ +K AGAL++E+ I
Sbjct: 330 GSLQRVSTSANLADVVKGLNALGATPQDLLAILQAMKTAGALRAELEI 377


>gi|330830299|ref|YP_004393251.1| flagellar P-ring protein FlgI [Aeromonas veronii B565]
 gi|328805435|gb|AEB50634.1| Flagellar P-ring protein FlgI [Aeromonas veronii B565]
          Length = 365

 Score =  255 bits (651), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 150/371 (40%), Positives = 226/371 (60%), Gaps = 15/371 (4%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R+  L+  L+ L   +A   +RIKD+ S++  R+NQLIGYGLVVGL GTG+  +++ FT
Sbjct: 4   LRLVTLLCCLLPLGVANA---ARIKDISSVEGVRNNQLIGYGLVVGLPGTGE--KNNAFT 58

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQ+ R++L N GI  P   +   K+VA V + A+LPPF+ PG  IDV+++++G+A SLRG
Sbjct: 59  EQTFRTMLNNFGIKVPDNIKPKIKDVAPVAIHADLPPFSKPGQTIDVTVSAIGEAKSLRG 118

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ + L G DG +YAVAQGS+VV GL  +G   S  +    T G+I NGA VERE+P 
Sbjct: 119 GTLLQSFLKGLDGRVYAVAQGSLVVGGLGAEGADGSKVVINTPTVGRIANGATVEREVPN 178

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L  PDF+TA R+AD +N           A+A D+ +VKV  P +     
Sbjct: 179 SFSQGDTITFNLNRPDFTTARRLADVVNDL----VGPNTAQALDATSVKVYAPRDPGQRV 234

Query: 240 RLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++ +E L V+  +  A++I+N RTGTIVIG  V++    +S+G LTV I EN+QV QP
Sbjct: 235 SYLATIENLEVDPANEAAKIIVNSRTGTIVIGSQVKLKPAAISHGGLTVTIAENQQVSQP 294

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N  +   +TVT NN+ + V    G  F       L+ L+  +N +G+    +++IL+ ++
Sbjct: 295 NPLAGGETTVT-NNSTINVQQEPGRMFKFDTGATLDDLVRAVNQVGVAPGDLMAILEALQ 353

Query: 358 AAGALQSEIII 368
            AGA++ +++I
Sbjct: 354 QAGAIEGQLVI 364


>gi|300114795|ref|YP_003761370.1| flagellar P-ring protein [Nitrosococcus watsonii C-113]
 gi|299540732|gb|ADJ29049.1| flagellar P-ring protein [Nitrosococcus watsonii C-113]
          Length = 367

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 150/370 (40%), Positives = 222/370 (60%), Gaps = 18/370 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           F I +L+ L +  AQ   R+KD+ ++   R NQL+GYGLVVGL GTGD +    +T QS+
Sbjct: 7   FFIMTLLWLSQ-GAQA-ERVKDLAAIAGVRSNQLVGYGLVVGLSGTGDQVTQISYTRQSL 64

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           R++L+  GI  P G  L  KNVAAV + A LPPFA PG  ID++++SLG+A SLRGG L+
Sbjct: 65  RNMLREFGIIMPPGVNLQPKNVAAVSIHAQLPPFAKPGQSIDITVSSLGNAKSLRGGSLL 124

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKD 184
           +T L GADG +YA+AQG+++V G   +G   S +   I + G+I NGA VER +P  F +
Sbjct: 125 LTPLKGADGQVYAMAQGNLIVGGFGAEGNDGSRVTVNIPSTGRIPNGATVERGVPNPFHN 184

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT----NIDLTR 240
              +IL L   DF+TA R+A  INS      +RP+    D  +++V+ P      +    
Sbjct: 185 GGPIILNLHASDFTTANRVAAAINSAIGAGTARPL----DGTSIQVNAPALPTQRVSFVS 240

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           L+  +E+   E   PA+++IN RTGT+VIG +VR+    VS+G LTV IT N  + QP  
Sbjct: 241 LLENLEVAPGE--APAKIVINSRTGTVVIGQHVRVQPAAVSHGRLTVTITSNPAISQPPP 298

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISILQGIKA 358
             S G T     TD+ + + +GS   + AP   L  ++  +N +G     +++IL+ +K 
Sbjct: 299 L-SGGQTAVVPRTDIDIQE-EGSRMFLFAPGVSLGEIVRAVNQVGAAPGDLVAILEALKQ 356

Query: 359 AGALQSEIII 368
            GAL +E+++
Sbjct: 357 VGALSAELVV 366


>gi|319787117|ref|YP_004146592.1| flagellar P-ring protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317465629|gb|ADV27361.1| flagellar P-ring protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 380

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 146/349 (41%), Positives = 211/349 (60%), Gaps = 14/349 (4%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---R 81
           RIKD+  +   R N L+GYGLVVGL  +GD    +PFT QS++++L  LG+  P     +
Sbjct: 36  RIKDLAQVGGVRGNALVGYGLVVGLDNSGDRTSQAPFTVQSLKNMLSELGVQVPANVNPQ 95

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
           L  KNVAAV + A LPPFA PG  IDV+++S+G+A SLRGG L+M  L GADG +YA+AQ
Sbjct: 96  L--KNVAAVAIHAELPPFAKPGQTIDVTVSSIGNAVSLRGGSLLMAPLKGADGQVYAIAQ 153

Query: 142 GSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           G++VV G   +G+  S +   I + G+I NGA VER LP       D+ L L   DF+T 
Sbjct: 154 GNLVVGGFGAQGRDGSRVAVNIPSAGRIPNGATVERALPSVLDGGGDITLNLHRNDFTTV 213

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL--MSEVEMLTVETDT-PAR 257
            R+ D IN+Y    F   +A A D  TV V+ P ++  +R+  +++VE L +   + PA+
Sbjct: 214 SRMVDAINAY----FGPGVARAVDGVTVSVAAPADVG-SRIGFLAQVENLELSPGSAPAK 268

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           VI+N RTGT+VIG  VR+    V++G LTV I E  QV QP A +  G+ V QN+T    
Sbjct: 269 VIVNARTGTVVIGSQVRVMPAAVAHGALTVTINEGVQVSQPGALAGGGTVVAQNSTVSGT 328

Query: 318 SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            +    F       L+ ++  +N +G     +I+IL+ ++ AGAL++E+
Sbjct: 329 QEGSRMFRFEGGTTLDEIVRAVNEVGAAPGDLIAILEALRQAGALRAEL 377


>gi|292492367|ref|YP_003527806.1| flagellar P-ring protein [Nitrosococcus halophilus Nc4]
 gi|291580962|gb|ADE15419.1| flagellar P-ring protein [Nitrosococcus halophilus Nc4]
          Length = 367

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 152/372 (40%), Positives = 226/372 (60%), Gaps = 12/372 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +I   +F ++ L    A    R+KD+ ++   R NQL+GYGLVVGL GTGD +   P+T
Sbjct: 1   MKITQTLFLVVLLCLSQAAQAERVKDLAAIAGVRSNQLVGYGLVVGLDGTGDQVTQVPYT 60

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+R++L+  GI+ P G     KNVAAV V A LPPFA PG +ID++++SLG+A SLRG
Sbjct: 61  TQSLRNMLREFGINLPPGVNPQPKNVAAVSVHAQLPPFAKPGQQIDITVSSLGNAKSLRG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPK 180
           G L++T L GADG +YA+AQG++VV G  ++G   S +   + + G+I NGA VER +  
Sbjct: 121 GSLLLTPLKGADGRVYAMAQGNLVVGGFGIEGNDGSRVTVNVPSTGRIPNGATVERHVVN 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKV-SKPTNIDLT 239
            F D   ++L L   DF+TA R+A  IN       +RP+    D  +++V + P      
Sbjct: 181 PFNDGDHIVLNLHTSDFTTANRVAVTINQAIGAGTARPL----DGTSIQVNAPPAPAQRV 236

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L VE  +  A+V+IN RTGT+VIG +VR+  V VS+G+LTV IT N  + QP
Sbjct: 237 SFVSLLENLEVEPGEAAAKVVINSRTGTVVIGQHVRVQPVAVSHGSLTVTITANPAISQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISILQGI 356
              S  G T     TD++V + +GS   + AP   L  ++  +N +G     +++IL+ +
Sbjct: 297 PPLSG-GQTAVVPRTDIEVKE-EGSRMFLFAPGVSLGDIVRAVNQVGAAPGDLVAILEAL 354

Query: 357 KAAGALQSEIII 368
           K A AL++E++I
Sbjct: 355 KQADALRAELVI 366


>gi|88799027|ref|ZP_01114608.1| Flagellar basal-body P-ring protein [Reinekea sp. MED297]
 gi|88778254|gb|EAR09448.1| Flagellar basal-body P-ring protein [Reinekea sp. MED297]
          Length = 364

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 150/366 (40%), Positives = 223/366 (60%), Gaps = 15/366 (4%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           LIF+L  L   +     RIKD+ ++Q  R+NQL+GYGLVVGL G+GD    +PFT Q+ R
Sbjct: 8   LIFTLCLLQSFA--FADRIKDLSAVQGVRNNQLVGYGLVVGLDGSGDK---APFTNQTFR 62

Query: 68  SLLQNLGISTPGGRLGS-KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++++  GI+ P G      NVAAV V A LPPFA PG  IDV+++S+G++ SLRGG L++
Sbjct: 63  NMMEQFGITIPEGEDPKLANVAAVSVHATLPPFAKPGQEIDVTVSSIGNSDSLRGGSLLL 122

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           T L GADG +YAVAQG+++V G   +G+  SS    I + G+I NGAIVERE+P  F   
Sbjct: 123 TPLRGADGKVYAVAQGNMIVGGFGAEGEDGSSIKVNIQSAGRIPNGAIVEREVPTAFSQG 182

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSE 244
             L   L  PDF+TA R+ + IN           A A D+ +V+V+ P +       +S 
Sbjct: 183 DYLTFNLHRPDFTTAKRMQEVINEL----LGPDAAYAVDAASVRVTAPRDASQRVSFLSV 238

Query: 245 VEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           +E L V   +  A+VIIN RTGTIV+G +V+I  V +++G+LTV I  + + VQP   S+
Sbjct: 239 LENLEVTPGEEAAKVIINSRTGTIVVGQHVKIEPVAITHGDLTVTIQNDLEAVQPEGLSA 298

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G TV   + ++   + +    L      L+ L+  +N +G     +++IL+ +K+AGAL
Sbjct: 299 -GETVVVPDAEVNAEEEQNPMFLFGPTVTLSDLVDAVNEVGAAPGDLMAILEALKSAGAL 357

Query: 363 QSEIII 368
           ++E+I+
Sbjct: 358 KAELIV 363


>gi|260767765|ref|ZP_05876700.1| flagellar P-ring protein FlgI [Vibrio furnissii CIP 102972]
 gi|260617274|gb|EEX42458.1| flagellar P-ring protein FlgI [Vibrio furnissii CIP 102972]
 gi|315179403|gb|ADT86317.1| flagellar P-ring protein FlgI [Vibrio furnissii NCTC 11218]
          Length = 361

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 155/370 (41%), Positives = 226/370 (61%), Gaps = 17/370 (4%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           R+  L+   +    +SAQ  +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+
Sbjct: 3   RLTLLLMMFVA---VSAQA-ARIKDVSQVAGVRSNQLVGYGLVTGLPGTGES---TPFTD 55

Query: 64  QSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS  ++LQ+ GI  P G +  +KNVAAV+VTA+LP F+  G  +DV+++S+G A SLRGG
Sbjct: 56  QSFNAMLQSFGIQLPQGTKPKTKNVAAVIVTADLPAFSKQGQTVDVTVSSIGSAKSLRGG 115

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKK 181
            L+ T L G DG +YAVAQG++VVSG    G   S + G + T G I  GAIVERE+P  
Sbjct: 116 TLMQTFLKGLDGQVYAVAQGNLVVSGFSASGADGSKIVGNNPTVGMISAGAIVEREVPTP 175

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F     +   L   DF+TA R+AD +N +        +A A D+ +V+V  P ++     
Sbjct: 176 FGRGDFITFNLLESDFTTAQRMADAVNQF----LGPQMASAVDATSVRVRAPRDVGQRVA 231

Query: 241 LMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +S +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN
Sbjct: 232 FLSAIENLEFDPADGAAKIIVNSRTGTIVVGQHVRLKPAAVTHGGMTVAIKENLNVSQPN 291

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           AF S G T    ++ ++V++ KG  F L     L+ L+  +N +G     +++ILQ +K 
Sbjct: 292 AF-SGGQTAIVPDSSIEVTEKKGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQ 350

Query: 359 AGALQSEIII 368
           AGA++ ++II
Sbjct: 351 AGAIEGQLII 360


>gi|326796593|ref|YP_004314413.1| flagellar P-ring protein [Marinomonas mediterranea MMB-1]
 gi|326547357|gb|ADZ92577.1| Flagellar P-ring protein [Marinomonas mediterranea MMB-1]
          Length = 366

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 146/373 (39%), Positives = 230/373 (61%), Gaps = 13/373 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ +    +  L  L      +  R+KD+ S+   R+NQL GYGLV+GL GTGD+   + 
Sbjct: 1   MVMKCCVRLIILFTLVVSQLSLADRLKDIASVAGVRENQLFGYGLVIGLNGTGDN---TD 57

Query: 61  FTEQSMRSLLQNLGISTPGGR-LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS  S+L   GI+ P G    S NVAAV +TA LPPF+ PG +IDV+++SLG+ASSL
Sbjct: 58  FTNQSFLSMLNQFGINLPAGTDADSDNVAAVSLTATLPPFSKPGQQIDVTVSSLGNASSL 117

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVEREL 178
           RGG L++++L GADG +YA+AQG++VV GL  +G   S +   I T G+I NGA VE+ +
Sbjct: 118 RGGTLLLSALKGADGEVYAIAQGNLVVGGLGAQGADGSRLSINIPTVGRIPNGASVEKVV 177

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L   L  PDF+TA ++AD+IN          +A + D+ +++V+ P +   
Sbjct: 178 PSSFNRGDTLTFNLNRPDFTTAKQVADKINGL----LGPGVATSLDATSIRVTAPRDPSQ 233

Query: 238 LTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L V+  +  A+++IN RTGTI+IG +V++S   V++G+LTV I EN ++ 
Sbjct: 234 RVTFLSILENLDVQLGEERAKIVINSRTGTIIIGQHVKVSPAAVTHGSLTVTIKENPEIG 293

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQG 355
           QPNA +  G T+    +++ V ++ G   + D    LN ++  +N +G     +++IL+G
Sbjct: 294 QPNALAG-GETILAPRSEITVDEDSGHMFVFDPGASLNDIVRAVNQVGAAPGDVMAILEG 352

Query: 356 IKAAGALQSEIII 368
           +K AGA+ +++++
Sbjct: 353 LKQAGAINADLVV 365


>gi|254522675|ref|ZP_05134730.1| flagellar P-ring protein FlgI [Stenotrophomonas sp. SKA14]
 gi|219720266|gb|EED38791.1| flagellar P-ring protein FlgI [Stenotrophomonas sp. SKA14]
          Length = 380

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 150/368 (40%), Positives = 216/368 (58%), Gaps = 9/368 (2%)

Query: 4   RIAFLIFSLIGLHEISAQV-VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           RIA L  S   L  ++A     RIKD+  +   R N L+GYGLVVGL G+GD    +PFT
Sbjct: 14  RIASLYGSFFLLLAMAAPASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFT 73

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+++LL  LG++ P       KNVAAV + A LPPFA PG  ID++++S+G+A SLRG
Sbjct: 74  VQSLKNLLGELGVNVPPNVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIGNAVSLRG 133

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPK 180
           G L+M  L GADG IYA+AQG+++V G   +G+  S +   + + G+I NGA VER LP 
Sbjct: 134 GSLLMAPLRGADGQIYAIAQGNLIVGGFGAQGKDGSRVSVNVPSVGRIPNGATVERALPD 193

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT- 239
              +  D+ L L N DF+T  R+   +N    N F    A A D  TV V+ PT+     
Sbjct: 194 PLANGGDITLNLHNNDFTTVSRMVAALN----NAFGEGAARAVDGVTVAVTAPTDPGARI 249

Query: 240 RLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
            L++ +E L +   + PA+V++N RTGT+VIG  VR+    +S+G+LTV I EN  V QP
Sbjct: 250 GLLARIENLELTPGSAPAKVVVNSRTGTVVIGQQVRVGPAAISHGSLTVTIQENTNVSQP 309

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           NA S   +  +  +T    +D    F       L+ ++  +N++G     +I+IL+ +K 
Sbjct: 310 NALSGGRTVASPQSTITATNDGSRMFKFSGGTTLDEIVHAVNAVGAAPGDLIAILEALKQ 369

Query: 359 AGALQSEI 366
           AGAL +E+
Sbjct: 370 AGALSAEL 377


>gi|90577348|ref|ZP_01233159.1| flagellar P-ring protein precursor [Vibrio angustum S14]
 gi|90440434|gb|EAS65614.1| flagellar P-ring protein precursor [Vibrio angustum S14]
          Length = 373

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 156/374 (41%), Positives = 235/374 (62%), Gaps = 16/374 (4%)

Query: 3   FRIAFLI--FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           F ++FL   F  + L+ +SA+    + D+V +Q  R NQL+GYGLVVGL G+GD      
Sbjct: 7   FILSFLCVTFGWMPLN-VSAKTAVPMMDLVDVQGIRSNQLVGYGLVVGLDGSGDR-NQVK 64

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSK--NVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           FT QS+ ++L+  G+   G R+  K  NVA+V VTA +   A PG  ++V ++S+GDA S
Sbjct: 65  FTSQSITNMLRQFGVQI-GDRIDPKLKNVASVSVTATVEAMAGPGQELNVVVSSIGDAKS 123

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERE 177
           LRGG L++T L G DG +YAVAQG+VVV G+  +GQS S +     T G+I NGA +ERE
Sbjct: 124 LRGGTLLLTPLRGIDGEVYAVAQGNVVVGGVKAEGQSGSKITVNTPTTGRIPNGATLERE 183

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI- 236
           +P  F +S+ + L LR P F+TA  I+  IN+     F   +A A     V++  P ++ 
Sbjct: 184 IPTDFNNSSIVTLNLRQPSFTTAKNISRAINAT----FGPKVATAISKGRVEMRAPQDLQ 239

Query: 237 DLTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                MS +E L V T    ARV+ N RTGT+V+G NVR+S+  VS+GNLTV I+E++Q+
Sbjct: 240 QRVTFMSMLEDLKVMTGRKAARVVFNARTGTVVVGKNVRVSEAAVSHGNLTVTISESDQI 299

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQ 354
            QPNAFS  G+T   NN+ + ++ ++    +  +  +LN++++ +NS+G   D ++SILQ
Sbjct: 300 SQPNAFSQ-GTTERVNNSKVDINQDEAQMYIWPEGTELNTIVNAVNSLGASPDDLMSILQ 358

Query: 355 GIKAAGALQSEIII 368
            +  AGAL +E+++
Sbjct: 359 ALHEAGALNAELVV 372


>gi|89072311|ref|ZP_01158890.1| flagellar P-ring protein precursor [Photobacterium sp. SKA34]
 gi|89051843|gb|EAR57295.1| flagellar P-ring protein precursor [Photobacterium sp. SKA34]
          Length = 373

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 153/373 (41%), Positives = 234/373 (62%), Gaps = 14/373 (3%)

Query: 3   FRIAFLIFSLIGL-HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           F ++FL  +   +   +SA+    + D+V +Q  R NQL+GYGLVVGL G+GD      F
Sbjct: 7   FILSFLCVTFGWMPFNVSAKTAVPMMDLVDVQGIRSNQLVGYGLVVGLDGSGDR-NQVKF 65

Query: 62  TEQSMRSLLQNLGISTPGGRLGSK--NVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T QS+ ++L+  G+   G R+  K  NVA+V VTA +   A PG  +++ ++S+GDA SL
Sbjct: 66  TSQSITNMLRQFGVQI-GDRIDPKLKNVASVSVTATVEAMAGPGQELNIVVSSIGDAKSL 124

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVEREL 178
           RGG L++T L G DG +YAVAQG+VVV G+  +GQS S +     T G+I NGA +ERE+
Sbjct: 125 RGGTLLLTPLRGIDGEVYAVAQGNVVVGGVKAEGQSGSKITVNTPTTGRIPNGATLEREI 184

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID- 237
           P  F +S+ + L LR P F+TA  I+  IN+     F   +A A     V++  P ++  
Sbjct: 185 PTDFNNSSIVTLNLRQPSFTTAKNISRAINAT----FGPKVATAISKGRVEMRAPQDLQQ 240

Query: 238 LTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               MS +E L V T    ARV+ N RTGT+V+G NVR+S+  VS+GNLTV I+E++Q+ 
Sbjct: 241 RVTFMSMLEDLKVMTGRKAARVVFNARTGTVVVGKNVRVSEAAVSHGNLTVTISESDQIS 300

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPNAFS  G+T   NN+++ ++ ++    +  +  +LN++++ +NS+G   D ++SILQ 
Sbjct: 301 QPNAFSQ-GTTERVNNSNVDINQDEAQMYIWPEGTELNTIVNAVNSLGASPDDLMSILQA 359

Query: 356 IKAAGALQSEIII 368
           +  AGAL +E+++
Sbjct: 360 LHEAGALNAELVV 372


>gi|242278487|ref|YP_002990616.1| flagellar basal body P-ring protein [Desulfovibrio salexigens DSM
           2638]
 gi|242121381|gb|ACS79077.1| flagellar P-ring protein [Desulfovibrio salexigens DSM 2638]
          Length = 377

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 141/351 (40%), Positives = 219/351 (62%), Gaps = 9/351 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           SA+ V R+KD+ S    RDN L+GYGLVVGL GTGD   S+ FT  SM ++L+ +G+   
Sbjct: 30  SAEAV-RLKDISSFSGVRDNDLVGYGLVVGLSGTGDGTNSA-FTITSMINMLEKMGVQVD 87

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
              +  KNVAAVMVTA +P  A PG+ +DV+++S+GD+ SL GG+L+MT L G DG +YA
Sbjct: 88  RASIKPKNVAAVMVTAKMPVSAKPGAPLDVTVSSIGDSKSLFGGVLLMTPLKGIDGKVYA 147

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           +AQG++ V G    G++++  + + T  +I +GA +ER +P  F     + + L   DF 
Sbjct: 148 LAQGALTVGGFSASGEAATASKNVVTVARIPSGATIERSVPFDFNRQQKITINLGVSDFG 207

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPA 256
           T +++  +IN      +    A A D+ TV ++ P +   ++  LM+ +E L +  DT A
Sbjct: 208 TTMQVVKRINGVVGGSY----ASAVDASTVDLAIPEHFRGNMVPLMAALENLEIAPDTKA 263

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS-TVTQNNTDL 315
           +V+++E+TGT+V+G NVR++KV +++GNL V I E   V QP  F+  G+ TVT   T+L
Sbjct: 264 KVVVDEKTGTVVLGRNVRLTKVAIAHGNLQVVIAEGADVSQPGPFAPEGAETVTTPETEL 323

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            V ++     L++   L  L+ G+N+IG     +ISIL+ +K AGAL +E+
Sbjct: 324 AVEEDNNRLMLVEGATLQELVDGLNAIGATPRDLISILRTMKVAGALHAEL 374


>gi|54308101|ref|YP_129121.1| flagellar basal body P-ring protein [Photobacterium profundum SS9]
 gi|81615375|sp|Q6LTQ6|FLGI2_PHOPR RecName: Full=Flagellar P-ring protein 2; AltName: Full=Basal body
           P-ring protein 2; Flags: Precursor
 gi|46912527|emb|CAG19319.1| Putative flagellar P-ring protein FlgI [Photobacterium profundum
           SS9]
          Length = 363

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 151/351 (43%), Positives = 214/351 (60%), Gaps = 17/351 (4%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKDV  +   R NQL+GYGLVVGL GTG++   +PFT+QS  ++LQN GI  P G +  
Sbjct: 22  RIKDVSEVAGVRSNQLVGYGLVVGLPGTGET---TPFTDQSFNAMLQNFGIQLPAGTKPK 78

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KNVAAV V A LP F   G +ID++++S+G A SLRGG L+ T L G DG +YAVAQGS
Sbjct: 79  TKNVAAVAVNATLPAFTKQGQKIDITVSSIGSAKSLRGGTLLQTFLKGLDGKVYAVAQGS 138

Query: 144 VVVSGLFVKGQSSSFMEG-ISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G  V G   S + G I T G+I NGA+VE+E+P  F     L   L   DFSTA R
Sbjct: 139 LVVGGFSVTGADGSKLVGNIPTVGRISNGAMVEQEVPNPFGRGDFLTFNLFESDFSTAQR 198

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDT---PARV 258
           +AD +N +        +A A D+ +V+V  P ++      ++ VE   +E D     A++
Sbjct: 199 LADAVNEF----LGPEMAAAIDATSVRVRAPRDVSQRVAFLATVE--NIEFDPAVGAAKI 252

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           I+N RTGTIVIG NV++    +++G +TV I EN QV QP  F S G TV   N++++V+
Sbjct: 253 IVNSRTGTIVIGQNVKLKPAAITHGGMTVSIKENYQVSQPAPF-SGGETVVVPNSEIEVT 311

Query: 319 DNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +     F       L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 312 EKDSRMFKFEPGVTLDELVRAVNQVGAAPSDLMAILQALKQAGAIEGQLII 362


>gi|83647169|ref|YP_435604.1| flagellar basal body P-ring protein [Hahella chejuensis KCTC 2396]
 gi|115311517|sp|Q2SDU5|FLGI2_HAHCH RecName: Full=Flagellar P-ring protein 2; AltName: Full=Basal body
           P-ring protein 2; Flags: Precursor
 gi|83635212|gb|ABC31179.1| Flagellar basal-body P-ring protein [Hahella chejuensis KCTC 2396]
          Length = 378

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 151/372 (40%), Positives = 222/372 (59%), Gaps = 20/372 (5%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F +  L F+ +   E       RIKD+ +++  R NQ++GYGLVVGL GTGD    +PF
Sbjct: 21  LFALGLLCFAAMAGAE-------RIKDIATVEGVRSNQIVGYGLVVGLDGTGDK---APF 70

Query: 62  TEQSMRSLLQNLGISTPGGRLGS-KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T+Q+ R+++   GI+ P G     KNVAAV V A+LP F+ PG +ID++++S+G+A SLR
Sbjct: 71  TDQTFRNMMNRFGITIPAGTDPKLKNVAAVSVHADLPAFSKPGQKIDITVSSVGNAKSLR 130

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVV-SGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+MT+L GADG  YAVAQG++VV          SS    + + G+I NGA VER +P
Sbjct: 131 GGSLLMTNLKGADGKTYAVAQGNLVVGGFGAGGADGSSITVNVPSVGRIPNGATVERAVP 190

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     L L L +PDF+TA R+ D+IN          +A+A D+ +++V  P      
Sbjct: 191 SSFSHGDTLTLNLSSPDFTTAKRVQDRINDL----LGPGLAQAVDAASIRVMAPREASQR 246

Query: 239 TRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S +E L VE     A+++IN RTGTIV+G NV++    V++GNLTV ITE+  V Q
Sbjct: 247 VGFLSILENLEVEPGQEAAKIVINSRTGTIVVGQNVKVLPAAVTHGNLTVTITEDFGVSQ 306

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNA +  G TV    TD+ V       F    A  LN ++  +N +G     ++++L+ +
Sbjct: 307 PNALAG-GDTVVVPQTDVNVEQEPSRMFKFGPAATLNDIVRAVNQVGAAPGDVMAVLEAL 365

Query: 357 KAAGALQSEIII 368
           K AGAL++E+I+
Sbjct: 366 KQAGALKAELIV 377


>gi|167034939|ref|YP_001670170.1| flagellar basal body P-ring protein [Pseudomonas putida GB-1]
 gi|166861427|gb|ABY99834.1| flagellar P-ring protein [Pseudomonas putida GB-1]
          Length = 371

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 150/374 (40%), Positives = 221/374 (59%), Gaps = 13/374 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F    LI + + L    A    R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 3   MFNARQLIAATLLLSCAFAAQAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPF 62

Query: 62  TEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SL
Sbjct: 63  TLQTFNNMLSQFGIKVPAGSGNVQLKNVAAVSVHADLPAFAKPGQVVDITVSSIGNSKSL 122

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVEREL 178
           RGG L+MT L G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +
Sbjct: 123 RGGSLLMTPLKGIDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAV 182

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN--- 235
           P  F     L L L  PDF+TA RI D++N          +A+A D  +V+VS P +   
Sbjct: 183 PSGFNQGNTLTLNLNRPDFTTAKRIVDKVNDL----LGPGVAQAVDGGSVRVSAPMDPSQ 238

Query: 236 -IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQ 294
            +D   ++  +E+   +    A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  
Sbjct: 239 RVDYLSILENLEIDPGQAV--AKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPI 296

Query: 295 VVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQ 354
           V QP AFS+  + V   +      + K  F       L+ ++  +N +G     +++IL+
Sbjct: 297 VSQPGAFSNGQTAVVPRSRVNAEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILE 356

Query: 355 GIKAAGALQSEIII 368
            +K AGALQ+++I+
Sbjct: 357 ALKQAGALQADLIV 370


>gi|91224195|ref|ZP_01259458.1| flagellar P-ring protein precursor I [Vibrio alginolyticus 12G01]
 gi|91191106|gb|EAS77372.1| flagellar P-ring protein precursor I [Vibrio alginolyticus 12G01]
          Length = 373

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 151/351 (43%), Positives = 224/351 (63%), Gaps = 17/351 (4%)

Query: 26  IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS---TPGGRL 82
           I D+V ++  R+NQL+GYGLVVGL G GD      FT QS+ ++L+  G+    +   +L
Sbjct: 31  IMDLVDVRGIRENQLVGYGLVVGLAGQGDR-NQVKFTSQSITNMLRQFGVQIDDSMNPKL 89

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             +NVA+V VTA++ P A PG  +DV ++S+GDA SLRGG L++T L G DG +YA+AQG
Sbjct: 90  --RNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLRGGTLLLTPLRGIDGEVYAIAQG 147

Query: 143 SVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           +VVV GL  +G+S S +E    T G++ NGA +ERE+   F    ++ L LR P F+TA 
Sbjct: 148 NVVVGGLSAEGRSGSKVEVNTPTAGRVPNGATLEREIKTDFNQRDEITLNLRKPSFTTAK 207

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEV--EMLTVETDTPARVI 259
            IA +IN    N F   +A A +   V +  P +     +M  +  EM  VE   PAR++
Sbjct: 208 NIAREIN----NTFGPNVAVAINKARVDMRAPKDTQQRVVMMSMLEEMSVVEGRKPARIV 263

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
            N RTGT+VIG +V++S+  VS+GNLTV+I+E++QV QPNAF +NG T   N TDL V++
Sbjct: 264 FNSRTGTVVIGKSVKVSEAAVSHGNLTVRISESQQVSQPNAF-ANGDTKVVNQTDLDVNE 322

Query: 320 NKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +     +I  P  +LN++++ +NS+G     ++SILQ +  AGAL +E+++
Sbjct: 323 DLAQM-VIWPPGTELNTIVNAVNSLGATPTDLMSILQALSEAGALNAELVV 372


>gi|78358195|ref|YP_389644.1| flagellar basal body P-ring protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|115311521|sp|Q30WJ7|FLGI_DESDG RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|78220600|gb|ABB39949.1| flagellar P-ring protein FlgI [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 370

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 158/349 (45%), Positives = 224/349 (64%), Gaps = 9/349 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           AQ V RIKD+ S    RDN L+GYGLVVGL GTGD  +SS FT  SM ++L  +GI+   
Sbjct: 26  AQAV-RIKDIASFGGVRDNDLMGYGLVVGLGGTGDK-KSSTFTISSMVNMLDKMGIAVDR 83

Query: 80  GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
            +L  KNVAAVMVT  +P  A PGSR+D++++SLGDA+SL GG+L+MT + G DG +YA+
Sbjct: 84  TKLTPKNVAAVMVTTRMPVSARPGSRLDITVSSLGDATSLLGGVLLMTPMKGVDGKVYAL 143

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQG + + G   +G ++   + I+T G+I  GA+VER +P +F     L L +   DFST
Sbjct: 144 AQGPLALGGFSAEGDAARAQKNITTVGRIPGGAVVERAVPFEFNTQNKLTLHMNVQDFST 203

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPAR 257
            +++ D++N     +F    A A D  TV +  P     +L  LM+ +E L V  D+PAR
Sbjct: 204 TMQVVDRLNDNMGGQF----ASARDIATVDIMVPPAYRGNLVPLMASLENLPVTPDSPAR 259

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           V+++E+TGT+V+G++VRISKV VS+GNL + + EN QV QP AFS  G TV    TD+  
Sbjct: 260 VVVDEKTGTVVVGNSVRISKVAVSHGNLQIVVQENPQVSQPGAFSP-GQTVVTPQTDIAA 318

Query: 318 SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            +      +++   L  L+ G+NSIG     +ISIL+ +KAAGAL +E+
Sbjct: 319 QEENRRLVMMEGATLQELVDGLNSIGATPRDLISILRTLKAAGALHAEL 367


>gi|145298495|ref|YP_001141336.1| flagellar basal body P-ring protein [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851267|gb|ABO89588.1| flagellar P-ring protein FlgI [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 375

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 152/366 (41%), Positives = 222/366 (60%), Gaps = 15/366 (4%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           LI  L+ L    A   SRIKD+ S++  R+NQLIGYGLVVGL GTG+  +++ FTEQ+ R
Sbjct: 19  LICCLMPLGMAHA---SRIKDISSVEGVRNNQLIGYGLVVGLPGTGE--KNNAFTEQTFR 73

Query: 68  SLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L N GI  P   +   K+VA V + A+LPPF+ PG  IDV+++++G+A SLRGG L+ 
Sbjct: 74  TMLNNFGIKVPDNIKPKIKDVAPVAIHADLPPFSKPGQTIDVTVSAIGEAKSLRGGTLLQ 133

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           + L G DG +YAVAQGS+VV GL  +G   S  +    T G+I NGA VERE+P  F   
Sbjct: 134 SFLKGLDGRVYAVAQGSLVVGGLGAEGADGSKVVINTPTVGRIANGATVEREVPNSFGQG 193

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSE 244
             +   L  PDF+TA  +AD +N           A+A D+ +VKV  P +       ++ 
Sbjct: 194 DTITFNLNRPDFTTARGLADVVNDL----VGPNTAQALDATSVKVYAPRDPGQRVSYLAT 249

Query: 245 VEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           +E L V+  +  A++I+N RTGTIVIG NVR+    +S+G LTV I EN+QV QPN  + 
Sbjct: 250 IENLEVDPASESAKIIVNSRTGTIVIGSNVRLKPAAISHGGLTVTIAENQQVSQPNPLAG 309

Query: 304 NGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G T   NN+ + V    G  F L     L+ L+  +N +G+    +++IL+ ++ AGA+
Sbjct: 310 -GETAVTNNSTINVQQEPGRMFKLDTGATLDDLVRAVNQVGVAPGDLMAILEALQQAGAI 368

Query: 363 QSEIII 368
           + +++I
Sbjct: 369 EGQLVI 374


>gi|149927802|ref|ZP_01916053.1| flagellar P-ring protein precursor I [Limnobacter sp. MED105]
 gi|149823424|gb|EDM82655.1| flagellar P-ring protein precursor I [Limnobacter sp. MED105]
          Length = 381

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 149/351 (42%), Positives = 218/351 (62%), Gaps = 9/351 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS-TP 78
           A+  +RI+D+V++   R N + GYGLV+GL GTGD    +PFT QS+ S+LQ  GI+  P
Sbjct: 33  AEAQTRIRDLVTVSGVRSNPVYGYGLVIGLDGTGDQTTQTPFTSQSIVSMLQQSGITLPP 92

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           G  L  KNVA+VMVTANLP FA PG  IDV+++S+G+A SLRGG+L+MT L GADG +YA
Sbjct: 93  GANLQLKNVASVMVTANLPAFAQPGQAIDVTVSSIGNAKSLRGGMLLMTPLKGADGQVYA 152

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           +AQG ++V G       S  +    + G+I  GA+VERE+   F     L L+L + DFS
Sbjct: 153 LAQGQLIVGGAGASAGGSKTVINHLSAGRIPAGALVEREVASPFLLGETLQLELTSTDFS 212

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDT-PA 256
            AIR+A+ IN    N     +A+A D RT+KV  P+N  D    +S V+ L++      A
Sbjct: 213 NAIRVAEAIN----NNMGPNVAQALDGRTIKVRAPSNPNDRVAFLSRVQELSINKAMGSA 268

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +VI+N RTG++V+   V +    V++GNLTV+IT    + QP  F   G TV     D++
Sbjct: 269 KVIVNARTGSVVMNQAVMLESCAVAHGNLTVKITSTPVISQPAPF-GQGETVVTEVADIQ 327

Query: 317 VSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +S++ G    I  A  L+ ++  +N++G     +ISILQ ++ AG+L++E+
Sbjct: 328 ISESGGELIEIKGAAQLSDVVKALNALGATPSDLISILQAMQTAGSLKAEL 378


>gi|71279538|ref|YP_268226.1| flagellar basal body P-ring protein [Colwellia psychrerythraea 34H]
 gi|115311519|sp|Q485N9|FLGI_COLP3 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|71145278|gb|AAZ25751.1| flagellar P-ring protein FlgI [Colwellia psychrerythraea 34H]
          Length = 363

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 155/367 (42%), Positives = 220/367 (59%), Gaps = 17/367 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           F++F+ +     +AQ   RIKD+  +   R NQLIGYGLVVGL GTG+    SPFTEQS 
Sbjct: 8   FILFTFLASLSANAQ---RIKDLADVAGVRSNQLIGYGLVVGLPGTGEQ---SPFTEQSF 61

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           +++L N GI+ P   +   KNVAAV V A L  F  PG  IDV+++S+G A SLRGG L+
Sbjct: 62  KTMLSNFGITMPDKLKPKIKNVAAVAVHAELSAFTKPGQTIDVTVSSMGSAQSLRGGTLI 121

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
            T L+G DGN YAVAQGS++VSGL  +G   S  +  I T G+I NG IVERE+   F  
Sbjct: 122 QTILMGIDGNAYAVAQGSLIVSGLGAQGLDGSQVLVNIPTVGRIANGGIVEREVKSPFSS 181

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMS 243
              +   LR+ DF+TA  ++D IN           A+A D+ +V+V  P +I D    +S
Sbjct: 182 GDHITFNLRHSDFTTAKLLSDTINDLIEGS-----AKALDATSVRVRAPRDISDRVSFLS 236

Query: 244 EVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E L  E  +P A++I+N RTGTIVIG  V +    +++G +TV I E + V QPNAF 
Sbjct: 237 VLENLEFEPASPAAKIIVNSRTGTIVIGSEVTLLAAAITHGGITVTINEIQDVSQPNAF- 295

Query: 303 SNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           + G TV  N +D+ VS++    F       L +L+  +N +G     +++IL+ +  AGA
Sbjct: 296 AEGETVVTNQSDINVSNSDARMFVFKPGVTLETLVRAINEVGAGPGDVMAILEALDQAGA 355

Query: 362 LQSEIII 368
           ++ E++I
Sbjct: 356 IRGELVI 362


>gi|77165834|ref|YP_344359.1| flagellar basal body P-ring protein [Nitrosococcus oceani ATCC
           19707]
 gi|254433462|ref|ZP_05046970.1| flagellar P-ring protein FlgI [Nitrosococcus oceani AFC27]
 gi|115311525|sp|Q3J8L7|FLGI_NITOC RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|76884148|gb|ABA58829.1| Flagellar P-ring protein [Nitrosococcus oceani ATCC 19707]
 gi|207089795|gb|EDZ67066.1| flagellar P-ring protein FlgI [Nitrosococcus oceani AFC27]
          Length = 367

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 150/369 (40%), Positives = 224/369 (60%), Gaps = 16/369 (4%)

Query: 7   FLIFSLIGLHE-ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           F I +L+ L + + A+   R+KD+ ++   R NQL+GYGLVVGL GTGD +    +T QS
Sbjct: 7   FFIITLLWLSQGVQAE---RVKDLAAIAGVRSNQLVGYGLVVGLSGTGDQVTQISYTRQS 63

Query: 66  MRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           +R++L+  GI  P G  L  KNVAAV + A LPPFA PG  ID++++SLG+A SLRGG L
Sbjct: 64  LRNMLREFGIIMPPGVNLQPKNVAAVSIHAQLPPFAKPGQSIDITVSSLGNAKSLRGGSL 123

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFK 183
           ++T L GADG +YA+AQG+++V G   +G   S +   I + G+I NGA VER +P  F 
Sbjct: 124 LLTPLKGADGRVYAMAQGNLIVGGFGAEGNDGSRVTVNIPSTGRIPNGATVERGVPNPFN 183

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLM 242
           +   +IL L   DF+TA R+A  INS      +RP+    D  +++V+ P         +
Sbjct: 184 NGGPIILNLHAADFTTANRVAAAINSAIGAGTARPL----DGASIQVNAPAVPAQRVSFV 239

Query: 243 SEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E L V+  + PA+++IN RTGT+VIG +VR+    VS+G LTV IT N  + QP   
Sbjct: 240 SLLENLEVDPGEAPAKIVINSRTGTVVIGQHVRVQPAAVSHGRLTVTITANPAISQPPPL 299

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISILQGIKAA 359
           S  G T     TD+ + + +GS   + AP   L  ++  +N +G     +++IL+ +K  
Sbjct: 300 SG-GQTAVVPRTDIDIQE-EGSRMFLFAPGVSLGEIVRAVNQVGAAPGDLVAILEALKQV 357

Query: 360 GALQSEIII 368
           GAL +E+++
Sbjct: 358 GALSAELVV 366


>gi|212709496|ref|ZP_03317624.1| hypothetical protein PROVALCAL_00538 [Providencia alcalifaciens DSM
           30120]
 gi|212687834|gb|EEB47362.1| hypothetical protein PROVALCAL_00538 [Providencia alcalifaciens DSM
           30120]
          Length = 371

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 153/369 (41%), Positives = 220/369 (59%), Gaps = 11/369 (2%)

Query: 7   FLIFSLIGLHE---ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           F++ S + L     ++     RIKD+ ++Q  RDN LIGYGLVVGL GTGD    +PFT 
Sbjct: 6   FVLISFVCLFGSLFVAPAYSERIKDLTTVQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTT 65

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS+ ++L  +GI+ P G  +  KNVAAVMVTA +PPF   G  +DV ++S+G+A SLRGG
Sbjct: 66  QSLNNMLSQMGITVPAGTNMQLKNVAAVMVTAKMPPFGRSGQSVDVVVSSMGNAKSLRGG 125

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L G DG IYA+AQG+V+V G       SS       GG+I +GA++ERELP  F
Sbjct: 126 TLLMTPLKGVDGQIYAMAQGNVLVGGAGASAGGSSVKVNQLNGGRITDGAMIERELPNSF 185

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRL 241
             S  + LQL    F+ A  I+D IN           A A DSRTV++  P  N D  R 
Sbjct: 186 GQSGAINLQLNEDSFALAQDISDAINRLG----GMGSARALDSRTVQLLVPANNTDQVRF 241

Query: 242 MSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           +S V+ L V T    A+VI+N RTG++VI  +V +    V++G+L V +    QV QP+ 
Sbjct: 242 LSRVQELNVRTPMAEAKVILNSRTGSVVINRSVTLDSCAVAHGSLAVTVERQTQVNQPDT 301

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAA 359
             + G TV   NT++ V +  G+   ++A   LN +I  +N++G     ++SILQ +++A
Sbjct: 302 PFAGGQTVVTRNTNIGVKEQGGALQKVNASVQLNQVIQALNTLGATPTDLMSILQAMESA 361

Query: 360 GALQSEIII 368
           G L++++ I
Sbjct: 362 GCLRAKLEI 370


>gi|330502738|ref|YP_004379607.1| flagellar basal body P-ring protein [Pseudomonas mendocina NK-01]
 gi|328917024|gb|AEB57855.1| flagellar basal body P-ring protein [Pseudomonas mendocina NK-01]
          Length = 404

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 149/348 (42%), Positives = 209/348 (60%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLG 83
           R+KD+ S+Q  R NQLIGYGLVVGL G+GD    +PFT Q+  ++L   GI  P GG + 
Sbjct: 60  RLKDLASIQGVRSNQLIGYGLVVGLNGSGDQTTQTPFTVQTFNNMLAQFGIKVPPGGNVQ 119

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV V A+LP FA PG  ID++I+S+G+A SLRGG L+MT L G DGN+YA+AQG+
Sbjct: 120 LKNVAAVSVHADLPAFAKPGQTIDITISSIGNAKSLRGGSLLMTPLKGIDGNVYAIAQGN 179

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G    G   S +   + + G+I  GA VER +P  F     L L L  PDF+TA  
Sbjct: 180 LVVGGFDASGADGSRITVNVPSAGRIPGGATVERPVPSGFDQGNYLTLNLNRPDFTTAKN 239

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVETDTP-ARVII 260
           I DQIN          +A+A D  +++VS P + +     +S +E L VE     A+VII
Sbjct: 240 IVDQINDL----LGPGVAQAIDGGSIRVSAPLDPNQRVDYLSILENLQVEAGKAVAKVII 295

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTGTIVIG +V++    V++G+LTV ITE+  V QP A S   + V   +      + 
Sbjct: 296 NSRTGTIVIGQDVKVQPAAVTHGSLTVTITEDPIVSQPEALSGGQTAVVPRSRVGAEQEA 355

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 356 KPMFKFGPGTSLDEIVRAVNQVGAAPSDLMAILEALKQAGALQADLIV 403


>gi|104782838|ref|YP_609336.1| flagellar basal body P-ring protein [Pseudomonas entomophila L48]
 gi|122402467|sp|Q1I733|FLGI_PSEE4 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|95111825|emb|CAK16549.1| flagellar basal P-ring protein [Pseudomonas entomophila L48]
          Length = 369

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 147/369 (39%), Positives = 217/369 (58%), Gaps = 19/369 (5%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+    G H        R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+ 
Sbjct: 12  LLMSCAFGAH------AERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPFTLQTF 65

Query: 67  RSLLQNLGISTP--GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            ++L   GI  P   G +  KNVAAV V A+LPPFA PG  +D++++S+G++ SLRGG L
Sbjct: 66  NNMLSQFGIKVPPGSGNVQLKNVAAVSVHADLPPFAKPGQVVDITVSSIGNSKSLRGGSL 125

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFK 183
           +MT L G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +P  F 
Sbjct: 126 LMTPLKGIDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAVPSGFN 185

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLT 239
               L L L  PDF+TA RI D++N          +A+A D  +V+V+ P +    +D  
Sbjct: 186 QGNSLTLNLNRPDFTTAKRIVDKVNEL----LGPGVAQAVDGGSVRVTAPMDPSQRVDYL 241

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            ++  +E+   +    A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP 
Sbjct: 242 SILENLEIDPGQAV--AKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPG 299

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
            FS+  + V   +      + K  F       L+ ++  +N +G     +++IL+ +K A
Sbjct: 300 PFSNGQTAVVPRSRVNAQQEAKPMFKFGPGTTLDEIVRAVNQVGAAPSDLMAILEALKQA 359

Query: 360 GALQSEIII 368
           GALQ+++I+
Sbjct: 360 GALQADLIV 368


>gi|148554185|ref|YP_001261767.1| flagellar basal body P-ring protein [Sphingomonas wittichii RW1]
 gi|166988333|sp|A5V5R3|FLGI_SPHWW RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|148499375|gb|ABQ67629.1| flagellar P-ring protein [Sphingomonas wittichii RW1]
          Length = 367

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 145/365 (39%), Positives = 213/365 (58%), Gaps = 12/365 (3%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           +F   GL    A    RIKD+ S    R NQL GYG+VVGL GTGD   S  ++   M+ 
Sbjct: 9   LFCFSGLALAGAGHAERIKDIGSFAGLRANQLTGYGIVVGLAGTGDD--SLDYSTLGMKG 66

Query: 69  LLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +    G+  P G     KN AAVM+TA LP FA PG R+D++I++LG A SLRGG L+M 
Sbjct: 67  VASRFGLQLPAGVNPALKNAAAVMITAELPAFAKPGQRLDITISALGKAKSLRGGTLIMA 126

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSA 186
            L+GADG IYA+AQG++ V GL +     S +   + T G+I  GA VER +   F  + 
Sbjct: 127 PLMGADGQIYAMAQGNLAVGGLGIDAADGSKLTINVPTAGRIPGGATVERSVDAGFATTP 186

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLMSEV 245
            L   L   D +T+ R+A  IN     R  +PIA + D+ T+ +  P   ++ T LMS +
Sbjct: 187 QLRFDLSEGDLTTSQRVAAAIN----GRLGQPIARSIDATTITIDAPQGAEVRTALMSRI 242

Query: 246 EMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           E L V+T + PARV++N RTGT+VI   VRI+ V V++G +TVQ+ E  Q++QP  F S 
Sbjct: 243 ENLEVDTAEAPARVVVNARTGTVVINGAVRIAPVAVTHGKMTVQVDEKPQIIQPQPF-SR 301

Query: 305 GSTVTQNNTDLKVS-DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G T  Q ++ + V  + +  F       L  ++  +N+IG     +++IL+ +K AGA++
Sbjct: 302 GQTAVQQSSAINVEQEARPMFEFNPGASLADIVKAVNAIGASPADLVAILEALKQAGAMK 361

Query: 364 SEIII 368
           +E+++
Sbjct: 362 AELVV 366


>gi|258622492|ref|ZP_05717514.1| Flagellar P-ring protein precursor [Vibrio mimicus VM573]
 gi|258585192|gb|EEW09919.1| Flagellar P-ring protein precursor [Vibrio mimicus VM573]
          Length = 378

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 156/375 (41%), Positives = 232/375 (61%), Gaps = 18/375 (4%)

Query: 3   FRIAFLIFSLIGLHEIS-AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           F  +FLI   +G    S A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      F
Sbjct: 12  FFSSFLIVLTLGFAATSQAKVEIPIMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKF 70

Query: 62  TEQSMRSLLQNLGISTPGGRLGS-KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +DV ++S+GDA SLR
Sbjct: 71  TAQSITNMLRQFGVQIDDNMDPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLR 130

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YAVAQG+VVV GL  +G+S S +     T G+I NGA +ERE+ 
Sbjct: 131 GGTLLLTPLRGIDGELYAVAQGNVVVGGLSAEGKSGSKVAVNTPTAGRIPNGATLEREIS 190

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN---- 235
             F     + L LR P F+TA  IA +IN    N F   +A + +  ++ +  P +    
Sbjct: 191 TDFNKRDQITLNLRKPSFTTAKNIAQEIN----NTFGPNVAVSVNKTSINMRAPKDTQQR 246

Query: 236 IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
           +++  ++   EM  VE   PARV+ N RTGT+VIG NV++ +  VS+GNLTV+I+E++QV
Sbjct: 247 VEMMAMLE--EMSVVEGRKPARVVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESQQV 304

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISIL 353
            QPNAF+  G T T + T + VS+++    +I  P  +LN++++ +NS+G     ++SIL
Sbjct: 305 SQPNAFAG-GETETIDQTRIDVSEDQNRM-MIWPPGTELNTIVNAINSLGATPTDLMSIL 362

Query: 354 QGIKAAGALQSEIII 368
           Q +  AGAL +E+++
Sbjct: 363 QALYEAGALNAELVV 377


>gi|325274794|ref|ZP_08140823.1| flagellar basal body P-ring protein [Pseudomonas sp. TJI-51]
 gi|324100075|gb|EGB97892.1| flagellar basal body P-ring protein [Pseudomonas sp. TJI-51]
          Length = 369

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 148/374 (39%), Positives = 220/374 (58%), Gaps = 13/374 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F +  LI + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MFNVRQLIAATLLLSCACVAQAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTP--GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P   G +  KNVAAV V A+LPPFA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPPGSGNVQLKNVAAVSVHADLPPFAKPGQVVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVEREL 178
           RGG L+MT L G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +
Sbjct: 121 RGGSLLMTPLKGIDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN--- 235
           P  F     L L L  PDF+TA RI D++N          +A+A D  +V+VS P +   
Sbjct: 181 PSGFNQGNTLTLNLNRPDFTTAKRIVDKVNDL----LGPGVAQAVDGGSVRVSAPMDPSQ 236

Query: 236 -IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQ 294
            +D   ++  +E+   +    A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  
Sbjct: 237 RVDYLSVLENLEIDPGQAV--AKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPI 294

Query: 295 VVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQ 354
           V QP   S+  + V   +      + K  F       L+ ++  +N +G     +++IL+
Sbjct: 295 VSQPGPLSNGQTAVVPRSRVNAEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILE 354

Query: 355 GIKAAGALQSEIII 368
            +K AGALQ+++I+
Sbjct: 355 ALKQAGALQADLIV 368


>gi|218778843|ref|YP_002430161.1| flagellar P-ring protein [Desulfatibacillum alkenivorans AK-01]
 gi|218760227|gb|ACL02693.1| Flagellar basal body P-ring protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 393

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 151/370 (40%), Positives = 224/370 (60%), Gaps = 30/370 (8%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIK++ S++  R NQLIGYGLVVGL GTGD    + FT Q + ++++++G+      + 
Sbjct: 28  ARIKELASIKGVRTNQLIGYGLVVGLNGTGDK-SGTEFTLQGLVNMMEHMGVHVSKDDVK 86

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA++PPFA  GS++DV I+S+GDA SL GG L++T L G D N+YA+AQG 
Sbjct: 87  VKNVAAVMVTADIPPFARIGSQVDVVISSVGDAKSLVGGTLLLTPLRGVDRNVYALAQGP 146

Query: 144 V-VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           + V             ++   T G+IV GA +ERE+P + +   +L L L + DF+TAIR
Sbjct: 147 LSVGGYSVGGAAGGGAVKNHPTVGRIVGGASIEREIPMQLQGRNELTLALNDADFTTAIR 206

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVII 260
           + D IN    N    P+A A DS TV +  P +    +  +++ VE L +  D  A+VI+
Sbjct: 207 MKDAIN----NGIGMPVAYAADSGTVIIDIPQDYRNKVVSMVAMVENLDIMPDAVAKVIV 262

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN---------------- 304
           NE+TGT+V+G+ VRIS V V++GNL++QITE+ QV QP +FS N                
Sbjct: 263 NEKTGTVVVGEKVRISTVAVAHGNLSIQITESAQVSQPASFSPNPPADAQTEQLNLEEGA 322

Query: 305 -----GSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKA 358
                G TV   ++ + V++      ++ A   +  L+  +N+IG+    +I+I Q IKA
Sbjct: 323 VVAPGGQTVVTADSQVVVAEENKQLMVVPAGATIGDLVRALNAIGVTPRDLITIFQMIKA 382

Query: 359 AGALQSEIII 368
           AGALQ E++I
Sbjct: 383 AGALQGELVI 392


>gi|166712058|ref|ZP_02243265.1| flagellar basal body P-ring protein [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 372

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 152/373 (40%), Positives = 220/373 (58%), Gaps = 20/373 (5%)

Query: 3   FRIAFLIFSLIGLHEISAQV-VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           FR   L+ +L+G   ++A     RIKD+  +   R N L+GYGLVVGL G+GD    +PF
Sbjct: 8   FR---LLATLLGACVVAAPASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPF 64

Query: 62  TEQSMRSLLQNLGISTPGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           T QS+++LL  LG++ P     +L  KNVAAV + A LPPFA PG  ID++++S+ +A S
Sbjct: 65  TVQSLKNLLGELGVNVPANVNPQL--KNVAAVAIHAELPPFAKPGQPIDITVSSIANAVS 122

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERE 177
           LRGG L+M  L GADG +YA+AQG++VV G   +G+  S +   + + G+I NGAIVER 
Sbjct: 123 LRGGSLLMAPLKGADGQVYAMAQGNLVVGGFGAQGKDGSRVSVNVPSVGRIPNGAIVERA 182

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-- 235
           LP  F  + ++ L L   DF+T  R+   I+S     F    A A D  TV V  PT+  
Sbjct: 183 LPDVFAGTGEITLNLHQNDFTTVSRMVAAIDS----SFGAGTARAVDGVTVAVRSPTDPG 238

Query: 236 --IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENE 293
             I L   +  VE+     D PA+V++N RTGT+VIG  VR+    +++G+LTV I+EN 
Sbjct: 239 ARIGLLSRLENVEL--SPGDAPAKVVVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENT 296

Query: 294 QVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISIL 353
            V QP AFS   + VTQ +T    S+    F       L+ ++  +N +G     +++IL
Sbjct: 297 NVSQPGAFSGGRTAVTQQSTITATSEGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAIL 356

Query: 354 QGIKAAGALQSEI 366
           + +K AGAL +E+
Sbjct: 357 EALKQAGALSAEL 369


>gi|190574259|ref|YP_001972104.1| flagellar basal body P-ring protein [Stenotrophomonas maltophilia
           K279a]
 gi|190012181|emb|CAQ45804.1| putative flagellar P-ring protein precuror [Stenotrophomonas
           maltophilia K279a]
          Length = 380

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 146/364 (40%), Positives = 217/364 (59%), Gaps = 13/364 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           FL+F+++     SA+   RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+
Sbjct: 23  FLVFAVVA--PASAE---RIKDLAQIGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSL 77

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           ++LL  LG++ P       KNVAAV + A LPPFA PG  ID++++S+G+A S+RGG L+
Sbjct: 78  KNLLGELGVNVPPNVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIGNAVSMRGGSLL 137

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKD 184
           M  L GADG IYA+AQG+++V G   +G+  S +   + + G+I NGA VER LP    +
Sbjct: 138 MAPLRGADGQIYAIAQGNLIVGGFGAQGKDGSRVSVNVPSVGRIPNGATVERALPDPLAN 197

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT-RLMS 243
             ++ L L N DF+T  R+   +N    N F    A A D  TV V+ PT+      L++
Sbjct: 198 GGEITLNLHNNDFTTVSRMVAALN----NAFGEGAARAVDGVTVAVTAPTDPGARIGLLA 253

Query: 244 EVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E L +   + PA+V++N RTGT+VIG  VR+    +S+G+LTV I EN  V QPNA S
Sbjct: 254 RIENLELTPGSAPAKVVVNSRTGTVVIGQQVRVGPAAISHGSLTVTIQENTNVSQPNALS 313

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
              +  +  +T    +D    F       L+ ++  +N++G     +I+IL+ +K AGAL
Sbjct: 314 GGRTVASPQSTITATNDGSRMFKFSGGTTLDEIVHAVNAVGAAPGDLIAILEALKQAGAL 373

Query: 363 QSEI 366
            +E+
Sbjct: 374 SAEL 377


>gi|292489129|ref|YP_003532016.1| flagellar P-ring protein [Erwinia amylovora CFBP1430]
 gi|291554563|emb|CBA22173.1| Flagellar P-ring protein precursor [Erwinia amylovora CFBP1430]
 gi|312173287|emb|CBX81542.1| Flagellar P-ring protein precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 374

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 151/377 (40%), Positives = 225/377 (59%), Gaps = 20/377 (5%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++  +  L+ SL+ +   +A    RI+D+ ++Q  R N L+GYGLVVGL GTGD    +P
Sbjct: 8   LLMSVGMLLCSLL-VALPNAACAERIRDLTTVQGVRPNTLMGYGLVVGLDGTGDQTMQAP 66

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KN+AAVMVTA LP F+ PG RID+ ++SLG+A SL
Sbjct: 67  FTGQSLNNMLSQLGITVPAGTNMQLKNIAAVMVTAELPAFSRPGDRIDIVVSSLGNAKSL 126

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L GAD  IYA+AQG+V++SG   +   S        GG+I  GA VERE+P
Sbjct: 127 RGGTLLMTPLKGADTQIYALAQGNVLISGAGAQAGGSRVQVNQLNGGRISGGATVEREVP 186

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT 239
             F     L LQL   DFS A +I+D IN     RFS   A   D+RTV++  PT+    
Sbjct: 187 NDFARQTALRLQLNETDFSLAQQISDAIN----RRFSGG-AVPEDARTVRLFGPTDGP-- 239

Query: 240 RLMSEVEMLTVETDTP-------ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
              S V  L    D P       A+VI+N RTG++V+  +V +    +++G LTV++ +N
Sbjct: 240 ---SRVRFLANIQDIPLHVAVQDAKVIVNSRTGSVVMNRHVTLESCAIAHGGLTVEVAQN 296

Query: 293 EQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIIS 351
             + QP+   + G TV      + V D+ G+   ++ + DLN+++  +N +G   + ++S
Sbjct: 297 NLISQPDTPLAGGETVVVPQAQISVRDSGGALQRVNSSADLNNVVRALNGLGATPNELMS 356

Query: 352 ILQGIKAAGALQSEIII 368
           ILQ +K+AG L++++ I
Sbjct: 357 ILQAMKSAGCLRAKLEI 373


>gi|293395587|ref|ZP_06639870.1| flagellar P-ring protein FlgI [Serratia odorifera DSM 4582]
 gi|291421906|gb|EFE95152.1| flagellar P-ring protein FlgI [Serratia odorifera DSM 4582]
          Length = 366

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 214/348 (61%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLG 83
           RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 22  RIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSLSNMLSQLGITVPPGTNMQ 81

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LPPFA  G  IDV ++S+G+A SLRGG L+MT L GAD  +YA+AQG+
Sbjct: 82  LKNVAAVMVTAKLPPFARSGQNIDVVVSSMGNAKSLRGGTLLMTPLKGADNQVYALAQGN 141

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+V G       SS       GG+I NGA++ERELP  F    ++ LQL + DF+ A +I
Sbjct: 142 VLVGGAGAAAGGSSVQVNQLNGGRISNGAVIERELPSTFGQGGEINLQLNDEDFTLAQQI 201

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVEMLTVETDT-PARVIIN 261
           +D IN       + P+    D+RTVKV  P  N    R +++++ + V      A+VIIN
Sbjct: 202 SDAINRQRGYGTATPL----DARTVKVLVPQGNSSQVRFLADIQNINVNVSAMDAKVIIN 257

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+   V +    V+ GNL+V +     V QPN     G TV   NT + +    
Sbjct: 258 SRTGSVVMNREVILDSCAVAQGNLSVVVDRQNTVSQPNTPFGGGQTVVTPNTQISMQQQG 317

Query: 322 GSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           GS   I+A  +LN++I  +N++G     ++SILQ +++AG L++++ I
Sbjct: 318 GSLQKINASANLNNVIRALNALGATPIDLMSILQAMQSAGCLRAKLDI 365


>gi|290474978|ref|YP_003467862.1| putative flagella basal body protein [Xenorhabdus bovienii SS-2004]
 gi|289174295|emb|CBJ81085.1| putative flagella basal body protein [Xenorhabdus bovienii SS-2004]
          Length = 372

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 146/348 (41%), Positives = 215/348 (61%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLG 83
           RI+D+V+++  RDN LIGYGLVVGL GTGD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 28  RIRDLVTIEGVRDNALIGYGLVVGLDGTGDQTMQTPFTTQSLSNMLSQLGITVPPGTNMQ 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LPPFA  G  IDV ++SLG+A SLRGG L+MT L G D  +YA+AQG+
Sbjct: 88  LKNVAAVMVTAKLPPFARSGQNIDVVVSSLGNAKSLRGGTLLMTPLKGIDNQVYALAQGN 147

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G  V    +S       GG+I NGA++ERELP +F     L LQL N DFS A +I
Sbjct: 148 ILVGGAGVSAGGNSIKINQLAGGRISNGAVIERELPTQFGQKGTLNLQLNNDDFSLAEQI 207

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVEMLTVETDT-PARVIIN 261
           +D +N        +  A   DSRTV++  P  N +  R +S+++ L +  D   A+VI N
Sbjct: 208 SDAVNRLQ----GKGTATPLDSRTVQLRLPRENSEQVRFLSQIQNLNIRVDAGDAKVIFN 263

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+  NV +    +++G+L+V +     V QPN   + G+TV   NT + + +  
Sbjct: 264 SRTGSVVMNRNVTLDSCAIAHGSLSVTVERQTAVNQPNTPLAGGNTVVTRNTGVGIQEQG 323

Query: 322 GSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           G+   ++A  +L  ++  +N +G     ++SILQ ++ AG L++++ I
Sbjct: 324 GALQQVNASANLTQVVRALNVLGATPTDLMSILQAMETAGCLRAKLEI 371


>gi|292900248|ref|YP_003539617.1| flagellar P-ring protein [Erwinia amylovora ATCC 49946]
 gi|291200096|emb|CBJ47222.1| flagellar P-ring protein [Erwinia amylovora ATCC 49946]
          Length = 373

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 151/377 (40%), Positives = 225/377 (59%), Gaps = 20/377 (5%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++  +  L+ SL+ +   +A    RI+D+ ++Q  R N L+GYGLVVGL GTGD    +P
Sbjct: 7   LLMSVGMLLCSLL-VALPNAACAERIRDLTTVQGVRPNTLMGYGLVVGLDGTGDQTMQAP 65

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KN+AAVMVTA LP F+ PG RID+ ++SLG+A SL
Sbjct: 66  FTGQSLNNMLSQLGITVPAGTNMQLKNIAAVMVTAELPAFSRPGDRIDIVVSSLGNAKSL 125

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L GAD  IYA+AQG+V++SG   +   S        GG+I  GA VERE+P
Sbjct: 126 RGGTLLMTPLKGADTQIYALAQGNVLISGAGAQAGGSRVQVNQLNGGRISGGATVEREVP 185

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT 239
             F     L LQL   DFS A +I+D IN     RFS   A   D+RTV++  PT+    
Sbjct: 186 NDFARQTALRLQLNETDFSLAQQISDAIN----RRFSGG-AVPEDARTVRLFGPTDGP-- 238

Query: 240 RLMSEVEMLTVETDTP-------ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
              S V  L    D P       A+VI+N RTG++V+  +V +    +++G LTV++ +N
Sbjct: 239 ---SRVRFLANIQDIPLHVAVQDAKVIVNSRTGSVVMNRHVTLESCAIAHGGLTVEVAQN 295

Query: 293 EQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIIS 351
             + QP+   + G TV      + V D+ G+   ++ + DLN+++  +N +G   + ++S
Sbjct: 296 NLISQPDTPLAGGETVVVPQAQISVRDSGGALQRVNSSADLNNVVRALNGLGATPNELMS 355

Query: 352 ILQGIKAAGALQSEIII 368
           ILQ +K+AG L++++ I
Sbjct: 356 ILQAMKSAGCLRAKLEI 372


>gi|227328342|ref|ZP_03832366.1| flagellar basal body P-ring protein [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 369

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 153/372 (41%), Positives = 223/372 (59%), Gaps = 10/372 (2%)

Query: 3   FRIA--FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
            RIA  F +   +    IS     RI+D+V++Q  R N LIGYGLVVGL G+GD    +P
Sbjct: 1   MRIASFFTVLLTLLTLNISPASAERIRDLVNIQGVRGNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  IDV ++SLG+A SL
Sbjct: 61  FTTQSLTNMLSQLGITVPAGTNMQLKNVAAVMVTAELPPFGRTGQNIDVVVSSLGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA++ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISNGAVIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
             F  S  ++LQL+N DFS A +++D IN       + P+    DSRT++V  P  N   
Sbjct: 181 STFGTSNTIMLQLKNDDFSMAQKVSDAINRSGYGGTATPL----DSRTIQVLAPHGNSSQ 236

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++V+ + V      A+VIIN RTG++V+  +V +    ++ GNL+V I +   V Q
Sbjct: 237 VRFLADVQNIEVNVGIQDAKVIINSRTGSVVMNRDVTLDSCAIAQGNLSVTINQQANVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGI 356
           PN     G TV    T++ V    G+   ++ + +LN+++  +NS+G     ++SILQ +
Sbjct: 297 PNTPFGGGQTVVTPQTEISVQQAGGALQRVNSSANLNNVVRALNSLGATPMELMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 QSAGCLRAKLEI 368


>gi|258625230|ref|ZP_05720142.1| Flagellar P-ring protein precursor [Vibrio mimicus VM603]
 gi|258582477|gb|EEW07314.1| Flagellar P-ring protein precursor [Vibrio mimicus VM603]
          Length = 378

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 156/375 (41%), Positives = 232/375 (61%), Gaps = 18/375 (4%)

Query: 3   FRIAFLIFSLIGLHEIS-AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           F  +FLI   +G    S A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      F
Sbjct: 12  FFSSFLIVLTLGFVPTSQAKVEIPIMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKF 70

Query: 62  TEQSMRSLLQNLGISTPGGRLGS-KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +DV ++S+GDA SLR
Sbjct: 71  TAQSITNMLRQFGVQIDDNMDPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLR 130

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YAVAQG+VVV GL  +G+S S +     T G+I NGA +ERE+ 
Sbjct: 131 GGTLLLTPLRGIDGELYAVAQGNVVVGGLSAEGKSGSKVAVNTPTAGRIPNGATLEREIS 190

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN---- 235
             F     + L LR P F+TA  IA +IN    N F   +A + +  ++ +  P +    
Sbjct: 191 TDFNKRDQITLNLRKPSFTTAKNIAQEIN----NTFGPNVAVSVNKTSINMRAPKDTQQR 246

Query: 236 IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
           +++  ++   EM  VE   PARV+ N RTGT+VIG NV++ +  VS+GNLTV+I+E++QV
Sbjct: 247 VEMMAMLE--EMSVVEGRKPARVVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESQQV 304

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISIL 353
            QPNAF+  G T T + T + VS+++    +I  P  +LN++++ +NS+G     ++SIL
Sbjct: 305 SQPNAFAG-GETETIDQTRIDVSEDQNRM-MIWPPGTELNTIVNAINSLGATPTDLMSIL 362

Query: 354 QGIKAAGALQSEIII 368
           Q +  AGAL +E+++
Sbjct: 363 QALYEAGALNAELVV 377


>gi|262173358|ref|ZP_06041035.1| flagellar P-ring protein FlgI [Vibrio mimicus MB-451]
 gi|261890716|gb|EEY36703.1| flagellar P-ring protein FlgI [Vibrio mimicus MB-451]
          Length = 373

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 156/375 (41%), Positives = 232/375 (61%), Gaps = 18/375 (4%)

Query: 3   FRIAFLIFSLIGLHEIS-AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           F  +FLI   +G    S A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      F
Sbjct: 7   FFSSFLIVLTLGFVPTSQAKVEIPIMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKF 65

Query: 62  TEQSMRSLLQNLGISTPGGRLGS-KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +DV ++S+GDA SLR
Sbjct: 66  TAQSITNMLRQFGVQIDDNMDPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YAVAQG+VVV GL  +G+S S +     T G+I NGA +ERE+ 
Sbjct: 126 GGTLLLTPLRGIDGELYAVAQGNVVVGGLSAEGKSGSKVAVNTPTAGRIPNGATLEREIS 185

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN---- 235
             F     + L LR P F+TA  IA +IN    N F   +A + +  ++ +  P +    
Sbjct: 186 TDFNKRDQITLNLRKPSFTTAKNIAQEIN----NTFGPNVAVSVNKTSINMRAPKDTQQR 241

Query: 236 IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
           +++  ++   EM  VE   PARV+ N RTGT+VIG NV++ +  VS+GNLTV+I+E++QV
Sbjct: 242 VEMMAMLE--EMSVVEGRKPARVVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESQQV 299

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISIL 353
            QPNAF+  G T T + T + VS+++    +I  P  +LN++++ +NS+G     ++SIL
Sbjct: 300 SQPNAFAG-GETETIDQTRIDVSEDQNRM-MIWPPGTELNTIVNAINSLGATPTDLMSIL 357

Query: 354 QGIKAAGALQSEIII 368
           Q +  AGAL +E+++
Sbjct: 358 QALYEAGALNAELVV 372


>gi|291613042|ref|YP_003523199.1| flagellar P-ring protein [Sideroxydans lithotrophicus ES-1]
 gi|291583154|gb|ADE10812.1| flagellar P-ring protein [Sideroxydans lithotrophicus ES-1]
          Length = 380

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 156/379 (41%), Positives = 221/379 (58%), Gaps = 17/379 (4%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +I  L F+L+ L  +SA    RIKD+ ++   R+NQLIGYGLVVGL G+GD    +PFT
Sbjct: 1   MKIRSLAFALLMLVSLSA-AAERIKDLATVLGVRENQLIGYGLVVGLDGSGDQTTQTPFT 59

Query: 63  EQSMRSLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+ ++L  +GI+  PG  L  KNVAAV VTA+LPPF+ PG  IDV+++S+G+A SLRG
Sbjct: 60  VQSIVTMLSQMGITLPPGTSLQLKNVAAVTVTASLPPFSRPGQTIDVTVSSIGNAKSLRG 119

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L GADG +YA+AQG+++VSG       S  +      G+I  GA VER +P  
Sbjct: 120 GTLLMTPLKGADGQVYAMAQGNMLVSGAGAAAGGSKTVVNHLDVGRIPGGATVERSVPTA 179

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLN------------RFSRPIAEAYDSRTVK 229
                 + L+L   DF+TA R+AD IN   L               + P A   D+RT++
Sbjct: 180 LGQGDYIYLELNTADFTTATRLADVINHEVLPVQDITAAASGVVPATVPAAAPVDARTIQ 239

Query: 230 VSKPTNIDLTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQ 288
           V  P        +S +E L V      A+VIIN RTG++V+  +V +    V++GNLTV 
Sbjct: 240 VKAPEGSARVAFISRIENLEVNAAAGSAKVIINARTGSVVMNQHVSLDDCAVAHGNLTVV 299

Query: 289 ITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTD 347
           I     V QP    S G T   +N  +++  +KG+   L    DLN ++  +NSIG    
Sbjct: 300 INSENTVSQPAPL-SQGQTAGVSNASIEIKADKGNLLHLKSGVDLNDVVKALNSIGATPQ 358

Query: 348 GIISILQGIKAAGALQSEI 366
            +++ILQ +KAAGAL++E+
Sbjct: 359 DMLAILQAMKAAGALRAEL 377


>gi|268589978|ref|ZP_06124199.1| flagellar P-ring protein FlgI [Providencia rettgeri DSM 1131]
 gi|291314695|gb|EFE55148.1| flagellar P-ring protein FlgI [Providencia rettgeri DSM 1131]
          Length = 367

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 153/366 (41%), Positives = 216/366 (59%), Gaps = 15/366 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           F  F+     E       RIKD+ ++Q  RDN LIGYGLVVGL GTGD    +PFT QS+
Sbjct: 12  FFCFTYSAYSE-------RIKDLTTVQGVRDNALIGYGLVVGLDGTGDQTMQTPFTTQSL 64

Query: 67  RSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++L  +GI+ P G  +  KNVAAVMVTA LPPFA  G  +D+ ++S+G+A SLRGG L+
Sbjct: 65  NNMLSQMGITVPPGTNMQLKNVAAVMVTAKLPPFARTGQSVDIVVSSMGNAKSLRGGTLL 124

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MT L G DG IYA+AQG+++V G    G  SS       GG+I  GA +ERELP  F  +
Sbjct: 125 MTPLKGVDGQIYAMAQGNILVGGAGASGGGSSIKVNQLNGGRITGGATIERELPSSFGQN 184

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSE 244
             + LQL    F+ A  IAD IN           A A DSRTV++  P  N D  R ++ 
Sbjct: 185 GAINLQLNEDSFTLAQDIADAINRMG----GMGTASALDSRTVQLLVPANNRDQVRFLAR 240

Query: 245 VEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           V+ L V      A+VI+N RTG++VI  +V +    V++G+L V +    QV QP+   +
Sbjct: 241 VQELNVRAPVAEAKVILNSRTGSVVINRSVTLDSCAVAHGSLAVTVERQTQVSQPDTPFA 300

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G TV   NT++ V D  G+   ++A   LN +I  +N++G   + ++SILQ +++AG L
Sbjct: 301 GGQTVVTRNTNVGVRDQGGALQKVNASVQLNQVIQALNTLGATPNDLMSILQAMESAGCL 360

Query: 363 QSEIII 368
           ++++ I
Sbjct: 361 RAKLEI 366


>gi|308050368|ref|YP_003913934.1| flagellar P-ring protein [Ferrimonas balearica DSM 9799]
 gi|307632558|gb|ADN76860.1| flagellar P-ring protein [Ferrimonas balearica DSM 9799]
          Length = 361

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 149/354 (42%), Positives = 210/354 (59%), Gaps = 12/354 (3%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           SAQ + R+KD+  +Q  R NQL+GYGLVVGL GTG+  R   +TEQS  ++L N GI+ P
Sbjct: 15  SAQAM-RLKDISDVQGVRSNQLVGYGLVVGLPGTGEQSR---YTEQSFTTMLSNFGINLP 70

Query: 79  G-GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
              R   KNVAAV V A LPPF  PG  ID++++S+G A SLRGG L+ T L GADG +Y
Sbjct: 71  ANARPKLKNVAAVAVHAELPPFIKPGQSIDITVSSVGSAKSLRGGTLLQTFLKGADGKVY 130

Query: 138 AVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           A+AQGS+VVSG   +G   S  ++   T G+I  GA VER +P  F +   L   L  PD
Sbjct: 131 ALAQGSLVVSGFSAEGLDGSKVLQNTPTVGRIPGGATVERSVPTPFANGDFLTFNLHRPD 190

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDT 254
           FSTA R+ + +N          +A A D+ +V+VS P +       ++ +E L V+  D 
Sbjct: 191 FSTAKRVVEAVNGL----LGPGVARALDATSVQVSAPRDPSQRVSYLATLENLQVQPADE 246

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A+VI+N RTGTIV+G +VR+    +++G LTV I+EN  V QPNAF    + VT  +  
Sbjct: 247 SAKVIVNSRTGTIVVGKDVRLMPTAITHGGLTVTISENINVSQPNAFGGGNTVVTPESQI 306

Query: 315 LKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
               D+   F       L+ L+  +N +G     +++IL+ +  AGAL+ E++I
Sbjct: 307 GVTQDDSRMFKFDTGTTLDELVRAVNEVGAAPSDLMAILEALSQAGALRGELVI 360


>gi|194365676|ref|YP_002028286.1| flagellar basal body P-ring protein [Stenotrophomonas maltophilia
           R551-3]
 gi|194348480|gb|ACF51603.1| flagellar P-ring protein [Stenotrophomonas maltophilia R551-3]
          Length = 376

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 147/367 (40%), Positives = 215/367 (58%), Gaps = 8/367 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           R A  I +L+ L   +     RIKD+  +   R N L+GYGLVVGL G+GD    +PFT 
Sbjct: 11  RRAASIVALMLLIVAAPASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTV 70

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS+++LL  LG++ P       KNVAAV + A LPPFA PG  ID++++S+G+A SLRGG
Sbjct: 71  QSLKNLLGELGVNVPANVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIGNAVSLRGG 130

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKK 181
            L+M  L GADG IYA+AQG+++V G   +G+  S +   + + G+I NGA VER LP  
Sbjct: 131 SLLMAPLRGADGQIYAIAQGNLIVGGFGAQGKDGSRVSVNVPSVGRIPNGATVERALPDP 190

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT-R 240
             +  D+ L L N DF+T  R+   +N    N F    A A D  TV V+ PT+      
Sbjct: 191 LANGGDITLNLHNNDFTTVSRMVAALN----NAFGEGAARAVDGVTVAVTAPTDPGARIG 246

Query: 241 LMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
           L++ +E L +   + PA+V++N RTGT+VIG  V++    +S+G+LTV I EN  V QPN
Sbjct: 247 LLARIENLELTPGSAPAKVVVNSRTGTVVIGQQVKVGPAAISHGSLTVTIQENTNVSQPN 306

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           A S   +  +  +T    +D    F       L+ ++  +N++G     +I+IL+ +K A
Sbjct: 307 ALSGGRTVASPQSTITATNDGSRMFKFSGGTTLDEIVHAVNAVGAAPGDLIAILEALKQA 366

Query: 360 GALQSEI 366
           GAL +E+
Sbjct: 367 GALSAEL 373


>gi|160896075|ref|YP_001561657.1| flagellar basal body P-ring protein [Delftia acidovorans SPH-1]
 gi|160361659|gb|ABX33272.1| flagellar P-ring protein [Delftia acidovorans SPH-1]
          Length = 382

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 143/350 (40%), Positives = 213/350 (60%), Gaps = 12/350 (3%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG---- 79
           +RIK+V ++Q  R NQL GYGLVVGL GTGD     P+T+Q++ + L+ +GIS P     
Sbjct: 35  TRIKEVAAIQGVRSNQLTGYGLVVGLDGTGDQTTQMPYTKQALANYLEQMGISLPATGNS 94

Query: 80  GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
           G+L  KNVAAV+VTA LP FA PG  IDV ++S+G+A SL+GG LV T L GADG IYA+
Sbjct: 95  GQLQLKNVAAVIVTAELPAFAQPGQAIDVVVSSVGNAKSLKGGTLVATPLRGADGEIYAL 154

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQG++VV G       S       + G++  GA VER +P    +   + L L   DF T
Sbjct: 155 AQGNLVVGGAGASAGGSKVQINHLSAGRVPQGAQVERAVPTPINEGDSITLGLNATDFQT 214

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-AR 257
           A ++   IN     R  + +A+A D RTV+VS P +     R+++E++ + +ET  P A+
Sbjct: 215 ADKVVRAIN----QRMGQGVAQALDGRTVRVSAPQDPGSRVRMIAEIQEMPIETSKPSAK 270

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           V+IN RTG+IV+   V +    +++GNL + I+    + QP AF S G TV    +D+++
Sbjct: 271 VVINARTGSIVLNQAVTLGPCAIAHGNLAITISTTPVISQPGAF-SQGQTVVAQKSDIQI 329

Query: 318 SDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
               G+  ++  +P L  ++  +N++G     +++ILQ IKAAGAL +E+
Sbjct: 330 KQEPGNIINMPGSPQLTDVVRALNTLGATPQDLLAILQAIKAAGALNAEL 379


>gi|227112525|ref|ZP_03826181.1| flagellar basal body P-ring protein [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 369

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 152/372 (40%), Positives = 223/372 (59%), Gaps = 10/372 (2%)

Query: 3   FRIA--FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
            RIA  F +   +    I+     RI+D+V++Q  R N LIGYGLVVGL G+GD    +P
Sbjct: 1   MRIASFFTVLLTLLTLNIAPASAERIRDLVNIQGVRGNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  IDV ++SLG+A SL
Sbjct: 61  FTTQSLTNMLSQLGITVPAGTNMQLKNVAAVMVTAELPPFGRTGQNIDVVVSSLGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA++ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISNGAVIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
             F  S  ++LQL+N DFS A +++D IN       + P+    DSRT++V  P  N   
Sbjct: 181 STFGTSNTIMLQLKNDDFSMAQKVSDAINRSGYGGTASPL----DSRTIQVLAPHGNSSQ 236

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++++ + V      A+VIIN RTG++V+  +V +    ++ GNL+V I +   V Q
Sbjct: 237 VRFLADIQNIEVNVGIQDAKVIINSRTGSVVMNRDVTLDSCAIAQGNLSVTINQQANVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGI 356
           PN     G TV    T++ V    GS   ++ + +LN+++  +NS+G     ++SILQ +
Sbjct: 297 PNTPFGGGQTVVTPQTEISVQQAGGSLQRVNSSANLNNVVRALNSLGATPMELMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 QSAGCLRAKLEI 368


>gi|188025867|ref|ZP_02960114.2| hypothetical protein PROSTU_02022 [Providencia stuartii ATCC 25827]
 gi|188020801|gb|EDU58841.1| hypothetical protein PROSTU_02022 [Providencia stuartii ATCC 25827]
          Length = 367

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 147/348 (42%), Positives = 215/348 (61%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLG 83
           RIKD+ ++Q  RDN LIGYGLVVGL GTGD    +PFT QS+ ++L  +GI+ P G  + 
Sbjct: 23  RIKDLTTVQGVRDNALIGYGLVVGLDGTGDQTMQTPFTTQSLSNMLSQMGITVPPGTNMQ 82

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LPPFA  G  +DV ++S+G+A SLRGG L+MT L G DG +YA+AQG+
Sbjct: 83  LKNVAAVMVTAKLPPFARAGQAVDVVVSSMGNAKSLRGGTLLMTPLKGVDGQVYAMAQGN 142

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       SS       GG+I  GA +ERELP  F  +  + LQL +  F+ A  I
Sbjct: 143 ILVGGAGASAGGSSIKVNQLAGGRITGGATIERELPTSFGQNGIINLQLNDDSFTLAQDI 202

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVEMLTVETD-TPARVIIN 261
           +D IN       + P+    DSRTV++  P  N D  R +++++ L V T    A+VI+N
Sbjct: 203 SDAINRLRGAGTATPL----DSRTVQLRVPMNNSDQVRFLAQIQELNVRTPIAEAKVILN 258

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++VI  +V +    V++G+L+V +    QV QPN   + G TV   NT++ V +  
Sbjct: 259 SRTGSVVINRSVTLESCAVAHGSLSVMVERQTQVSQPNTPFAGGQTVVTRNTNIGVREQG 318

Query: 322 GSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           G+   ++A   LN +I  +N++G     ++SILQ +++AG L++++ I
Sbjct: 319 GALQKVNASVQLNQVIQALNTLGATPTDLMSILQAMESAGCLRAKLEI 366


>gi|261344138|ref|ZP_05971782.1| flagellar P-ring protein FlgI [Providencia rustigianii DSM 4541]
 gi|282567730|gb|EFB73265.1| flagellar P-ring protein FlgI [Providencia rustigianii DSM 4541]
          Length = 371

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 150/368 (40%), Positives = 219/368 (59%), Gaps = 8/368 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           + F +  L+G   ++     R+KD+ ++Q  RDN LIGYGLVVGL GTGD    +PFT Q
Sbjct: 7   VLFSLCCLLGSLFVAPAYSERVKDLTTVQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQ 66

Query: 65  SMRSLLQNLGIST-PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           S+ ++L  +GI+  PG  +  KNVAAVMVTA +PPF   G  +D+ ++S+G+A SLRGG 
Sbjct: 67  SLNNMLSQMGITVPPGTNMQLKNVAAVMVTAKMPPFGRSGQSVDIVVSSMGNAKSLRGGT 126

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L+MT L G DG IYA+AQG+V+V G       SS       GG+I +GA +ERELP  F 
Sbjct: 127 LLMTPLKGVDGQIYAMAQGNVLVGGAGASAGGSSIKVNQLNGGRITDGATIERELPSSFG 186

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLM 242
            S  + LQL    F+ A  I D IN           A A DSRTV++  P  N +  R +
Sbjct: 187 QSGAINLQLNEDSFALAQDITDAINRMG----GMGTARALDSRTVQLLVPANNSEQVRFL 242

Query: 243 SEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S V+ L V T  T A+VI+N RTG++VI  +V +    V++G+L V +    QV QP+  
Sbjct: 243 SRVQELNVRTPMTEAKVILNSRTGSVVINRSVTLESCAVAHGSLAVTVERQTQVNQPDTP 302

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            + G TV   NT++ + +  G+   ++A   LN +I  +N++G     ++SILQ +++AG
Sbjct: 303 FAGGQTVVTRNTNVGMREQGGALQKVNASVQLNQVIQALNTLGATPTDLMSILQAMESAG 362

Query: 361 ALQSEIII 368
            L++++ I
Sbjct: 363 CLRAKLEI 370


>gi|146281775|ref|YP_001171928.1| flagellar basal body P-ring protein [Pseudomonas stutzeri A1501]
 gi|145569980|gb|ABP79086.1| flagellar P-ring protein precursor FlgI [Pseudomonas stutzeri
           A1501]
          Length = 366

 Score =  251 bits (642), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 151/350 (43%), Positives = 210/350 (60%), Gaps = 12/350 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLG 83
           R+KDV ++   R NQLIGYGLVVGL G+GD    +PFT Q+  ++L   GI  P GG + 
Sbjct: 22  RLKDVATIHGVRANQLIGYGLVVGLNGSGDQTTQTPFTVQTFNNMLAQFGIKVPSGGNIQ 81

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV + A LPPFA PG  ID++++S+G+A SLRGG L+M  L G DGN+YAVAQG+
Sbjct: 82  LKNVAAVSIHAELPPFAKPGQTIDITVSSIGNAKSLRGGSLLMAPLKGIDGNVYAVAQGN 141

Query: 144 VVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G    G   S +   S + G+I  GA VER +P  F     L L L  PDF+TA  
Sbjct: 142 LVVGGFDAGGADGSRVTVNSPSAGRIPGGATVERPVPSGFNQGNTLTLNLNRPDFTTAKN 201

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR---LMSEVEMLTVETDTP-ARV 258
           I DQIN          +A+A D  ++ V+ P  +D ++    +S +E L VE     A+V
Sbjct: 202 IVDQINEL----LGPGVAQALDGGSISVTAP--LDPSQRVDYLSILENLEVEVGQAVAKV 255

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           IIN RTGTIVIG NVR+    V++G+LTV I+E+ QV QP  FS   + V  N+      
Sbjct: 256 IINSRTGTIVIGQNVRVQPAAVTHGSLTVTISEDPQVSQPGPFSGGQTVVVPNSRVTAEQ 315

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 316 EAKPMFKFGPGTTLDEIVRAVNQVGAAPSDLMAILEALKQAGALQADLIV 365


>gi|58582200|ref|YP_201216.1| flagellar basal body P-ring protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624092|ref|YP_451464.1| flagellar basal body P-ring protein [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188576760|ref|YP_001913689.1| flagellar basal body P-ring protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576952|ref|YP_001913881.1| flagellar basal body P-ring protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|75435188|sp|Q5GZP0|FLGI_XANOR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|124021078|sp|Q2P2N7|FLGI_XANOM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|58426794|gb|AAW75831.1| flagellar protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368032|dbj|BAE69190.1| flagellar protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188521212|gb|ACD59157.1| flagellar P-ring protein FlgI [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521404|gb|ACD59349.1| flagellar P-ring protein FlgI [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 372

 Score =  251 bits (642), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 152/373 (40%), Positives = 221/373 (59%), Gaps = 20/373 (5%)

Query: 3   FRI-AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           FR+ A L+ + + +   SA+   RIKD+  +   R N L+GYGLVVGL G+GD    +PF
Sbjct: 8   FRLLATLLGACVVVAPASAE---RIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPF 64

Query: 62  TEQSMRSLLQNLGISTPGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           T QS+++LL  LG++ P     +L  KNVAAV + A LPPFA PG  ID++++S+ +A S
Sbjct: 65  TVQSLKNLLGELGVNVPANVNPQL--KNVAAVAIHAELPPFAKPGQPIDITVSSIANAVS 122

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERE 177
           LRGG L+M  L GADG +YA+AQG++VV G   +G+  S +   + + G+I NGAIVER 
Sbjct: 123 LRGGSLLMAPLKGADGQVYAMAQGNLVVGGFGAQGKDGSRVSVNVPSVGRIPNGAIVERA 182

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-- 235
           LP  F  + ++ L L   DF+T  R+   I+S     F    A A D  TV V  PT+  
Sbjct: 183 LPDVFAGTGEITLNLHQNDFTTVSRMVAAIDS----SFGAGTARAVDGVTVAVRSPTDPG 238

Query: 236 --IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENE 293
             I L   +  VE+     D PA+V++N RTGT+VIG  VR+    +++G+LTV I+EN 
Sbjct: 239 ARIGLLSRLENVEL--SPGDAPAKVVVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENT 296

Query: 294 QVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISIL 353
            V QP AFS   + VTQ +T    S+    F       L+ ++  +N +G     +++IL
Sbjct: 297 NVSQPGAFSGGRTAVTQQSTITATSEGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAIL 356

Query: 354 QGIKAAGALQSEI 366
           + +K AGAL +E+
Sbjct: 357 EALKQAGALSAEL 369


>gi|89902481|ref|YP_524952.1| flagellar basal body P-ring protein [Rhodoferax ferrireducens T118]
 gi|123091072|sp|Q21S32|FLGI_RHOFD RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|89347218|gb|ABD71421.1| flagellar P-ring protein [Rhodoferax ferrireducens T118]
          Length = 381

 Score =  251 bits (642), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 149/366 (40%), Positives = 219/366 (59%), Gaps = 13/366 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            LI SL+G     A   SRIK+V +++  R NQL G+GLVVGL GTGD     P+T Q +
Sbjct: 20  CLIASLLGAGTAQA---SRIKEVAAVEGVRSNQLTGFGLVVGLDGTGDQTTQMPYTAQGL 76

Query: 67  RSLLQNLGISTPGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
            + LQ LGI+ P     +L  KNVAAV+VTA LP FA PG  IDV+++S+G+A SL+GG 
Sbjct: 77  TNYLQQLGITLPEAQVSKLQLKNVAAVLVTAALPAFARPGQAIDVNVSSMGNAKSLKGGT 136

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L+ T L GADG +YA+AQGS+VV+G       S       + G+I  GA VER +P    
Sbjct: 137 LITTPLKGADGEVYALAQGSLVVAGAGAAAGGSKVQINHLSAGRIPGGAQVERIVPTPLL 196

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLM 242
           + A + L L+  DF TA R+A+ IN     RF    A A D RT+ V+ P+  +     +
Sbjct: 197 EGASITLGLQASDFQTARRVAEAIN----RRFGAHSARALDGRTIDVTAPSESNARVSFI 252

Query: 243 SEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           +E+E L +E+  P A+V+IN RTG+IV+   V + +  +++GNL+V I+    + QPN  
Sbjct: 253 AEMEELQLESSIPSAKVVINSRTGSIVMNQAVTLGECAIAHGNLSVSISTTPVISQPNPL 312

Query: 302 SSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           S+ G TV    +++++    G    L  +  L+ ++  +N++G     +++ILQ IKAAG
Sbjct: 313 STGGKTVVAEKSNIQIRQEPGMLIQLPKSTQLSDVVRALNALGATPQDLLAILQAIKAAG 372

Query: 361 ALQSEI 366
           AL +E+
Sbjct: 373 ALNAEL 378


>gi|149189840|ref|ZP_01868120.1| flagellar P-ring protein precursor I [Vibrio shilonii AK1]
 gi|148836326|gb|EDL53283.1| flagellar P-ring protein precursor I [Vibrio shilonii AK1]
          Length = 373

 Score =  251 bits (642), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 151/375 (40%), Positives = 228/375 (60%), Gaps = 19/375 (5%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           F    L F+L  +    A+V   I D+V +Q  R NQL+GYGLVVGL G GD      FT
Sbjct: 8   FTSILLAFALGMMSSARAEVEIPIMDLVDVQGVRTNQLVGYGLVVGLDGQGDR-NQVKFT 66

Query: 63  EQSMRSLLQNLGI-----STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
            QS+ ++L+  G+     + P  R    NVA+V VTA++ P A PG  +D+ ++S+GDA 
Sbjct: 67  AQSITNMLRQFGVQIGDDANPKLR----NVASVSVTASVDPMAGPGQMLDIVVSSIGDAK 122

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVER 176
           SLRGG L++T L G DG +YAVAQG+VVV G+  +G+S S +     T G++ NGA +ER
Sbjct: 123 SLRGGTLLLTPLRGVDGEVYAVAQGNVVVGGVSAEGRSGSKIAVNTPTAGRVPNGATLER 182

Query: 177 ELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP--T 234
           E+P  F   + + L LR   F+TA  IA +IN      F   +A A +   V +  P  T
Sbjct: 183 EIPSDFNSRSQITLNLRKASFTTAKNIAREINGT----FGPDVAIAINKVRVDMRAPKDT 238

Query: 235 NIDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQ 294
              +T +    EM  VE   PAR++ N RTGT+V+G NV++++  VS+GNLTV ITE++Q
Sbjct: 239 QQRVTMMSMLEEMSVVEGRKPARIVFNSRTGTVVVGQNVKVTEAAVSHGNLTVSITESQQ 298

Query: 295 VVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISIL 353
           V QPNAF ++G TV  + + + +S+++    +  +  +LN++++ +NS+G     ++SIL
Sbjct: 299 VSQPNAF-ADGDTVVVDQSKIDISEDQAQMVIWPEGTELNTIVNAVNSLGATPTDLMSIL 357

Query: 354 QGIKAAGALQSEIII 368
           Q +  AGAL +E+++
Sbjct: 358 QALHEAGALNAELVV 372


>gi|86146151|ref|ZP_01064477.1| flagellar P-ring protein precursor [Vibrio sp. MED222]
 gi|218708808|ref|YP_002416429.1| flagellar basal body P-ring protein [Vibrio splendidus LGP32]
 gi|254789300|sp|B7VKM6|FLGI_VIBSL RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|85836098|gb|EAQ54230.1| flagellar P-ring protein precursor [Vibrio sp. MED222]
 gi|218321827|emb|CAV17798.1| Flagellar P-ring protein precursor [Vibrio splendidus LGP32]
          Length = 363

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 149/370 (40%), Positives = 226/370 (61%), Gaps = 15/370 (4%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           ++  ++F ++ L   S+   +RIKDV  +   R NQL+GYGLV GL GTG++   +PFT+
Sbjct: 3   KLTLVLFGMLFLA--SSAHAARIKDVAKVAGVRSNQLVGYGLVTGLPGTGET---TPFTD 57

Query: 64  QSMRSLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           Q+  ++LQN GI   PG +  +KNVAAV+VTA LP F+  G  +DV+++S+G A SLRGG
Sbjct: 58  QTFNAMLQNFGIQLPPGTKPKTKNVAAVIVTAELPAFSKQGQEVDVTVSSIGSAKSLRGG 117

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTG-GKIVNGAIVERELPKK 181
            L+ T L G DG +YAVAQG++VVSG   +G   S + G +   G I +GA VE+E+P  
Sbjct: 118 TLLQTFLKGLDGQVYAVAQGNLVVSGFSAQGNDGSKLVGNNPNVGIISSGATVEQEIPTP 177

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F     +   L   DF+TA R+AD +N++        +A A D+ +VKV  P  I     
Sbjct: 178 FGRGDYITFNLIQSDFTTAQRLADAVNNF----LGPQMASAVDATSVKVRAPREISQRVA 233

Query: 241 LMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +S +E +  +  +  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN
Sbjct: 234 FLSAIENIEFDPAEGSAKIIVNSRTGTIVVGKHVRLKAAAVTHGGMTVAIKENLNVSQPN 293

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           AF S G TV   ++D++V++  G  F       L+ L+  +N +G     +++ILQ +K 
Sbjct: 294 AF-SGGQTVVVPDSDIEVTEADGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQ 352

Query: 359 AGALQSEIII 368
           AGA++ ++II
Sbjct: 353 AGAIEGQLII 362


>gi|187478189|ref|YP_786213.1| flagellar basal body P-ring protein [Bordetella avium 197N]
 gi|114151666|sp|Q2L1B1|FLGI_BORA1 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|115422775|emb|CAJ49303.1| flagellar P-ring protein [Bordetella avium 197N]
          Length = 376

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 148/349 (42%), Positives = 215/349 (61%), Gaps = 10/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           R+KD+ + Q  R NQLIGYGLVVGL GTGD +R +PFT+QS+ ++L  LGI+ P G  + 
Sbjct: 32  RLKDLATFQGVRGNQLIGYGLVVGLDGTGDQVRQTPFTQQSLTNMLSQLGITVPAGSNMQ 91

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LP FA PG  +DV ++S+G+A SLRGG L+MT L GAD ++YA+AQG+
Sbjct: 92  LKNVAAVMVTATLPAFARPGQTVDVVVSSMGNAKSLRGGTLLMTPLKGADNSVYAIAQGN 151

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+V G       SS       GG+I  GAIVER +P  F     + L++ N DF T    
Sbjct: 152 VLVGGAGASAGGSSVQINTLNGGRISAGAIVERPVPTSFAQDGLVYLEMNNSDFGTTQNA 211

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP--ARVII 260
           A+ IN     +F    A   D+R +++  P +   +   +S++E L V T  P  A+VII
Sbjct: 212 ANAIN----RQFGAGTAMVMDARVLQLRGPLDPSQMPAFLSQIENLPV-TLAPAVAKVII 266

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG++V+   V I +  V++GNL+V I    QV QP+   ++G TV   NT ++V   
Sbjct: 267 NARTGSVVMNRTVTIEEAAVAHGNLSVIINRQNQVFQPDTPFTDGQTVVAPNTQIEVRQE 326

Query: 321 KGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G+   +  + +L  ++  +N++G     +++ILQ +KAAGAL++E+ I
Sbjct: 327 GGALQRVRTSANLADVVKALNALGATPQDLLAILQAMKAAGALRAELEI 375


>gi|322435949|ref|YP_004218161.1| flagellar P-ring protein [Acidobacterium sp. MP5ACTX9]
 gi|321163676|gb|ADW69381.1| flagellar P-ring protein [Acidobacterium sp. MP5ACTX9]
          Length = 398

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 141/344 (40%), Positives = 212/344 (61%), Gaps = 7/344 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +R+KD+ S++  RDNQL+GYGLVVGL GTGDS +++ F  Q++ ++L  +G+S P   + 
Sbjct: 58  ARVKDIASIEGIRDNQLVGYGLVVGLNGTGDSQQTT-FPTQTLSAILLRMGVSVPASAIK 116

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            +N+AAV V A+LPPFA PG+++D++++S GDA SL GG+L+MT L GADG IYA AQG 
Sbjct: 117 VQNLAAVFVAASLPPFARPGTKLDITVSSAGDARSLEGGLLLMTPLYGADGKIYAQAQGP 176

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           +V+ G  V    S+      T  ++  GA  ER +  + +      + L + DF +A  +
Sbjct: 177 LVLGGYSVTANGSTKSLNHPTTARVPFGATAERGVALELEGRRQFSILLNDEDFHSAEAM 236

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
           A+ IN       +RP+A+AYDSR V+++ P   D+  L+S VE + V     A+VI+NER
Sbjct: 237 AEAIN----KDLARPLAKAYDSRRVELAVPAGEDVPMLLSRVEAVQVSLYPRAKVIVNER 292

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TGT+VIG  V +  V + +G L V +  +  V QP  F SNG+T T   T ++  D   S
Sbjct: 293 TGTVVIGGTVVLQPVSILHGGLAVNVVTDFNVSQPGPF-SNGTTTTVPVTRIEAHDKPVS 351

Query: 324 -FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              L     ++ L+  + +IG     +ISILQ +K+AGAL++EI
Sbjct: 352 RIELKQGATVDDLVRSLQTIGASARDVISILQAMKSAGALEAEI 395


>gi|310764856|gb|ADP09806.1| Flagellar P-ring protein precursor [Erwinia sp. Ejp617]
          Length = 374

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 148/353 (41%), Positives = 215/353 (60%), Gaps = 19/353 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RI+D+ S+Q  R N L+GYGLVVGL GTGD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 31  RIRDLTSVQGVRPNTLMGYGLVVGLDGTGDQTMQAPFTGQSLNNMLSQLGITVPAGTNMQ 90

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KN+AAVMVTA LP F+ PG RID+ ++SLG+A SLRGG L+MT L GAD  IYA+AQG+
Sbjct: 91  LKNIAAVMVTAELPAFSRPGDRIDIVVSSLGNAKSLRGGTLLMTPLKGADTQIYALAQGN 150

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V++SG   +   S        GG+I  GA VERE+P  F     L LQL   DFS A +I
Sbjct: 151 VLISGAGAQAGGSRVQVNQLNGGRISGGATVEREVPNDFAKQTALRLQLNETDFSLAQQI 210

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTP-------A 256
           +D IN     RFS   A   D+RTV++  PT+       S V  L    D P       A
Sbjct: 211 SDAIN----RRFSGG-AVPEDARTVRLFGPTDGP-----SRVRFLANIQDIPLHVAVQDA 260

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +VI+N RTG++V+  +V +    +++G LTV++++N  + QP+   + G TV      + 
Sbjct: 261 KVIVNSRTGSVVMNRHVTLESCAIAHGGLTVEVSQNNLISQPDTPLAGGETVVVPQAQIS 320

Query: 317 VSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           V D+ G+   ++ + DLN+++  +N +G   + ++SILQ +K+AG L++++ I
Sbjct: 321 VRDSGGALQRVNSSADLNNVVRALNGLGATPNELMSILQAMKSAGCLRAKLEI 373


>gi|237653579|ref|YP_002889893.1| flagellar basal body P-ring protein [Thauera sp. MZ1T]
 gi|237624826|gb|ACR01516.1| flagellar P-ring protein [Thauera sp. MZ1T]
          Length = 374

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 223/372 (59%), Gaps = 13/372 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVS-RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           ++ R A +  +++ LH   A   + RIKD+ S+   RDNQL+GYGLVVGL G+GD    +
Sbjct: 7   LLLRAAVVSLAVLILHPAQAYAAAERIKDLASVAGVRDNQLVGYGLVVGLDGSGDQTTQT 66

Query: 60  PFTEQSMRSLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           PFT QS+ ++L NLG+S  PG  L  KNVAAVMVTANLP FA PG  IDV+++S+G+A S
Sbjct: 67  PFTVQSIVNMLGNLGVSLPPGTNLQLKNVAAVMVTANLPAFARPGQAIDVTVSSIGNAKS 126

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           LRGG LVMT L GADG +YA+AQG++ V G   +G  +S +    + G+I  GA VER +
Sbjct: 127 LRGGTLVMTPLKGADGQVYAIAQGNMAVGGAGAQGGGASLVINHLSAGRIPGGATVERAV 186

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRP-IAEAYDSRTVKVSKPTNID 237
           P        ++ +L + DF TA R+ D IN         P  A A D R+++V  PT+  
Sbjct: 187 PTALGQGDAVLFELNDADFGTARRVVDAIN------LVYPGAASALDGRSIQVRAPTDSS 240

Query: 238 L-TRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                +  +E L V      A+VI+N RTG++V+   V +    V++GNLTV +    QV
Sbjct: 241 ARVAFLGHIENLEVTPVQQAAKVIVNSRTGSVVMNQRVTLQNCAVAHGNLTVTVNIETQV 300

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQ 354
            QP   S   + VTQ    + V+   G+ F++    +L  ++  +N++G K   ++SILQ
Sbjct: 301 SQPPPLSGGQTVVTQRG-QVDVAQEGGALFNVRGGANLADVVKALNTLGAKPMDLVSILQ 359

Query: 355 GIKAAGALQSEI 366
            +KAAGAL++E+
Sbjct: 360 AMKAAGALRAEL 371


>gi|68164542|gb|AAY87271.1| predicted flagellar basal-body P-ring protein [uncultured bacterium
           BAC17H8]
          Length = 381

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 149/380 (39%), Positives = 237/380 (62%), Gaps = 25/380 (6%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           + + F  F++IG    ++ +  R+KD+ S+   R NQL+GYG+VVGL GTGD   SS  T
Sbjct: 12  WLVLFGCFAVIGS---ASALADRLKDMTSIAGVRSNQLVGYGVVVGLAGTGDG--SSGLT 66

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
            QS++S++   G+ T    L +KNVA+VMVTA +P F  PG R+D++++++G A SLRGG
Sbjct: 67  LQSLQSMVSQFGLVTDSANLNAKNVASVMVTAEMPAFMKPGQRLDITVSTIGGAKSLRGG 126

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKK 181
            L+MT +LGADG  YAVAQG++VV GL V G   SS +  I T G+I  GA +E+ +   
Sbjct: 127 TLLMTPMLGADGETYAVAQGNLVVGGLGVAGNDGSSVIVNIPTVGRIPRGASIEKMVDTP 186

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL 241
           F+ + +++L L   DFSTA+R+AD +N      F   +A   D+ T+KV  P  +D ++ 
Sbjct: 187 FQSNDNVLLNLHQSDFSTAMRVADAVNEV----FGPDVAVPLDASTIKVRAP--VDPSQK 240

Query: 242 MSEVEML---TVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           +S V +L    VE   P A+VI+N RTGTIVIG +VR++  VV++G+LTV+I E+++V Q
Sbjct: 241 VSFVSLLENIEVEPARPSAKVIVNSRTGTIVIGGDVRVTPSVVTHGSLTVRINEDKEVTQ 300

Query: 298 PNAFSSN--------GSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDG 348
            N  + N        G     ++T++ +        + D   +L+ ++  +N++G     
Sbjct: 301 TNTITQNQQGAVVAPGQAQVNDDTEIVIEQEPARAFIFDPGVELSDVVDAVNAVGASPAD 360

Query: 349 IISILQGIKAAGALQSEIII 368
           +++IL+ ++ AG+L++EII+
Sbjct: 361 LVAILEALREAGSLRAEIIV 380


>gi|253688968|ref|YP_003018158.1| flagellar P-ring protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259645997|sp|C6D995|FLGI_PECCP RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|251755546|gb|ACT13622.1| flagellar P-ring protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 369

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 151/372 (40%), Positives = 223/372 (59%), Gaps = 10/372 (2%)

Query: 3   FRIA--FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
            RIA  F +   +    I+     RI+D+V++Q  R N LIGYGLVVGL G+GD    +P
Sbjct: 1   MRIASFFTVLLTLLTLNIAPASAERIRDLVNIQGVRGNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  IDV ++SLG+A SL
Sbjct: 61  FTTQSLTNMLSQLGITVPAGTNMQLKNVAAVMVTAELPPFGRAGQNIDVVVSSLGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA++ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISNGAVIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
             F  S  ++LQL+N DFS A +++D IN       + P+    DSRT++V  P  N   
Sbjct: 181 STFGASNTIMLQLKNDDFSMAQKVSDAINRSGYGGTATPL----DSRTIQVLAPHGNSSQ 236

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++V+ + V      A+V+IN RTG++V+  +V +    ++ GNL+V I +   V Q
Sbjct: 237 VRFLADVQNIEVNVGIQDAKVVINSRTGSVVMNRDVTLDSCAIAQGNLSVTINQQANVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGI 356
           PN     G TV    T++ V    G+   ++ + +LN+++  +NS+G     ++SILQ +
Sbjct: 297 PNTPFGGGQTVVTPQTEISVQQAGGALQRVNSSANLNNVVRALNSLGATPMELMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 QSAGCLRAKLEI 368


>gi|221199743|ref|ZP_03572786.1| flagellar P-ring protein FlgI [Burkholderia multivorans CGD2M]
 gi|221208652|ref|ZP_03581652.1| flagellar P-ring protein FlgI [Burkholderia multivorans CGD2]
 gi|221171463|gb|EEE03910.1| flagellar P-ring protein FlgI [Burkholderia multivorans CGD2]
 gi|221179982|gb|EEE12386.1| flagellar P-ring protein FlgI [Burkholderia multivorans CGD2M]
          Length = 394

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 150/377 (39%), Positives = 219/377 (58%), Gaps = 19/377 (5%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           A L+ ++ G     A    R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q+
Sbjct: 22  AGLLIAVAGALGAPAAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQT 81

Query: 66  MRSLLQNLGISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGD 115
           + ++L NLGIS   G           +  KNVAAVMVTA LPPFA PG  +DV+++SLG+
Sbjct: 82  LANMLANLGISINNGSANGGTSSLSNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGN 141

Query: 116 ASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVE 175
           A SLRGG L++T L GADG +YA+AQG++ V G       S         G+IV GAIVE
Sbjct: 142 AKSLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVE 201

Query: 176 RELPKKFKDSADLI-LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT 234
           R +P        ++ LQL + D+ TA RI   +NS     F   +A A D RT++++ P 
Sbjct: 202 RSVPNALAQMNGMLQLQLNDMDYGTAQRIVAAVNS----SFGPGVATALDGRTIQLAAPA 257

Query: 235 N-IDLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
           +       M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +   
Sbjct: 258 DPAQQVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQ 317

Query: 293 EQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIIS 351
             V QP  F SNG TV    + +++  + G+  ++ A  +L  ++  +N++G     ++S
Sbjct: 318 PVVSQPGPF-SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMS 376

Query: 352 ILQGIKAAGALQSEIII 368
           ILQ +KAAGAL++++ I
Sbjct: 377 ILQAMKAAGALRADLEI 393


>gi|88858139|ref|ZP_01132781.1| flagellar P-ring protein precursor [Pseudoalteromonas tunicata D2]
 gi|88819756|gb|EAR29569.1| flagellar P-ring protein precursor [Pseudoalteromonas tunicata D2]
          Length = 364

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 148/355 (41%), Positives = 217/355 (61%), Gaps = 13/355 (3%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           +A V  RIKDV  ++  RDNQL+GYGLVVGL GTG+  R   FTEQ+ +++L   GI+ P
Sbjct: 17  TASVAERIKDVSMVEGVRDNQLVGYGLVVGLPGTGEQSR---FTEQTFKAMLSGFGIALP 73

Query: 79  GG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
              +   KNVAAV V A LPPF  PG  IDV+++S+G A SLRGG L+ T L G DGN+Y
Sbjct: 74  DNLKPKIKNVAAVAVHAKLPPFIKPGQTIDVTVSSIGSAGSLRGGTLLQTFLKGIDGNVY 133

Query: 138 AVAQGSVVVSGLFVK-GQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           A+AQGS++VSGL  + G  S  +    T G++ NGA VER +P  F     +   L  PD
Sbjct: 134 AIAQGSLIVSGLGAEGGDGSRILVNTPTVGRVPNGATVERAVPNPFSQGDFITFNLHRPD 193

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDT 254
           F+TA R+A+ IN    N      A A D+ +V+V  P ++      +S +E L  +  DT
Sbjct: 194 FTTAKRLAETIN----NLVGPNSASAQDAASVRVIAPRDVSQRVAYLSTLENLEFKPADT 249

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTV-TQNNT 313
            A++++N RTGTIVIG +V++    +++G LTV I EN+ V QPN  ++  +TV TQ+  
Sbjct: 250 SAKILVNSRTGTIVIGKDVKLQPAAITHGGLTVTIAENQDVSQPNPLATGDTTVTTQSII 309

Query: 314 DLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           D+   D++ +F       L+ L+  +N +G     +++IL+ +K AGA+  ++I+
Sbjct: 310 DVSRDDSR-AFVFNPGVSLDDLVRAINEVGAAPGDLMAILEALKEAGAISGQLIV 363


>gi|259907638|ref|YP_002647994.1| Flagellar P-ring protein 1, flgI [Erwinia pyrifoliae Ep1/96]
 gi|224963260|emb|CAX54744.1| Flagellar P-ring protein 1, flgI [Erwinia pyrifoliae Ep1/96]
          Length = 372

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 148/353 (41%), Positives = 214/353 (60%), Gaps = 19/353 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RI+D+ S+Q  R N L+GYGLVVGL GTGD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 29  RIRDLTSVQGVRANTLMGYGLVVGLDGTGDQTMQAPFTGQSLNNMLSQLGITVPAGTNMQ 88

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KN+AAVMVTA LP F+ PG RID+ ++SLG+A SLRGG L+MT L GAD  IYA+AQG+
Sbjct: 89  LKNIAAVMVTAELPAFSRPGDRIDIVVSSLGNAKSLRGGTLLMTPLKGADTQIYALAQGN 148

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V++SG   +   S        GG+I  GA VERE+P  F     L LQL   DFS A +I
Sbjct: 149 VLISGAGAQAGGSRVQVNQLNGGRISGGATVEREVPNDFAKQTALRLQLNETDFSLAQQI 208

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTP-------A 256
           +D IN     RFS   A   D+RTV++  PT+       S V  L    D P       A
Sbjct: 209 SDAIN----RRFSGG-AVPEDARTVRLFGPTDGP-----SRVRFLANIQDIPLHVAVQDA 258

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +VI+N RTG++V+  +V +    +++G LTV++ +N  + QP+   + G TV      + 
Sbjct: 259 KVIVNSRTGSVVMNRHVTLESCAIAHGGLTVEVAQNNLISQPDTPLAGGETVVVPQAQIS 318

Query: 317 VSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           V D+ G+   ++ + DLN+++  +N +G   + ++SILQ +K+AG L++++ I
Sbjct: 319 VRDSGGALQRVNSSADLNNVVRALNGLGATPNELMSILQAMKSAGCLRAKLEI 371


>gi|283477480|emb|CAY73396.1| Flagellar P-ring protein precursor [Erwinia pyrifoliae DSM 12163]
          Length = 374

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 148/353 (41%), Positives = 214/353 (60%), Gaps = 19/353 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RI+D+ S+Q  R N L+GYGLVVGL GTGD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 31  RIRDLTSVQGVRANTLMGYGLVVGLDGTGDQTMQAPFTGQSLNNMLSQLGITVPAGTNMQ 90

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KN+AAVMVTA LP F+ PG RID+ ++SLG+A SLRGG L+MT L GAD  IYA+AQG+
Sbjct: 91  LKNIAAVMVTAELPAFSRPGDRIDIVVSSLGNAKSLRGGTLLMTPLKGADTQIYALAQGN 150

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V++SG   +   S        GG+I  GA VERE+P  F     L LQL   DFS A +I
Sbjct: 151 VLISGAGAQAGGSRVQVNQLNGGRISGGATVEREVPNDFAKQTALRLQLNETDFSLAQQI 210

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTP-------A 256
           +D IN     RFS   A   D+RTV++  PT+       S V  L    D P       A
Sbjct: 211 SDAIN----RRFSGG-AVPEDARTVRLFGPTDGP-----SRVRFLANIQDIPLHVAVQDA 260

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +VI+N RTG++V+  +V +    +++G LTV++ +N  + QP+   + G TV      + 
Sbjct: 261 KVIVNSRTGSVVMNRHVTLESCAIAHGGLTVEVAQNNLISQPDTPLAGGETVVVPQAQIS 320

Query: 317 VSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           V D+ G+   ++ + DLN+++  +N +G   + ++SILQ +K+AG L++++ I
Sbjct: 321 VRDSGGALQRVNSSADLNNVVRALNGLGATPNELMSILQAMKSAGCLRAKLEI 373


>gi|46578931|ref|YP_009739.1| flagellar basal body P-ring protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603468|ref|YP_967868.1| flagellar basal body P-ring protein [Desulfovibrio vulgaris DP4]
 gi|46448343|gb|AAS94998.1| flagellar P-ring protein FlgI [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563697|gb|ABM29441.1| flagellar P-ring protein [Desulfovibrio vulgaris DP4]
 gi|311232789|gb|ADP85643.1| flagellar P-ring protein [Desulfovibrio vulgaris RCH1]
          Length = 378

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 153/344 (44%), Positives = 225/344 (65%), Gaps = 8/344 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+ +    RDNQL+GYGLVVGL GTGD  + S FT  SM ++L+ +G++    +L  
Sbjct: 38  RIKDIATFSGVRDNQLVGYGLVVGLGGTGDK-KESVFTVSSMVNMLERMGVAVDPKQLKP 96

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVA+VMVTA +P  A PG+R+DV+++S+GDA+SL GG+L+ T L G DG IY +AQGS+
Sbjct: 97  KNVASVMVTARMPVSAKPGARLDVTVSSMGDATSLLGGVLLQTPLKGVDGKIYGLAQGSL 156

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
            + G   +GQ++   + I+T G I  GAI+ER +P +F     L L L   DFSTA ++A
Sbjct: 157 ALGGFSAEGQAARAQKNITTVGLIPGGAIIERGVPFEFNQQDRLTLNLSTADFSTAQQVA 216

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIINE 262
           +++N+    R+    A A D+ TV +  P N   +L  LM+ VE + V  D PARV+++E
Sbjct: 217 ERLNAAMGGRY----ANAVDASTVAMDVPPNYRGNLVPLMASVENIEVAPDAPARVVVDE 272

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           +TGT+V+G +VRIS+V V++G+L V + E++QV QP  F S G TV    T++ V +   
Sbjct: 273 KTGTVVLGRDVRISRVAVAHGSLQVTVQESQQVSQPAPF-SQGQTVVTPQTNVNVREENR 331

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              +I+   L  L+ G+N+IG     +ISIL+ +KAAGAL +E+
Sbjct: 332 RLMMIEGATLQELVDGLNAIGATPRDLISILRAMKAAGALHAEL 375


>gi|90411009|ref|ZP_01219023.1| flagellar P-ring protein precursor [Photobacterium profundum 3TCK]
 gi|90328222|gb|EAS44533.1| flagellar P-ring protein precursor [Photobacterium profundum 3TCK]
          Length = 363

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 150/351 (42%), Positives = 212/351 (60%), Gaps = 17/351 (4%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+  +   R NQL+GYGLVVGL GTG++   +PFT+QS  ++LQN GI  P G +  
Sbjct: 22  RIKDISEVAGVRSNQLVGYGLVVGLPGTGET---TPFTDQSFNAMLQNFGIQLPAGTKPK 78

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KNVAAV V A LP F   G  ID++++S+G A SLRGG L+ T L G DG +YAVAQGS
Sbjct: 79  TKNVAAVAVNATLPAFTKQGQSIDITVSSIGSAKSLRGGTLLQTFLKGLDGKVYAVAQGS 138

Query: 144 VVVSGLFVKGQSSSFMEG-ISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G  V G   S + G I T G+I NGA+VE+E+P  F     L   L   DFSTA R
Sbjct: 139 LVVGGFSVTGADGSKLVGNIPTVGRISNGAMVEQEVPNPFGRGDFLTFNLFESDFSTAQR 198

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDT---PARV 258
           +AD +N +        +A A D+ +V+V  P ++      ++ VE   +E D     A++
Sbjct: 199 MADSVNEF----LGPQMAAAIDATSVRVRAPRDVSQRVAFLATVE--NIEFDPAVGAAKI 252

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           I+N RTGTIVIG NV++    +++G +TV I EN QV QP  F S G TV   N+++ V+
Sbjct: 253 IVNSRTGTIVIGQNVKLKPAAITHGGMTVSIKENYQVSQPAPF-SGGETVVVPNSEIDVT 311

Query: 319 DNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +     F       L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 312 EKDSRMFKFEPGITLDELVRAVNQVGAAPSDLMAILQALKQAGAIEGQLII 362


>gi|161526182|ref|YP_001581194.1| flagellar basal body P-ring protein [Burkholderia multivorans ATCC
           17616]
 gi|189349102|ref|YP_001944730.1| flagellar basal body P-ring protein [Burkholderia multivorans ATCC
           17616]
 gi|160343611|gb|ABX16697.1| flagellar P-ring protein [Burkholderia multivorans ATCC 17616]
 gi|189333124|dbj|BAG42194.1| flagellar P-ring protein precursor [Burkholderia multivorans ATCC
           17616]
          Length = 390

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 147/358 (41%), Positives = 212/358 (59%), Gaps = 19/358 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 37  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 96

Query: 81  ------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
                  +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SLRGG L++T L GADG
Sbjct: 97  GTSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSLRGGTLLLTPLKGADG 156

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLI-LQLR 193
            +YA+AQG++ V G       S         G+IV GAIVER +P        ++ LQL 
Sbjct: 157 QVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERSVPNALAQMNGMLQLQLN 216

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET 252
           + D+ TA RI   +NS     F   +A A D RT++++ P +       M+ ++ L V  
Sbjct: 217 DMDYGTAQRIVAAVNS----SFGPGVATALDGRTIQLAAPADPAQQVAFMARLQNLDVSP 272

Query: 253 D-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
           D   ARVI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV   
Sbjct: 273 DKAAARVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVAQ 331

Query: 312 NTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + +++  + G+  ++ A  +L  ++  +N++G     ++SILQ +KAAGAL++++ I
Sbjct: 332 QSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSILQAMKAAGALRADLEI 389


>gi|302878280|ref|YP_003846844.1| flagellar P-ring protein [Gallionella capsiferriformans ES-2]
 gi|302581069|gb|ADL55080.1| flagellar P-ring protein [Gallionella capsiferriformans ES-2]
          Length = 362

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 152/345 (44%), Positives = 214/345 (62%), Gaps = 8/345 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLG 83
           RIKDV S+Q  RDNQL+GYGLVVGL G+GD    +PFT QS+ S+L  +G++ P G  L 
Sbjct: 20  RIKDVASIQGVRDNQLLGYGLVVGLDGSGDQTTQTPFTVQSIISMLSQMGVNLPQGTSLQ 79

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA+LPPF+ PG  IDV+ +S+G+A SLRGG L+MT L GADG +YA+AQG+
Sbjct: 80  LKNVAAVMVTASLPPFSKPGQTIDVTASSMGNAKSLRGGTLLMTPLKGADGQVYAMAQGN 139

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+V G+      +S      + G++  GA VER +P        + L+LR+ DF+TA RI
Sbjct: 140 VLVGGVGASAGGASVQVNHLSVGRVPAGATVERAVPTLLGQGEFIHLELRSNDFTTATRI 199

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTV-ETDTPARVIINE 262
            D INS    + +  IA A D R ++V  P    L   +S +E L + +    A+VIIN 
Sbjct: 200 VDVINS----QIAPDIAVAQDGRMIEVRAPQGNGLVAFISRIENLEINQAQGIAKVIINA 255

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTG+IV+   V +    V++GNLTV I  +    QPNA  S+G TV  + T + V  +KG
Sbjct: 256 RTGSIVMNQAVTLDACAVAHGNLTVVINTDSTASQPNA-RSDGRTVVTDKTTIDVKSDKG 314

Query: 323 SF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
               L     L+ ++  +N+IG     +++ILQ +K++GAL +E+
Sbjct: 315 GLVELSKGVSLSEVVKALNAIGATPQDLLAILQAMKSSGALHAEL 359


>gi|300722677|ref|YP_003711967.1| putative flagella basal body protein [Xenorhabdus nematophila ATCC
           19061]
 gi|297629184|emb|CBJ89780.1| putative flagella basal body protein [Xenorhabdus nematophila ATCC
           19061]
          Length = 372

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 141/348 (40%), Positives = 217/348 (62%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RI+D+ +++  RDN LIGYGLVVGL GTGD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 28  RIRDLTTIEGVRDNALIGYGLVVGLDGTGDQTMQTPFTTQSLSNMLSQLGITVPSGTNMQ 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LPPFA  G  IDV ++SLG+A SLRGG L+MT L G D  +YA+AQG+
Sbjct: 88  LKNVAAVMVTAKLPPFARTGQNIDVVVSSLGNAKSLRGGTLLMTPLKGVDNQVYALAQGN 147

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       +S       GG+I NGA++ERELP +F     L LQL + DFS A +I
Sbjct: 148 ILVGGAGASAGGNSIKINQLAGGRISNGAVIERELPTQFGQKDTLNLQLNDDDFSLAQQI 207

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVEMLTVETDT-PARVIIN 261
           +D +N       + P+    DSRTV++  P  N +  + +S+V+ L +  D   A+VI N
Sbjct: 208 SDAVNRLKGTGTATPL----DSRTVQLRLPIENSEQVKFLSQVQNLVIRVDAGDAKVIFN 263

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+  NV +    +++G+L+V +     V QP+   + G+TV   NT++ + +  
Sbjct: 264 SRTGSVVMNRNVTLDSCAIAHGSLSVTVERQTAVNQPDTPLAGGNTVVTRNTNIGIQEQG 323

Query: 322 GSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           G+   ++A  +L  ++  +N++G     +++ILQ +++AG L++++ I
Sbjct: 324 GALQQVNASANLAQVVRALNALGATPTDLMTILQAMESAGCLRAKLEI 371


>gi|90112110|sp|Q7WJD1|FLGI_BORBR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|90112111|sp|Q7WA91|FLGI_BORPA RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 368

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 147/349 (42%), Positives = 212/349 (60%), Gaps = 8/349 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRL 82
            R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R +PFT+QS+ ++L  LGI+ P G  +
Sbjct: 23  ERLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTPFTQQSLTNMLSQLGITVPQGSNM 82

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAVMVTA LP FA PG  +DV ++S+G+A SLRGG L+MT L GAD  +YA+AQG
Sbjct: 83  QLKNVAAVMVTATLPSFARPGQTVDVVVSSMGNAKSLRGGTLLMTPLKGADNQVYAIAQG 142

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++V G       SS       GG+I NGAIVER +P  +     + L++ N DF T   
Sbjct: 143 NLLVGGAGASAGGSSVQINQLNGGRISNGAIVERAVPTMYAQDGTVYLEMNNTDFGTTQN 202

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT-RLMSEVEMLTV-ETDTPARVII 260
            A  IN     +F    A A D R ++V  P +  +    MS+VE L V      A+VII
Sbjct: 203 AAAAIN----RQFGAGTAMALDGRVIQVRGPLDPSMMPAFMSQVENLQVARAPATAKVII 258

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG++V+   V I +  V++GNL+V I    QV QP+   + G TV   NT ++V  +
Sbjct: 259 NARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVFQPDTPFTEGQTVVVPNTQIEVRQD 318

Query: 321 KGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G+   +  + +L  ++  +N++G     +++ILQ +K AGAL++++ I
Sbjct: 319 GGALQRVTTSANLADVVKALNALGATPQDLLAILQAMKTAGALRADLEI 367


>gi|33596143|ref|NP_883786.1| flagellar basal body P-ring protein [Bordetella parapertussis
           12822]
 gi|33601545|ref|NP_889105.1| flagellar basal body P-ring protein [Bordetella bronchiseptica
           RB50]
 gi|33573146|emb|CAE36794.1| flagellar P-ring protein precursor [Bordetella parapertussis]
 gi|33575981|emb|CAE33060.1| flagellar P-ring protein precursor [Bordetella bronchiseptica RB50]
          Length = 377

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 147/348 (42%), Positives = 212/348 (60%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLG 83
           R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R +PFT+QS+ ++L  LGI+ P G  + 
Sbjct: 33  RLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTPFTQQSLTNMLSQLGITVPQGSNMQ 92

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LP FA PG  +DV ++S+G+A SLRGG L+MT L GAD  +YA+AQG+
Sbjct: 93  LKNVAAVMVTATLPSFARPGQTVDVVVSSMGNAKSLRGGTLLMTPLKGADNQVYAIAQGN 152

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       SS       GG+I NGAIVER +P  +     + L++ N DF T    
Sbjct: 153 LLVGGAGASAGGSSVQINQLNGGRISNGAIVERAVPTMYAQDGTVYLEMNNTDFGTTQNA 212

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT-RLMSEVEMLTV-ETDTPARVIIN 261
           A  IN     +F    A A D R ++V  P +  +    MS+VE L V      A+VIIN
Sbjct: 213 AAAIN----RQFGAGTAMALDGRVIQVRGPLDPSMMPAFMSQVENLQVARAPATAKVIIN 268

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+   V I +  V++GNL+V I    QV QP+   + G TV   NT ++V  + 
Sbjct: 269 ARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVFQPDTPFTEGQTVVVPNTQIEVRQDG 328

Query: 322 GSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           G+   +  + +L  ++  +N++G     +++ILQ +K AGAL++++ I
Sbjct: 329 GALQRVTTSANLADVVKALNALGATPQDLLAILQAMKTAGALRADLEI 376


>gi|85701342|sp|Q72EQ3|FLGI_DESVH RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 366

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 153/344 (44%), Positives = 225/344 (65%), Gaps = 8/344 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+ +    RDNQL+GYGLVVGL GTGD  + S FT  SM ++L+ +G++    +L  
Sbjct: 26  RIKDIATFSGVRDNQLVGYGLVVGLGGTGDK-KESVFTVSSMVNMLERMGVAVDPKQLKP 84

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVA+VMVTA +P  A PG+R+DV+++S+GDA+SL GG+L+ T L G DG IY +AQGS+
Sbjct: 85  KNVASVMVTARMPVSAKPGARLDVTVSSMGDATSLLGGVLLQTPLKGVDGKIYGLAQGSL 144

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
            + G   +GQ++   + I+T G I  GAI+ER +P +F     L L L   DFSTA ++A
Sbjct: 145 ALGGFSAEGQAARAQKNITTVGLIPGGAIIERGVPFEFNQQDRLTLNLSTADFSTAQQVA 204

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIINE 262
           +++N+    R+    A A D+ TV +  P N   +L  LM+ VE + V  D PARV+++E
Sbjct: 205 ERLNAAMGGRY----ANAVDASTVAMDVPPNYRGNLVPLMASVENIEVAPDAPARVVVDE 260

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           +TGT+V+G +VRIS+V V++G+L V + E++QV QP  F S G TV    T++ V +   
Sbjct: 261 KTGTVVLGRDVRISRVAVAHGSLQVTVQESQQVSQPAPF-SQGQTVVTPQTNVNVREENR 319

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              +I+   L  L+ G+N+IG     +ISIL+ +KAAGAL +E+
Sbjct: 320 RLMMIEGATLQELVDGLNAIGATPRDLISILRAMKAAGALHAEL 363


>gi|288574700|ref|ZP_06393057.1| flagellar P-ring protein [Dethiosulfovibrio peptidovorans DSM
           11002]
 gi|288570441|gb|EFC91998.1| flagellar P-ring protein [Dethiosulfovibrio peptidovorans DSM
           11002]
          Length = 369

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 146/345 (42%), Positives = 215/345 (62%), Gaps = 12/345 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+  ++  R NQL G G+V+GLQGTGD    S  + Q +R+L++  G++     + S
Sbjct: 31  RIKDLADIEGVRSNQLSGVGVVMGLQGTGDK---SDMSIQVLRNLMRRFGVTLSDKDVKS 87

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVA V VTA LPPF  PG  +DV++++LGDA SL+GG+L+ T L  A+GN+YA AQG V
Sbjct: 88  KNVAMVAVTAELPPFVRPGQTVDVTVSTLGDAKSLQGGVLLQTPLKAANGNVYAAAQGPV 147

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +V G       SS  + + T G++  GAIVER++  +F     L L LRNPDF+T+ RIA
Sbjct: 148 LVGGFSAGRGGSSVTKNVVTVGRVNGGAIVERDVSTEFSYGGRLSLLLRNPDFTTSRRIA 207

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIINE 262
           D IN     +F   IA A D+  V++  P       +  ++++E + V  D  A+V++NE
Sbjct: 208 DAIN----RKFGS-IASALDAGRVQIQLPGAYMASPSAFIADMESMRVTPDMQAKVVVNE 262

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+V+G NV+IS V V++G+LTV+I +  QV QP  FS   +T   N+T ++  + +G
Sbjct: 263 RTGTVVMGGNVQISSVAVAHGDLTVRIDQENQVSQPEPFSGGVTTPYANDT-VQAEEKRG 321

Query: 323 SFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           SF  +DA   ++ L+  +N++G     +I ILQ I  AGAL  E+
Sbjct: 322 SFIKMDATTTVDQLVDAINAVGASPRDVIGILQAIDRAGALHGEL 366


>gi|50120643|ref|YP_049810.1| flagellar basal body P-ring protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|62286800|sp|Q6D6H2|FLGI_ERWCT RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|49611169|emb|CAG74615.1| flagellar P-ring protein precursor [Pectobacterium atrosepticum
           SCRI1043]
          Length = 369

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 150/372 (40%), Positives = 222/372 (59%), Gaps = 10/372 (2%)

Query: 3   FRIA--FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
            RIA  F +   +    I+     RI+D+V++Q  R N LIGYGLVVGL G+GD    +P
Sbjct: 1   MRIASFFTVLLTLLTLNITPASAERIRDLVNIQGVRGNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  ID+ ++SLG+A SL
Sbjct: 61  FTTQSLTNMLSQLGITVPAGTNMQLKNVAAVMVTAELPPFGRTGQNIDIVVSSLGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA++ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISNGAVIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
             F  S  ++LQL+N DFS A +++D IN       + P+    DSRT++V  P  N   
Sbjct: 181 STFGTSNTIMLQLKNDDFSMAQKVSDAINRSGYGGTASPL----DSRTIQVLAPHGNSSQ 236

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++V+ + V      A+V+IN RTG++V+  +V +    ++ GNL+V I +   V Q
Sbjct: 237 VRFLADVQNIEVNVGIQDAKVVINSRTGSVVMNRDVTLDSCAIAQGNLSVTINQQANVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGI 356
           PN     G TV    T++ V    G    ++ + +LN+++  +NS+G     ++SILQ +
Sbjct: 297 PNTPFGGGQTVVTPQTEISVQQTGGVLQRVNSSANLNNVVRALNSLGATPMELMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 QSAGCLRAKLEI 368


>gi|260767927|ref|ZP_05876861.1| flagellar P-ring protein FlgI [Vibrio furnissii CIP 102972]
 gi|260615957|gb|EEX41142.1| flagellar P-ring protein FlgI [Vibrio furnissii CIP 102972]
          Length = 373

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 150/356 (42%), Positives = 223/356 (62%), Gaps = 15/356 (4%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI---S 76
           A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      FT QS+ ++L+  G+    
Sbjct: 25  AEVEIPIMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKFTAQSITNMLRQFGVQIDE 83

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
           +   +L  +NVA+V VTA + P A PG  +++ ++S+GDA SLRGG L++T L G DG +
Sbjct: 84  STDPKL--RNVASVSVTATVDPMAGPGQTLNIVVSSIGDAKSLRGGTLLLTPLRGIDGEV 141

Query: 137 YAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           YAVAQG+VVV G+  +G+S S +     T G+I NGA +ERE+P  F D   + L LR P
Sbjct: 142 YAVAQGNVVVGGVSAEGRSGSKIAVNTPTSGRIPNGATLEREIPTDFNDRDTVTLNLREP 201

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTV-ETD 253
            F+TA  IA +IN    + F   +A A +   V++  P +      +MS +E ++V E  
Sbjct: 202 SFTTAKNIAREIN----DTFGPQVAVAINKGRVEMRAPKDTQQRVTMMSMLEEMSVMEGR 257

Query: 254 TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT-QNN 312
            PAR++ N RTGT+VIG NV++ +  VS+GNLTV ITE++QV QPNAF+S  + V  Q+ 
Sbjct: 258 KPARIVFNSRTGTVVIGKNVKVGQAAVSHGNLTVSITESQQVSQPNAFASGDTQVVDQSQ 317

Query: 313 TDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            D+   DN       +  +LN++++ +NS+G     ++SILQ +  AGAL +E+++
Sbjct: 318 IDIN-EDNAQMVIWPEGTELNTIVNAVNSLGATPTDLMSILQALHEAGALNAELVV 372


>gi|148976398|ref|ZP_01813104.1| flagellar P-ring protein precursor I [Vibrionales bacterium SWAT-3]
 gi|145964221|gb|EDK29477.1| flagellar P-ring protein precursor I [Vibrionales bacterium SWAT-3]
          Length = 363

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 148/370 (40%), Positives = 226/370 (61%), Gaps = 15/370 (4%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           ++  ++F ++ L   ++   +RIKDV  +   R NQL+GYGLV GL GTG++   +PFT+
Sbjct: 3   KLTLVLFGMLFLA--TSAHAARIKDVAKVAGVRSNQLVGYGLVTGLPGTGET---TPFTD 57

Query: 64  QSMRSLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           Q+  ++LQN GI   PG +  +KNVAAV+VTA LP F+  G  +DV+++S+G A SLRGG
Sbjct: 58  QTFNAMLQNFGIQLPPGTKPKTKNVAAVIVTAELPAFSKQGQEVDVTVSSIGSAKSLRGG 117

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTG-GKIVNGAIVERELPKK 181
            L+ T L G DG +YAVAQG++VVSG   +G   S + G +   G I +GA VE+E+P  
Sbjct: 118 TLLQTFLKGLDGQVYAVAQGNLVVSGFSAQGNDGSKIVGNNPNVGIISSGATVEQEIPTP 177

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F     +   L   DF+TA R+AD +N++        +A A D+ +VKV  P  I     
Sbjct: 178 FGRGDYITFNLIQSDFTTAQRMADAVNNF----LGPQMASAVDATSVKVRAPREISQRVA 233

Query: 241 LMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +S +E +  +  +  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN
Sbjct: 234 FLSAIENIEFDPAEGSAKIIVNSRTGTIVVGKHVRLKAAAVTHGGMTVAIKENLNVSQPN 293

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           AF S G TV   ++D++V++  G  F       L+ L+  +N +G     +++ILQ +K 
Sbjct: 294 AF-SGGQTVVVPDSDIEVTEADGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQ 352

Query: 359 AGALQSEIII 368
           AGA++ ++II
Sbjct: 353 AGAIEGQLII 362


>gi|119899023|ref|YP_934236.1| flagellar basal body P-ring protein [Azoarcus sp. BH72]
 gi|119671436|emb|CAL95349.1| flagellar P-ring protein precursor [Azoarcus sp. BH72]
          Length = 370

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 216/358 (60%), Gaps = 9/358 (2%)

Query: 13  IGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQN 72
           +G+   +     RIK++ S+   RDNQL+GYGLVVGL G+GD    +PFT QS+ ++L N
Sbjct: 15  VGMAVAAPASAERIKELASVAGVRDNQLVGYGLVVGLDGSGDQTTQTPFTVQSVINMLGN 74

Query: 73  LGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
           +G++  PG  L  KNVAAVMVTA LPPFA PG  +DV+++S+G+A SLRGG LVMT L G
Sbjct: 75  MGVTLPPGTNLQLKNVAAVMVTATLPPFARPGQAVDVTVSSMGNAKSLRGGTLVMTPLKG 134

Query: 132 ADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQ 191
           ADG IYA+AQG++VV G    G  +S      + G+I  GA VER +P        ++ +
Sbjct: 135 ADGQIYAIAQGNMVVGGAGASGGGASQTINHLSAGRIPGGATVERAVPTMLGQGDHILFE 194

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLMSEVEMLTV 250
           L + DF TA R+ D IN  +        AEA D RT++V  P +       + ++E L V
Sbjct: 195 LNDTDFGTARRVVDAINQSA----GHGSAEALDGRTIRVRAPADSSARVAFLGQLENLEV 250

Query: 251 -ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
                 A+VI+N RTG++V+   V +    V++GNLTV +  + +V QP   S  G TVT
Sbjct: 251 TPVQQAAKVIVNSRTGSVVMNQRVTVQNCAVAHGNLTVSVNTDTRVSQPAPLSG-GQTVT 309

Query: 310 QNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
             +  + +    G+ F++    +L  ++  +NS+G K   ++SILQ +KAAGAL++E+
Sbjct: 310 TQSGQVAIEQGAGTLFNVKAGANLADVVKALNSLGAKPMDLVSILQAMKAAGALRAEL 367


>gi|119477949|ref|ZP_01618049.1| flagellar P-ring protein precursor I [marine gamma proteobacterium
           HTCC2143]
 gi|119448862|gb|EAW30104.1| flagellar P-ring protein precursor I [marine gamma proteobacterium
           HTCC2143]
          Length = 403

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 149/350 (42%), Positives = 219/350 (62%), Gaps = 10/350 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RL 82
           +R+KD+ S+   RDN LIGYGLVVGL GTGD    +PFT QS RS+++ LG++ P G + 
Sbjct: 58  ARLKDIASVAGVRDNPLIGYGLVVGLDGTGDQTTQTPFTTQSFRSMMKQLGVAIPDGQKF 117

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAV + A LPPF+ PG  IDV+++S+G++ SLRGG L+M+ L GADG +YA+AQG
Sbjct: 118 QLKNVAAVTIHAVLPPFSKPGQPIDVTVSSIGNSKSLRGGSLLMSPLKGADGQVYAIAQG 177

Query: 143 SVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
            +VV G  V+G   S +   I + G+I NGAIVER++   F     L   L+  DF+TA 
Sbjct: 178 ELVVGGFGVEGSDGSKVTVNIPSAGRIPNGAIVERKISNSFSQGTSLTFNLKRSDFTTAR 237

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET-DTPARVI 259
           R+A+ IN          +A+A D+ ++ V+ P + D     MS +E + VE     AR++
Sbjct: 238 RVAESINEL----LGPDVAKAADATSINVTAPIDPDQRVSYMSLLENIEVEPGREAARIV 293

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           IN RTGTIV+G+NV +    V++G+LTV I    +V QPN F  +G TV    T++ V+ 
Sbjct: 294 INSRTGTIVVGENVVVRAGAVTHGSLTVTIKNASEVSQPNPF-GDGETVVLPQTEVSVTQ 352

Query: 320 NKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
                 + +A   L+ ++  +N IG     +++IL+ +K AGALQ+E+I+
Sbjct: 353 EANRMFVFEASTTLDEIVRAVNQIGAAPGDLMAILEALKQAGALQAELIV 402


>gi|170725959|ref|YP_001759985.1| flagellar basal body P-ring protein [Shewanella woodyi ATCC 51908]
 gi|226701963|sp|B1KLG5|FLGI_SHEWM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|169811306|gb|ACA85890.1| flagellar P-ring protein [Shewanella woodyi ATCC 51908]
          Length = 363

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 149/349 (42%), Positives = 211/349 (60%), Gaps = 13/349 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+ ++Q  R NQLIGYGLVVGL GTG+    + +TEQ+ +++L+N GI+ P   R  
Sbjct: 22  RIKDIANVQGVRSNQLIGYGLVVGLPGTGEK---TTYTEQTFKTMLKNFGINLPDNLRPK 78

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVA V V A +P F  PG  +DV+++SLG+A SLRGG L+ T L G DGN+YA+AQGS
Sbjct: 79  IKNVAVVAVHAEMPAFIKPGQTLDVTVSSLGEAKSLRGGTLLQTFLKGVDGNVYAIAQGS 138

Query: 144 VVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VVSG   +G   S  ++   T G+I NG IVER +   F     L   LR  DFSTA R
Sbjct: 139 MVVSGFSAEGLDGSKVIQNTPTVGRIPNGGIVERTVTTPFSTGDHLTFNLRRADFSTAKR 198

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-ARVII 260
           +AD IN       +RP+    D+ +V+VS P ++      ++ +E + VE  +  A+VI+
Sbjct: 199 LADAINELLGPGMARPL----DAASVQVSAPRDVSQRVSFLATLENIQVEPASESAKVIV 254

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTGTIV+G  VR+    V++G LTV I E  QV QPN   + G TV   +T + V++ 
Sbjct: 255 NSRTGTIVVGREVRLLPAAVTHGGLTVTIAEATQVSQPNPL-AGGQTVVTADTTIDVAEE 313

Query: 321 KGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
                L +    L+ L+  +N +G     +++IL+ +K AGAL  E+II
Sbjct: 314 DSRMFLFNPGTTLDELVRAVNLVGAAPSDVLAILEALKMAGALHGELII 362


>gi|325295402|ref|YP_004281916.1| Flagellar P-ring protein [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065850|gb|ADY73857.1| Flagellar P-ring protein [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 365

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 145/335 (43%), Positives = 202/335 (60%), Gaps = 8/335 (2%)

Query: 36  RDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTAN 95
           R N L GYG+VVGL GTGD   +S FT QS+ ++L+ +GI      + +KN AAV+VTA 
Sbjct: 36  RPNYLTGYGIVVGLDGTGDG-TTSIFTLQSIANMLKKMGIYVDPKAVKTKNAAAVIVTAK 94

Query: 96  LPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVK-GQ 154
           LPPFA PG   DV + SLGDA SL  GIL+ T LLG DG IYA AQG V   G F +  +
Sbjct: 95  LPPFAKPGMTFDVEVASLGDAKSLANGILIRTPLLGPDGKIYAFAQGPVSTGGGFTESNK 154

Query: 155 SSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNR 214
                +  ST G I NG IVERELP +  +  +LIL L++PDFS A  IA  IN+Y    
Sbjct: 155 GGKIKKNFSTTGMIPNGGIVERELPFELSNEKNLILTLKHPDFSRANNIAFAINNY---- 210

Query: 215 FSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVR 274
           F + +A+A DS TV V    N +  + +SE+  L + T++   ++I ERTGT+++  +++
Sbjct: 211 FGKNLAKAEDSSTVIVKYLPNYNKVKFISEILNLKINTESEPTIVIYERTGTVIMSGDIK 270

Query: 275 IS-KVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLN 333
           I   V VS+GN+ V +T+   + QP    SNG+TV   N    V +  G    I +P L 
Sbjct: 271 IEPPVYVSHGNIYVSVTKTPVISQPPPL-SNGTTVQTENVTTTVKEEHGRIFSITSPSLR 329

Query: 334 SLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            L+  +N +G+    +I+I+Q +KAAG L ++III
Sbjct: 330 DLVKALNDLGVSPGDLIAIIQAMKAAGKLHAKIII 364


>gi|238758106|ref|ZP_04619286.1| Flagellar P-ring protein [Yersinia aldovae ATCC 35236]
 gi|238703644|gb|EEP96181.1| Flagellar P-ring protein [Yersinia aldovae ATCC 35236]
          Length = 370

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 152/366 (41%), Positives = 222/366 (60%), Gaps = 9/366 (2%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L  +LI L  + A+   RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+
Sbjct: 9   ILCITLISLVWMPAKA-ERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSL 67

Query: 67  RSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++L  LGI+ P G  +  KNVAAVMVTA LPPF+  G  ID+ ++S+G+A S+RGG L+
Sbjct: 68  SNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPPFSRAGQTIDIVVSSMGNAKSIRGGTLL 127

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MT L G D  +YA+AQG+V+V G       SS      TGG+I  GA +ERELP  F   
Sbjct: 128 MTPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISGGATIERELPTTFGTD 187

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSE 244
             + LQL N DF+ A +++D IN      F    A A D+RT++V  P  N    R +++
Sbjct: 188 GVINLQLNNEDFTLAQQVSDAINRQ--RGFGS--ATALDARTIQVRVPRGNSSQVRFLAD 243

Query: 245 VEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           ++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP+    
Sbjct: 244 IQNIPVNVDAGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVSQPDTPFG 303

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G TV   NT + V    G    ++A P+LN+++  +NS+G     ++SILQ +++AG L
Sbjct: 304 GGQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQSAGCL 363

Query: 363 QSEIII 368
           ++++ I
Sbjct: 364 RAKLEI 369


>gi|107023949|ref|YP_622276.1| flagellar basal body P-ring protein [Burkholderia cenocepacia AU
           1054]
 gi|116691036|ref|YP_836659.1| flagellar basal body P-ring protein [Burkholderia cenocepacia
           HI2424]
 gi|105894138|gb|ABF77303.1| flagellar P-ring protein [Burkholderia cenocepacia AU 1054]
 gi|116649125|gb|ABK09766.1| flagellar P-ring protein [Burkholderia cenocepacia HI2424]
          Length = 391

 Score =  248 bits (634), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 150/379 (39%), Positives = 217/379 (57%), Gaps = 20/379 (5%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R A  + +   L    A    R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PF
Sbjct: 16  VARFAAFVLAACMLGAAPAHA-ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPF 74

Query: 62  TEQSMRSLLQNLGISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSIN 111
           T Q++ ++L NLGIS   G           +  KNVAAVMVTA LPPFA PG  +DV+++
Sbjct: 75  TTQTLANMLANLGISINNGSANGGPSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVS 134

Query: 112 SLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNG 171
           SLG+A SLRGG L++T L GADG +YA+AQG++ V G       S         G+IV G
Sbjct: 135 SLGNAKSLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGG 194

Query: 172 AIVERELPKKFKD-SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKV 230
           AIVER +P      +  L LQL + D+ TA RI   +NS     F    A A D RT+++
Sbjct: 195 AIVERAVPNAIAQMNGVLQLQLNDMDYGTAQRIVSAVNS----NFGPGTATALDGRTIQL 250

Query: 231 SKPTN-IDLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQ 288
           + P +       M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V 
Sbjct: 251 AAPADSAQQVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVV 310

Query: 289 ITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTD 347
           +     V QP  F SNG TV    + +++  + G+  ++ A  +L  ++  +N++G    
Sbjct: 311 VNTQPVVSQPGPF-SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPA 369

Query: 348 GIISILQGIKAAGALQSEI 366
            ++SILQ +KAAGAL++++
Sbjct: 370 DLMSILQAMKAAGALRADL 388


>gi|221215575|ref|ZP_03588538.1| flagellar P-ring protein FlgI [Burkholderia multivorans CGD1]
 gi|221164563|gb|EED97046.1| flagellar P-ring protein FlgI [Burkholderia multivorans CGD1]
          Length = 394

 Score =  248 bits (634), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 146/358 (40%), Positives = 212/358 (59%), Gaps = 19/358 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 41  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 100

Query: 81  ------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
                  +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SLRGG L++T L GADG
Sbjct: 101 GTSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSLRGGTLLLTPLKGADG 160

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLI-LQLR 193
            +YA+AQG++ V G       S         G+IV GAIVER +P        ++ LQL 
Sbjct: 161 QVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERSVPNALAQMNGMLQLQLN 220

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET 252
           + D+ TA RI   +NS     F   +A A D RT++++ P +       M+ ++ L V  
Sbjct: 221 DMDYGTAQRIVAAVNS----SFGPGVATALDGRTIQLAAPADPAQQVAFMARLQNLDVSP 276

Query: 253 D-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
           D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV   
Sbjct: 277 DKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVAQ 335

Query: 312 NTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + +++  + G+  ++ A  +L  ++  +N++G     ++SILQ +KAAGAL++++ I
Sbjct: 336 QSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSILQAMKAAGALRADLEI 393


>gi|289666052|ref|ZP_06487633.1| flagellar basal body P-ring protein [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 353

 Score =  248 bits (634), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 146/350 (41%), Positives = 208/350 (59%), Gaps = 16/350 (4%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---R 81
           RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P     +
Sbjct: 9   RIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPANVNPQ 68

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
           L  KNVAAV + A LPPFA PG  ID++++S+ +A SLRGG L+M  L GADG +YA+AQ
Sbjct: 69  L--KNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRGGSLLMAPLKGADGQVYAMAQ 126

Query: 142 GSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           G++VV G   +G+  S +   I + G+I NGA VER LP  F  + ++ L L   DF+T 
Sbjct: 127 GNLVVGGFGAQGKDGSRVSVNIPSVGRIPNGATVERALPDVFAGTGEITLNLHQNDFTTV 186

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLTVETDTPA 256
            R+   I+S     F    A A D  TV V  PT+    I L   +  VE+     D PA
Sbjct: 187 SRMVAAIDSS----FGAGTARAVDGVTVAVRSPTDPGARIGLLSRLENVEL--SPGDAPA 240

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +V++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VTQ +T   
Sbjct: 241 KVVVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTQQSTITA 300

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            S+    F       L+ ++  +N +G     +++IL+ +K AGAL +E+
Sbjct: 301 TSEGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAEL 350


>gi|85859199|ref|YP_461401.1| flagellar basal body P-ring protein [Syntrophus aciditrophicus SB]
 gi|85722290|gb|ABC77233.1| flagellar basal-body P-ring protein [Syntrophus aciditrophicus SB]
          Length = 403

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 150/388 (38%), Positives = 229/388 (59%), Gaps = 25/388 (6%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           IF    ++  L+    +S    +R+KD+ S+   R+NQLIGYGLVVGL GTGD +++  F
Sbjct: 19  IFLTGIIVLDLVFF--VSYGFAARLKDIASISGVRENQLIGYGLVVGLAGTGDDVKNG-F 75

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T +S+ +LL   GIS     L + N+AAVMVT++LP FA  G+RID +++S+GDA SL G
Sbjct: 76  TSESLSNLLNRQGISMKNKTLKADNIAAVMVTSSLPAFAKIGARIDATVSSIGDAKSLHG 135

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L G DG IYAVAQG V + G  V G +SS  +  ++ G++ +G +VEREL   
Sbjct: 136 GTLLMTPLRGVDGEIYAVAQGPVTLGGYAVGGANSSTGKNHASAGRVSSGVLVERELKYD 195

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL 241
           F       L L  PDF+T+  +AD +N            +++ S  V++ + T  +L  +
Sbjct: 196 FDRLRSFTLNLLQPDFTTSACLADVMNKTLGQHVEAKQVDSF-SVDVRMKEATGGNLMNI 254

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           +S +E L V  D+ + V++NE+TGT+V+G+NVRIS V V++GNL++QI E+ +V QP  F
Sbjct: 255 ISMMENLDVPVDSKSVVVMNEKTGTVVMGENVRISTVAVAHGNLSIQIKEDIRVSQPLPF 314

Query: 302 S--------------------SNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMN 340
           S                      G TV   +T + + + K    +I     +  ++  +N
Sbjct: 315 SPLSSKGNQPAMDKKTGTIVAPGGQTVVTLDTTVGIEEEKKQVMVISKGVTIQEVVKALN 374

Query: 341 SIGLKTDGIISILQGIKAAGALQSEIII 368
           ++G+    +I+I+Q IKAAGALQ+E+ I
Sbjct: 375 ALGVSPRDLITIMQTIKAAGALQAELKI 402


>gi|253998484|ref|YP_003050547.1| flagellar P-ring protein [Methylovorus sp. SIP3-4]
 gi|313200559|ref|YP_004039217.1| flagellar p-ring protein [Methylovorus sp. MP688]
 gi|253985163|gb|ACT50020.1| flagellar P-ring protein [Methylovorus sp. SIP3-4]
 gi|312439875|gb|ADQ83981.1| flagellar P-ring protein [Methylovorus sp. MP688]
          Length = 374

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 142/345 (41%), Positives = 210/345 (60%), Gaps = 8/345 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLG 83
           R+KD+ ++Q  R NQLIGY LVVGL GTGD    +PFT QS+ S+LQ +G++ P G  L 
Sbjct: 32  RLKDLATIQGVRSNQLIGYSLVVGLDGTGDQTTQTPFTVQSLISMLQGMGVTLPQGTNLQ 91

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LPPFA PG  +DV+++S+G+A SLRGG L+MT L GAD  +YA+AQG+
Sbjct: 92  LKNVAAVMVTATLPPFAQPGQALDVTVSSMGNAKSLRGGTLLMTPLKGADNQVYAMAQGN 151

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           +VV G+      S         G+I  GA VER +P        + L+L++ DFSTA ++
Sbjct: 152 LVVGGVGASANGSQTQINHLGVGRISAGATVERAVPVALNQGTGINLELKDSDFSTASKV 211

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVE-TDTPARVIINE 262
            D IN     RF    A A D R ++V+ P +      ++ +E + V   ++ A+VI+N 
Sbjct: 212 VDAIN----QRFGTGTAAAQDGRVIRVNAPADSSRVSFLAALESINVNPAESSAKVILNA 267

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTG++V+  +V +    VS+GNL+V I     + QP A  S G TV+   +++ +    G
Sbjct: 268 RTGSVVMNRSVSLEDCAVSHGNLSVVINTAPVISQPGAL-SGGQTVSTARSEISIEKEPG 326

Query: 323 SFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
               +D    L+ +I  +N+IG     +++ILQ +K+AGAL++E+
Sbjct: 327 KVLKLDGGASLSDVIKALNAIGATPQDLLAILQAMKSAGALRAEL 371


>gi|307546964|ref|YP_003899443.1| flagellar basal body P-ring protein [Halomonas elongata DSM 2581]
 gi|307218988|emb|CBV44258.1| flagellar basal body P-ring protein [Halomonas elongata DSM 2581]
          Length = 374

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 146/348 (41%), Positives = 211/348 (60%), Gaps = 9/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RI+++ S    RDN L+GYGLVVGL G+GD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 31  RIREIASFAGVRDNALVGYGLVVGLDGSGDRTMQAPFTGQSLTNMLSQLGITVPAGTNMQ 90

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            +NVAAVMVTANLP FA  G R+DV ++S+G+A SLRGG L+MT L GADG  YA+AQG+
Sbjct: 91  LRNVAAVMVTANLPAFARQGQRLDVVVSSVGNADSLRGGTLLMTPLKGADGETYAIAQGN 150

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF-KDSADLILQLRNPDFSTAIR 202
           V+V G       SS       GG+I NGA VERE+P     +   L LQL   DF T  R
Sbjct: 151 VLVGGAGASAGGSSVQVNQQAGGRIANGATVEREVPLVLGSNGGRLELQLDRSDFGTVQR 210

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLMSEVEMLTV-ETDTPARVII 260
           +   IN      F   +A A + R + +  P++ +     M+ VE L V  T+ PARV++
Sbjct: 211 VVSAINQS----FGYSVASAQNGRVISLDGPSDANARVNFMARVENLEVTPTEAPARVVL 266

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG IV+   V + +  V+ GNL++ I  +  V QPN F+  G TV   +T++ +   
Sbjct: 267 NSRTGAIVLNGAVTLRQAAVAQGNLSIVIDSDYGVSQPNPFTK-GETVVVRDTEVSIEQQ 325

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G+  +++  DL  ++  +NS+G   + ++SIL+ +KAAG+L++E+ I
Sbjct: 326 PGTLKVVEGADLLDVVDALNSLGATPNDLMSILEALKAAGSLRAELEI 373


>gi|325927971|ref|ZP_08189192.1| flagellar basal-body P-ring protein [Xanthomonas perforans 91-118]
 gi|325541656|gb|EGD13177.1| flagellar basal-body P-ring protein [Xanthomonas perforans 91-118]
          Length = 372

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 145/348 (41%), Positives = 206/348 (59%), Gaps = 12/348 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P      
Sbjct: 28  RIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPANVNPQ 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV + A LPPFA PG  ID++I+S+ +A SLRGG L+M  L GADG +YA+AQG+
Sbjct: 88  LKNVAAVAIHAELPPFAKPGQPIDITISSIANAVSLRGGSLLMAPLKGADGQVYAMAQGN 147

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G   +G+  S +   + + G+I NGA VER LP  F  + ++ L L   DF+T  R
Sbjct: 148 LVVGGFGAQGKDGSRVSVNVPSVGRIPNGATVERALPDVFAGTGEITLNLHQNDFTTVSR 207

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLTVETDTPARV 258
           +   I+S     F    A A D  TV V  PT+    I L   +  VE+     D PA+V
Sbjct: 208 MVAAIDSS----FGAGTARAVDGVTVAVRSPTDPGARIGLLSRLENVEL--SPGDAPAKV 261

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VTQ +T    S
Sbjct: 262 VVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTQQSTITATS 321

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +    F       L+ ++  +N +G     +++IL+ +K AGAL +E+
Sbjct: 322 EGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAEL 369


>gi|21242723|ref|NP_642305.1| flagellar basal body P-ring protein [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|48474872|sp|Q8PL27|FLGI_XANAC RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|21108199|gb|AAM36841.1| flagellar protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 372

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 145/348 (41%), Positives = 206/348 (59%), Gaps = 12/348 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P      
Sbjct: 28  RIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPANVNPQ 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV + A LPPFA PG  IDV+++S+ +A SLRGG L+M  L GADG +YA+AQG+
Sbjct: 88  LKNVAAVAIHAELPPFAKPGQPIDVTVSSIANAVSLRGGSLLMAPLKGADGQVYAMAQGN 147

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G   +G+  S +   + + G+I NGA VER LP  F  + ++ L L   DF+T  R
Sbjct: 148 LVVGGFGAQGKDGSRVSVNVPSVGRIPNGATVERALPDVFAGTGEITLNLHQNDFTTVSR 207

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLTVETDTPARV 258
           +   I+S     F    A A D  TV V  PT+    I L   +  VE+     D PA+V
Sbjct: 208 MVAAIDSS----FGAGTARAVDGVTVAVRSPTDPGARIGLLSRLENVEL--SPGDAPAKV 261

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VTQ +T    S
Sbjct: 262 VVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTQQSTITATS 321

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +    F       L+ ++  +N +G     +++IL+ +K AGAL +E+
Sbjct: 322 EGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAEL 369


>gi|91776313|ref|YP_546069.1| flagellar basal body P-ring protein [Methylobacillus flagellatus
           KT]
 gi|122399642|sp|Q1GZV9|FLGI_METFK RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|91710300|gb|ABE50228.1| flagellar P-ring protein [Methylobacillus flagellatus KT]
          Length = 368

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 213/347 (61%), Gaps = 8/347 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+ ++Q  R NQLIGYGLVVGL GTGD    +PFT QS+ S++Q +GI+ P G  L 
Sbjct: 26  RIKDLTTIQGVRSNQLIGYGLVVGLDGTGDQTTQTPFTVQSIVSMMQQMGINLPSGTNLQ 85

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            +NVAAVMVT NLPPFA PG  +DV+++S+G+A SLRGG L+MT L GAD  +YA+AQG+
Sbjct: 86  LRNVAAVMVTGNLPPFAQPGQPMDVTVSSMGNARSLRGGTLLMTPLKGADNQVYAMAQGN 145

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           +V+ G       +S        G+I  GAIVER +P +  +++ + L+L+  DFSTA  +
Sbjct: 146 LVIGGAGAGASGTSTQINHLGAGRISAGAIVERAVPSQLTETSTIRLELKEADFSTASMV 205

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVE-TDTPARVIINE 262
            D IN     RF    A   D R ++V  P +I+    +  +E L V+ +  PA+VI+N 
Sbjct: 206 VDAINK----RFGNGTATPLDGRVIQVQPPMDINRIAFIGNLENLDVKPSQGPAKVILNA 261

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTG++V+   V +    +S+GNL+V I     + QP  FS  G TV    + ++++   G
Sbjct: 262 RTGSVVMNQAVTLDDCAISHGNLSVVINTAPAISQPGPFSG-GQTVATQVSQVEINKEPG 320

Query: 323 SFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
               +D    L  ++  +N+IG     +++ILQ +KAAG+L++++ I
Sbjct: 321 QVIKLDKGTSLADVVKALNAIGATPQDLVAILQAMKAAGSLRADLEI 367


>gi|167585198|ref|ZP_02377586.1| flagellar basal body P-ring protein [Burkholderia ubonensis Bu]
          Length = 392

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 150/379 (39%), Positives = 217/379 (57%), Gaps = 20/379 (5%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           R A     ++ L   +A+   R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT 
Sbjct: 19  RCALAACCVLALVPAAARA-ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTT 77

Query: 64  QSMRSLLQNLGISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSL 113
           Q++ ++L NLGIS   G           +  KNVAAVMVTA LPPFA PG  +DV+++SL
Sbjct: 78  QTLANMLANLGISINNGSANGGGSSLSNMQLKNVAAVMVTATLPPFARPGEAVDVTVSSL 137

Query: 114 GDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAI 173
           G+A SLRGG L++T L GADG +YA+AQG++ V G       S         G+I  GAI
Sbjct: 138 GNAKSLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLASGRIAGGAI 197

Query: 174 VERELPKKFKDSADLI-LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK 232
           VER +P        ++ LQL + D+ TA RI   IN      F    A A D RT++++ 
Sbjct: 198 VERSVPNAVAQMNGMLQLQLNDMDYGTAQRIVSAINGS----FGPNTATALDGRTIQLAA 253

Query: 233 PTN-IDLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQIT 290
           P +       M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V + 
Sbjct: 254 PADSAQQVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVN 313

Query: 291 ENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGI 349
               V QP  F SNG TV    + +++  + G+  ++ A  +L  ++  +NS+G     +
Sbjct: 314 TQPVVSQPGPF-SNGQTVAAQQSQIQLKQDNGALKMVTAGANLADVVKALNSLGATPADL 372

Query: 350 ISILQGIKAAGALQSEIII 368
           +SILQ +KAAGAL++++ I
Sbjct: 373 MSILQAMKAAGALRADLEI 391


>gi|108868299|sp|Q2LT20|FLGI_SYNAS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 390

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 150/388 (38%), Positives = 229/388 (59%), Gaps = 25/388 (6%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           IF    ++  L+    +S    +R+KD+ S+   R+NQLIGYGLVVGL GTGD +++  F
Sbjct: 6   IFLTGIIVLDLVFF--VSYGFAARLKDIASISGVRENQLIGYGLVVGLAGTGDDVKNG-F 62

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T +S+ +LL   GIS     L + N+AAVMVT++LP FA  G+RID +++S+GDA SL G
Sbjct: 63  TSESLSNLLNRQGISMKNKTLKADNIAAVMVTSSLPAFAKIGARIDATVSSIGDAKSLHG 122

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L G DG IYAVAQG V + G  V G +SS  +  ++ G++ +G +VEREL   
Sbjct: 123 GTLLMTPLRGVDGEIYAVAQGPVTLGGYAVGGANSSTGKNHASAGRVSSGVLVERELKYD 182

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL 241
           F       L L  PDF+T+  +AD +N            +++ S  V++ + T  +L  +
Sbjct: 183 FDRLRSFTLNLLQPDFTTSACLADVMNKTLGQHVEAKQVDSF-SVDVRMKEATGGNLMNI 241

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           +S +E L V  D+ + V++NE+TGT+V+G+NVRIS V V++GNL++QI E+ +V QP  F
Sbjct: 242 ISMMENLDVPVDSKSVVVMNEKTGTVVMGENVRISTVAVAHGNLSIQIKEDIRVSQPLPF 301

Query: 302 S--------------------SNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMN 340
           S                      G TV   +T + + + K    +I     +  ++  +N
Sbjct: 302 SPLSSKGNQPAMDKKTGTIVAPGGQTVVTLDTTVGIEEEKKQVMVISKGVTIQEVVKALN 361

Query: 341 SIGLKTDGIISILQGIKAAGALQSEIII 368
           ++G+    +I+I+Q IKAAGALQ+E+ I
Sbjct: 362 ALGVSPRDLITIMQTIKAAGALQAELKI 389


>gi|84388095|ref|ZP_00990991.1| flagellar P-ring protein precursor [Vibrio splendidus 12B01]
 gi|84377162|gb|EAP94032.1| flagellar P-ring protein precursor [Vibrio splendidus 12B01]
          Length = 363

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 147/370 (39%), Positives = 226/370 (61%), Gaps = 15/370 (4%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           ++  ++F ++ L   ++   +RIKDV  +   R NQL+GYGLV GL GTG++   +PFT+
Sbjct: 3   KLTLVLFGMLFLA--TSAHAARIKDVAKVAGVRSNQLVGYGLVSGLPGTGET---TPFTD 57

Query: 64  QSMRSLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           Q+  ++LQN GI   PG +  +KNVAAV+VTA LP F+  G  +DV+++S+G A SLRGG
Sbjct: 58  QTFNAMLQNFGIQLPPGTKPKTKNVAAVIVTAELPAFSKQGQEVDVTVSSIGSAKSLRGG 117

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTG-GKIVNGAIVERELPKK 181
            L+ T L G DG +YAVAQG++VVSG   +G   S + G +   G I +GA VE+E+P  
Sbjct: 118 TLLQTFLKGLDGQVYAVAQGNLVVSGFSAQGNDGSKIVGNNPNVGIISSGATVEQEIPTP 177

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F     +   L   DF+TA R+AD +N++        +A A D+ +VKV  P  I     
Sbjct: 178 FGRGDYITFNLIQSDFTTAQRLADAVNNF----LGPQMASAVDATSVKVRAPREISQRVA 233

Query: 241 LMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +S +E +  +  +  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN
Sbjct: 234 FLSAIENIEFDPAEGSAKIIVNSRTGTIVVGKHVRLRAAAVTHGGMTVAIKENLNVSQPN 293

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           AFS  G TV   ++D+++++  G  F       L+ L+  +N +G     +++ILQ +K 
Sbjct: 294 AFSG-GQTVVVPDSDIEITEGDGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQ 352

Query: 359 AGALQSEIII 368
           AGA++ ++II
Sbjct: 353 AGAIEGQLII 362


>gi|170734370|ref|YP_001766317.1| flagellar basal body P-ring protein [Burkholderia cenocepacia
           MC0-3]
 gi|254246968|ref|ZP_04940289.1| Flagellar P-ring protein [Burkholderia cenocepacia PC184]
 gi|124871744|gb|EAY63460.1| Flagellar P-ring protein [Burkholderia cenocepacia PC184]
 gi|169817612|gb|ACA92195.1| flagellar P-ring protein [Burkholderia cenocepacia MC0-3]
          Length = 391

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 150/379 (39%), Positives = 217/379 (57%), Gaps = 20/379 (5%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R A  + +   L    A    R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PF
Sbjct: 16  VARFAAFVLAACVLGAAPAHA-ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPF 74

Query: 62  TEQSMRSLLQNLGISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSIN 111
           T Q++ ++L NLGIS   G           +  KNVAAVMVTA LPPFA PG  +DV+++
Sbjct: 75  TTQTLANMLANLGISINNGSANGGPSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVS 134

Query: 112 SLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNG 171
           SLG+A SLRGG L++T L GADG +YA+AQG++ V G       S         G+IV G
Sbjct: 135 SLGNAKSLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGG 194

Query: 172 AIVERELPKKFKD-SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKV 230
           AIVER +P      +  L LQL + D+ TA RI   +NS     F    A A D RT+++
Sbjct: 195 AIVERAVPNAIAQMNGVLQLQLNDMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQL 250

Query: 231 SKPTN-IDLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQ 288
           + P +       M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V 
Sbjct: 251 AAPADSAQQVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVV 310

Query: 289 ITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTD 347
           +     V QP  F SNG TV    + +++  + G+  ++ A  +L  ++  +N++G    
Sbjct: 311 VNTQPVVSQPGPF-SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPA 369

Query: 348 GIISILQGIKAAGALQSEI 366
            ++SILQ +KAAGAL++++
Sbjct: 370 DLMSILQAMKAAGALRADL 388


>gi|332284023|ref|YP_004415934.1| flagellar basal body P-ring protein [Pusillimonas sp. T7-7]
 gi|330427976|gb|AEC19310.1| flagellar basal body P-ring protein [Pusillimonas sp. T7-7]
          Length = 384

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 146/349 (41%), Positives = 215/349 (61%), Gaps = 10/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R +PFT+QS+ ++L  LGI+ P G  + 
Sbjct: 40  RVKDLASIQGVRANQLIGYGLVVGLDGSGDQVRQTPFTQQSLTNMLSQLGITVPQGTNMQ 99

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            +NVAAVMVTA LP FA PG  +DV ++S+G+A SLRGG L+MT L GA+G +YA+AQG+
Sbjct: 100 LRNVAAVMVTARLPAFARPGQTVDVVVSSMGNAKSLRGGTLLMTPLKGANGQVYAIAQGN 159

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G   +   SS       GG I NGAI+ER +P  +     + L+L   DF TA  +
Sbjct: 160 LLVGGAGAEAGGSSVQVNQLNGGIISNGAIIERAVPTIYARDGIVNLELNTTDFGTAQNL 219

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLMSEVEMLTVETDTPAR--VII 260
              +N     +F    A A D R V+V  P N D     +S+VE L V    PAR  V+I
Sbjct: 220 VAALN----KQFGTGTATALDGRVVQVRGPLNPDAQAAFLSQVESLQVRV-APARAKVVI 274

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG++V+   V I +  ++YGNL+V I+    V QP+     G TV  ++T +++  +
Sbjct: 275 NARTGSVVMNRTVTIDEAAIAYGNLSVVISRQSDVSQPDTPFGGGQTVVTDSTQIEMRSD 334

Query: 321 KGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            GS   +  + +L  ++  +N++G     ++SILQ +K+AGAL++++ I
Sbjct: 335 SGSLQRVRTSANLADVVKALNALGATPQDLLSILQNLKSAGALRADLEI 383


>gi|167561209|ref|ZP_02354125.1| flagellar basal body P-ring protein [Burkholderia oklahomensis
           EO147]
          Length = 398

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 210/358 (58%), Gaps = 19/358 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 45  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 104

Query: 81  ------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
                  +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GADG
Sbjct: 105 GSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGADG 164

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQLR 193
            +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL 
Sbjct: 165 QVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAIAQMNGVLQLQLN 224

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET 252
           + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V  
Sbjct: 225 DMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVSP 280

Query: 253 D-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
           D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV   
Sbjct: 281 DKAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVAQ 339

Query: 312 NTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + +++  + G+  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 340 QSQIQLKQDNGALRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 397


>gi|297538900|ref|YP_003674669.1| flagellar P-ring protein [Methylotenera sp. 301]
 gi|297258247|gb|ADI30092.1| flagellar P-ring protein [Methylotenera sp. 301]
          Length = 377

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 143/365 (39%), Positives = 223/365 (61%), Gaps = 14/365 (3%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
            A L  SL+ +    A+   R+KD+ ++Q  R+NQLIGYGLVVGL GTGD    +P+T Q
Sbjct: 21  CALLSISLLFIQPAHAE---RLKDLATIQGVRNNQLIGYGLVVGLDGTGDQ---TPYTVQ 74

Query: 65  SMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           SM S++Q +G++ P G  +  KNVA+V++T +LP FA PG  +DV+++S+G A SLRGG 
Sbjct: 75  SMISMMQQMGVNLPAGTSIQMKNVASVIITGSLPAFAQPGQTLDVTVSSMGSAKSLRGGT 134

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L+MT L GADG IYA+AQG++VV G+      S       + G+I +GA VER +P    
Sbjct: 135 LLMTPLKGADGQIYAMAQGNLVVGGVGASANGSQTQINHLSVGRISDGATVERSIPNTIN 194

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMS 243
            + ++ L+L+  DFSTA  +AD IN     RF +  A A D R ++V  P N      ++
Sbjct: 195 LTDNVNLELKESDFSTASLVADAINK----RFGQNTALAQDGRVIRVQAPANSSRVSFLA 250

Query: 244 EVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           ++E + V    T A++I+N RTG++V+   V +    VS+GNL+V I  +  + QP A S
Sbjct: 251 DLEKINVAPAPTNAKIIMNARTGSVVMNQAVTLESCAVSHGNLSVVINTDPVISQPGALS 310

Query: 303 SNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S G T++   + ++++   G    L    +L+ ++  +N+IG     +++ILQ +KAAG+
Sbjct: 311 S-GQTISTARSQIEINKEPGKVLKLNSGANLSDVVKALNAIGATPQDLLAILQAMKAAGS 369

Query: 362 LQSEI 366
           L +++
Sbjct: 370 LHADL 374


>gi|261821157|ref|YP_003259263.1| flagellar basal body P-ring protein [Pectobacterium wasabiae
           WPP163]
 gi|261605170|gb|ACX87656.1| flagellar P-ring protein [Pectobacterium wasabiae WPP163]
          Length = 369

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 223/365 (61%), Gaps = 9/365 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           ++ +L+ L+ I+     RI+D+V++Q  R N LIGYGLVVGL G+GD    +PFT QS+ 
Sbjct: 9   VLLTLLALN-IAPASAERIRDLVNIQGVRGNALIGYGLVVGLDGSGDQTMQTPFTTQSLT 67

Query: 68  SLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L  LGI+ P G  +  KNVAAVMVTA LP F   G  IDV ++SLG+A SLRGG L+M
Sbjct: 68  NMLSQLGITVPAGTNMQLKNVAAVMVTAELPAFGRSGQNIDVVVSSLGNAKSLRGGTLLM 127

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L G D  +YA+AQG+V+V G       SS       GG+I NGA++ERELP  F  S 
Sbjct: 128 TPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISNGAVIERELPSTFGASN 187

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEV 245
            ++LQL+N DFS A +++D IN       + P+    DSRT++V  P  N    R +++V
Sbjct: 188 TIMLQLKNDDFSMAQKVSDAINRSGYGGTASPL----DSRTIQVLAPHGNSSQVRFLADV 243

Query: 246 EMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           + + V      A+V+IN RTG++V+  +V +    ++ GNL+V I +   V QPN     
Sbjct: 244 QNIEVNVGIQDAKVVINSRTGSVVMNRDVTLDSCAIAQGNLSVTINQQANVSQPNTPFGG 303

Query: 305 GSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G TV    T++ V    G+   ++ + +LN+++  +NS+G     ++SILQ +++AG L+
Sbjct: 304 GQTVVTPQTEISVQQAGGALQRVNSSANLNNVVRALNSLGATPMELMSILQAMQSAGCLR 363

Query: 364 SEIII 368
           +++ I
Sbjct: 364 AKLEI 368


>gi|78047582|ref|YP_363757.1| flagellar basal body P-ring protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|294665575|ref|ZP_06730856.1| flagellar P-ring protein precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|124021077|sp|Q3BU06|FLGI_XANC5 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|78036012|emb|CAJ23703.1| flagellar basal-body P-ring protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|292604673|gb|EFF48043.1| flagellar P-ring protein precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 372

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 144/348 (41%), Positives = 206/348 (59%), Gaps = 12/348 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P      
Sbjct: 28  RIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPANVNPQ 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV + A LPPFA PG  ID++++S+ +A SLRGG L+M  L GADG +YA+AQG+
Sbjct: 88  LKNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRGGSLLMAPLKGADGQVYAMAQGN 147

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G   +G+  S +   + + G+I NGA VER LP  F  + ++ L L   DF+T  R
Sbjct: 148 LVVGGFGAQGKDGSRVSVNVPSVGRIPNGATVERALPDVFAGTGEITLNLHQNDFTTVSR 207

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLTVETDTPARV 258
           +   I+S     F    A A D  TV V  PT+    I L   +  VE+     D PA+V
Sbjct: 208 MVAAIDSS----FGAGTARAVDGVTVAVRSPTDPGARIGLLSRLENVEL--SPGDAPAKV 261

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VTQ +T    S
Sbjct: 262 VVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTQQSTITATS 321

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +    F       L+ ++  +N +G     +++IL+ +K AGAL +E+
Sbjct: 322 EGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAEL 369


>gi|253996315|ref|YP_003048379.1| flagellar P-ring protein [Methylotenera mobilis JLW8]
 gi|253982994|gb|ACT47852.1| flagellar P-ring protein [Methylotenera mobilis JLW8]
          Length = 390

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 216/345 (62%), Gaps = 8/345 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           R+KD+ S+Q  R NQLIGYGLVVGL GTGD    +PFT QS+ S++Q +G++ P G  L 
Sbjct: 48  RLKDLASIQGVRSNQLIGYGLVVGLDGTGDQTVQTPFTVQSIISMMQQMGVNLPTGTSLQ 107

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV+VT++LP FA PG  +D++++S+G+A SLRGG L+MT L GADG +YA+AQGS
Sbjct: 108 LKNVAAVIVTSSLPAFAQPGQTLDITVSSMGNAKSLRGGTLLMTPLKGADGQVYAMAQGS 167

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           +VV G+      S       + G+I  GA VER +P     +    L+L++ DFSTA  +
Sbjct: 168 LVVGGVGASANGSQTQVNHLSVGRITAGATVERAVPSNVTQNNTFNLELKDSDFSTASLV 227

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTV-ETDTPARVIINE 262
            D +N     +F +  A A ++R ++++ P +      ++ +E L V    + A+VI+N 
Sbjct: 228 VDAVN----RQFGQNTALAQNARVIQINPPASYSRVAFLAALESLNVAPAASYAKVIVNA 283

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTG++V+   V +    VS+GNLTV I  +  + QP A +S G TV    +++ +  + G
Sbjct: 284 RTGSVVMNQTVTLESCAVSHGNLTVTINTDPVISQPGALAS-GQTVATARSEIDIKKDPG 342

Query: 323 SFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
               +D+  +L+ ++  +N+IG     +++ILQ +KAAG+L++E+
Sbjct: 343 QVVKLDSGANLSDVVKALNAIGATPQDLLAILQAMKAAGSLRAEL 387


>gi|315179630|gb|ADT86544.1| flagellar P-ring protein precursor I [Vibrio furnissii NCTC 11218]
          Length = 373

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 149/356 (41%), Positives = 222/356 (62%), Gaps = 15/356 (4%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI---S 76
           A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      FT QS+ ++L+  G+    
Sbjct: 25  AEVEIPIMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKFTAQSITNMLRQFGVQIDE 83

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
           +   +L  +NVA+V VTA + P A PG  +++ ++S+GDA SLRGG L++T L G DG +
Sbjct: 84  STDPKL--RNVASVSVTATVDPMAGPGQTLNIVVSSIGDAKSLRGGTLLLTPLRGIDGEV 141

Query: 137 YAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           YAVAQG+VVV G+  +G+S S +     T G+I NGA +ERE+P  F D   + L LR P
Sbjct: 142 YAVAQGNVVVGGVSAEGRSGSKIAVNTPTSGRIPNGATLEREIPTDFNDRDTVTLNLREP 201

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTV-ETD 253
            F+TA  IA +IN    + F   +A A +   V++  P +      +MS +E ++V E  
Sbjct: 202 SFTTAKNIAREIN----DTFGPEVAIAINKGRVEMRAPKDTQQRVTMMSMLEEMSVMEGR 257

Query: 254 TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT-QNN 312
            PAR++ N RTGT+VIG NV++ +  VS+GNLTV ITE++Q  QPNAF+S  + V  Q+ 
Sbjct: 258 KPARIVFNSRTGTVVIGKNVKVGQAAVSHGNLTVSITESQQASQPNAFASGDTQVVDQSQ 317

Query: 313 TDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            D+   DN       +  +LN++++ +NS+G     ++SILQ +  AGAL +E+++
Sbjct: 318 IDIN-EDNAQMVIWPEGTELNTIVNAVNSLGATPTDLMSILQALHEAGALNAELVV 372


>gi|30248326|ref|NP_840396.1| flagellar basal body P-ring protein [Nitrosomonas europaea ATCC
           19718]
 gi|81584780|sp|Q82XG5|FLGI_NITEU RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|30138212|emb|CAD84220.1| Flagellar P-ring protein [Nitrosomonas europaea ATCC 19718]
          Length = 370

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 156/365 (42%), Positives = 221/365 (60%), Gaps = 11/365 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L   LI  H +SA+   RIKD+ ++Q  R NQLIGYGLVVGL GTGD  + +PFT QS+ 
Sbjct: 12  LSVCLIVSHPVSAE---RIKDLANIQGVRANQLIGYGLVVGLDGTGDQTQQTPFTVQSIL 68

Query: 68  SLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           S+L  LG++  PG  L  +NVA+VMVTA LP FA PG +IDV+++S+G+A SLRGG L+M
Sbjct: 69  SMLGQLGVNLPPGTNLQLRNVASVMVTATLPAFAKPGQQIDVTVSSMGNAKSLRGGTLLM 128

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L G D  +YAVAQGS+V+ G       SS        G+I  GAIVER +P       
Sbjct: 129 TPLKGIDNQVYAVAQGSLVIGGAGASSAGSSVQINHLGAGRISAGAIVERAVPTVLGQGE 188

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEV 245
            + L+LR+ DF+TA RI D INS    RFS   A A D R +++  P N +     +S++
Sbjct: 189 YINLELRDTDFTTARRIVDTINS----RFSYGTATALDGRVIQLRAPLNNNQRVTFISQI 244

Query: 246 EMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           E L V      A+VIIN RTG++V+   V +    V++GNL+V I     V QP  F+  
Sbjct: 245 EDLDVIPAQGIAKVIINARTGSVVMNQMVTLESSAVAHGNLSVIINTQPIVSQPGPFAQR 304

Query: 305 GSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G TV    + ++V   +G+  L+  +  L  ++  +N+IG     +++ILQ +KA+G+L+
Sbjct: 305 GETVVVPQSQIEVRSEEGNLMLLPGSASLADVVKALNAIGATPQDLLAILQALKASGSLR 364

Query: 364 SEIII 368
           +E+ I
Sbjct: 365 AELEI 369


>gi|56460248|ref|YP_155529.1| flagellar basal body P-ring protein [Idiomarina loihiensis L2TR]
 gi|62286744|sp|Q5R0Q0|FLGI_IDILO RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|56179258|gb|AAV81980.1| Flagellar basal-body P-ring protein [Idiomarina loihiensis L2TR]
          Length = 366

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 156/371 (42%), Positives = 217/371 (58%), Gaps = 14/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +I  L  SL+ +     Q  SRIKD+ S+Q  R NQLIGYGLVVGL GTG+    +PFT
Sbjct: 4   LKIFALAVSLLSMLAAPVQA-SRIKDIASVQGVRSNQLIGYGLVVGLPGTGEQ---TPFT 59

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           +Q+ R++L N GI+ P   R    NVAAV V A LP FA PG +IDV+++S+G A  L G
Sbjct: 60  DQTFRTMLGNFGINIPANERPKIDNVAAVAVHAELPAFAKPGQKIDVTVSSVGSADGLTG 119

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSS-FMEGISTGGKIVNGAIVERELPK 180
           G L+ T L GA+G +YAVAQGS++V GL  +G   S  +    T G+I NG +VERE+  
Sbjct: 120 GTLMQTFLKGANGEVYAVAQGSLIVGGLGAEGNDGSRIVINTPTVGRIPNGGVVEREVRS 179

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F  S  L   L   DF+TA R+A+ IN    N      A+A D+ +V+V  P ++    
Sbjct: 180 GFGSSDYLTFNLHQSDFTTAKRMAETIN----NLVGDGTAQAVDATSVRVRAPRDLSQRV 235

Query: 240 RLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             MS +E L V +    A++I+N RTGTIV+G NV +    V++GN+ V I EN  V QP
Sbjct: 236 SYMSTLENLEVQQASASAKIIVNARTGTIVVGQNVELRPAAVAHGNMQVTIAENVNVDQP 295

Query: 299 NAFSSNGSTVT-QNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N F+   + +T Q+  D+   D +  F       LN L+  +N IG     +I++L+ +K
Sbjct: 296 NPFADGETAITPQSIIDVNQEDAR-MFVFQPGTTLNDLVRAVNQIGAAPGDMIAVLEALK 354

Query: 358 AAGALQSEIII 368
            AGAL  E+I+
Sbjct: 355 QAGALSGELIV 365


>gi|323492334|ref|ZP_08097487.1| flagellar basal body P-ring protein [Vibrio brasiliensis LMG 20546]
 gi|323313381|gb|EGA66492.1| flagellar basal body P-ring protein [Vibrio brasiliensis LMG 20546]
          Length = 403

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 145/369 (39%), Positives = 226/369 (61%), Gaps = 15/369 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+ SL       A+    + D+V +Q  R+NQL+GYGLVVGL G GD      FT QS+
Sbjct: 42  LLMLSLGASASAQAEATIPVMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKFTSQSV 100

Query: 67  RSLLQNLGIS---TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
            ++L+  G+    T   +L  +NVA+V VTA + P A PG +++V ++S+GDA SLRGG 
Sbjct: 101 TNMLRQFGVQIDDTTDPKL--RNVASVSVTATVEPMAGPGQKLNVVVSSIGDAKSLRGGT 158

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKF 182
           L++T L G DG +YA+AQG+VVV G+  +G+S S  +    T G+I  GA +ERE+   F
Sbjct: 159 LLLTPLRGIDGEVYAIAQGNVVVGGVSAEGKSGSKIVINTPTSGRIPGGATLEREVASDF 218

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLM 242
            +   ++L LR P F+TA  IA ++N    N F   +A A ++  + +  P +     +M
Sbjct: 219 SEQQHIVLNLRKPSFTTAKNIAREVN----NIFGPEVAVAKNNVRINIRAPKDSQQRVVM 274

Query: 243 SEV--EMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
             +  E+  VE   PAR++ N RTGT+VIG +V++S+  VS+GNLTV I E++QV QPNA
Sbjct: 275 MSMLEEISVVEGRKPARIVFNSRTGTVVIGKSVKVSEAAVSHGNLTVTIAESQQVSQPNA 334

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           F ++G T   + + L VS+ +   ++     +LN++++ +NS+G     ++SILQ +  A
Sbjct: 335 F-ADGETTVVDQSQLDVSEERAQMAIWPPGTELNTIVNAVNSLGATPTDLMSILQALHEA 393

Query: 360 GALQSEIII 368
           GAL +E+++
Sbjct: 394 GALNAELVV 402


>gi|134297194|ref|YP_001120929.1| flagellar basal body P-ring protein [Burkholderia vietnamiensis G4]
 gi|134140351|gb|ABO56094.1| flagellar P-ring protein [Burkholderia vietnamiensis G4]
          Length = 390

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 151/380 (39%), Positives = 215/380 (56%), Gaps = 25/380 (6%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           F +    F   G H        R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT
Sbjct: 21  FMLIACAFGAAGAH------AERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFT 74

Query: 63  EQSMRSLLQNLGISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINS 112
            Q++ ++L NLGIS   G           +  KNVAAVMVTA LPPFA PG  +DV+++S
Sbjct: 75  TQTLANMLANLGISINNGSANGGSSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSS 134

Query: 113 LGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGA 172
           LG+A SLRGG L++T L GADG +YA+AQG++ V G       S         G+I  GA
Sbjct: 135 LGNAKSLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGA 194

Query: 173 IVERELPKKFKD-SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVS 231
           IVER +P      +  L LQL + D+ TA RI   +NS     F    A A D RT++++
Sbjct: 195 IVERSVPNAVAQMNGVLQLQLNDMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLA 250

Query: 232 KPTNI-DLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQI 289
            P +       M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +
Sbjct: 251 APADPSQQVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVV 310

Query: 290 TENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDG 348
                V QP  F SNG TV    + +++  + GS  ++ A  +L  ++  +N++G     
Sbjct: 311 NTQPVVSQPGPF-SNGQTVVAQQSQIQLKQDNGSLKMVTAGANLADVVKALNTLGATPAD 369

Query: 349 IISILQGIKAAGALQSEIII 368
           ++SILQ +KAAGAL++++ I
Sbjct: 370 LMSILQAMKAAGALRADLEI 389


>gi|254496891|ref|ZP_05109739.1| flagellar basal body P-ring protein [Legionella drancourtii LLAP12]
 gi|254353910|gb|EET12597.1| flagellar basal body P-ring protein [Legionella drancourtii LLAP12]
          Length = 352

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 145/357 (40%), Positives = 214/357 (59%), Gaps = 13/357 (3%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
           I++    RIKD+ +L+  R NQLIGYGLVVGL GTGD    + +TE S  ++L  LG++ 
Sbjct: 2   INSVYAERIKDMATLEGVRINQLIGYGLVVGLNGTGDK-NGTRYTEDSFANMLTQLGVNI 60

Query: 78  PGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
             G +L SKN+AAVMVTANL  F   G  +DV+I+S+GD+ SL GG L+MT L GADG +
Sbjct: 61  RAGTKLNSKNMAAVMVTANLSSFMKKGQNLDVNISSIGDSKSLLGGTLLMTPLKGADGRV 120

Query: 137 YAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           YA++QG+++VSG+   G   SS    + +GG+I NGA +E ++P  F  S +++  L  P
Sbjct: 121 YAISQGNIIVSGISAAGSDGSSVTVNVPSGGRIPNGATIEADIPNPFYFSKNIVYNLHTP 180

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLTVE 251
           DF+TA R++D IN           A+A D+ +V ++ P      +D   ++  +E    E
Sbjct: 181 DFTTAKRMSDAINL----ELGPGTAKALDATSVVITSPIKMAQRVDFVSVLENIEFKPAE 236

Query: 252 TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
               A+VIIN RTGT+VI  NV +    VS+GNL V +TE   + QPNAF+   +  TQ 
Sbjct: 237 --AMAKVIINARTGTVVISSNVIVKSAAVSHGNLVVSVTETPVISQPNAFARGRTVQTQQ 294

Query: 312 NTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +       N  +F L     L  ++ G+N++G     +ISIL+ ++ AGAL + +I+
Sbjct: 295 SQVNIAQKNNHAFVLPKGTTLKDIVRGINAVGATPADVISILEALQQAGALNATLIV 351


>gi|227355997|ref|ZP_03840389.1| flagellar P-ring protein precursor [Proteus mirabilis ATCC 29906]
 gi|227163985|gb|EEI48887.1| flagellar P-ring protein precursor [Proteus mirabilis ATCC 29906]
          Length = 368

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 153/366 (41%), Positives = 221/366 (60%), Gaps = 12/366 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           F++ + +G    SA    RI+D+ S++  R+N LIGYGLVVGL GTGD    +PFT QS+
Sbjct: 10  FIVMTCVGF---SAHA-ERIRDLTSVEGVRENALIGYGLVVGLDGTGDQTMQTPFTTQSL 65

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  IDV ++SLG+A SLRGG L+
Sbjct: 66  NNMLSQLGITVPAGTNMQLKNVAAVMVTAKLPPFGRTGQSIDVVVSSLGNAKSLRGGTLL 125

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MT L G D  +YAVAQG+++V G       SS       GG+I NGAI+ERELP +F  +
Sbjct: 126 MTPLKGVDSQVYAVAQGNIIVGGSGASAGGSSVKVNQLAGGRISNGAIIERELPSQFGQT 185

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSE 244
             L LQL   +F+ A  IAD IN       + P+    D+RTV++  P    +  R +++
Sbjct: 186 GLLNLQLNEENFTLAQSIADAINKLRGVGTALPL----DARTVQLRVPLGKSEQVRFLAD 241

Query: 245 VEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           V+ L V+     A+VIIN RTG++V+  +V +    ++ GNL+V +     V QPN   +
Sbjct: 242 VQNLEVKRVIADAKVIINARTGSVVMNRDVVLGSCAIAQGNLSVTVDSQVNVSQPNTPFA 301

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            GSTV   NT + V++  GS   ++A   LN +I  +N++G     ++SILQ +++AG L
Sbjct: 302 GGSTVVSRNTSVNVNEKGGSLQKVNASASLNEVIRSLNALGATPTDLMSILQAMESAGCL 361

Query: 363 QSEIII 368
           ++ + I
Sbjct: 362 RARLEI 367


>gi|171321842|ref|ZP_02910743.1| flagellar P-ring protein [Burkholderia ambifaria MEX-5]
 gi|171092880|gb|EDT38132.1| flagellar P-ring protein [Burkholderia ambifaria MEX-5]
          Length = 394

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 210/356 (58%), Gaps = 19/356 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 41  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 100

Query: 81  ------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
                  +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SLRGG L++T L GADG
Sbjct: 101 GPSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSLRGGTLLLTPLKGADG 160

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQLR 193
            +YA+AQG++ V G       S         G+IV GAIVER +P      +  L LQL 
Sbjct: 161 QVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERAVPNAIAQMNGVLQLQLN 220

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET 252
           + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V  
Sbjct: 221 DMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLAAPADSAQQVAFMARLQNLDVSP 276

Query: 253 D-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
           D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV   
Sbjct: 277 DKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVAQ 335

Query: 312 NTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            + +++  + G+  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++
Sbjct: 336 QSQIQLKQDNGALKMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADL 391


>gi|21231393|ref|NP_637310.1| flagellar basal body P-ring protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768554|ref|YP_243316.1| flagellar basal body P-ring protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|48474490|sp|Q8P9C0|FLGI_XANCP RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|81305474|sp|Q4UUH7|FLGI_XANC8 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|21113058|gb|AAM41234.1| flagellar protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66573886|gb|AAY49296.1| flagellar protein [Xanthomonas campestris pv. campestris str. 8004]
          Length = 372

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 145/348 (41%), Positives = 205/348 (58%), Gaps = 12/348 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P      
Sbjct: 28  RIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPANVNPQ 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV + A LPPFA PG  ID++++S+ +A SLRGG L+M  L GADG +YA+AQG+
Sbjct: 88  LKNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRGGSLLMAPLKGADGQVYAMAQGN 147

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G   +G+  S +   I + G+I NGA VER LP  F  S ++ L L   DF+T  R
Sbjct: 148 LVVGGFGAQGKDGSRVSVNIPSVGRIPNGATVERALPDVFAGSGEITLNLHQNDFTTVSR 207

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLTVETDTPARV 258
           +   I+    N F    A A D  TV V  PT+    I L   +  VE+     D PA+V
Sbjct: 208 MVAAID----NSFGAGTARAVDGVTVSVRSPTDPSARIGLLARLENVEL--SPGDAPAKV 261

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VT  +T    S
Sbjct: 262 VVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTPQSTIKATS 321

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +    F       L+ ++  +N +G     +++IL+ +K AGAL +E+
Sbjct: 322 EGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAEL 369


>gi|188991637|ref|YP_001903647.1| flagellar basal body P-ring protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|226701965|sp|B0RT12|FLGI_XANCB RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|167733397|emb|CAP51598.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 372

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 145/348 (41%), Positives = 205/348 (58%), Gaps = 12/348 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P      
Sbjct: 28  RIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPANVNPQ 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV + A LPPFA PG  ID++++S+ +A SLRGG L+M  L GADG +YA+AQG+
Sbjct: 88  LKNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRGGSLLMAPLKGADGQVYAMAQGN 147

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G   +G+  S +   I + G+I NGA VER LP  F  S ++ L L   DF+T  R
Sbjct: 148 LVVGGFGAQGKDGSRVSVNIPSVGRIPNGATVERALPDVFAGSGEITLNLHQNDFTTVSR 207

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLTVETDTPARV 258
           +   I+    N F    A A D  TV V  PT+    I L   +  VE+     D PA+V
Sbjct: 208 MVAAID----NSFGAGTARAVDGVTVSVRSPTDPSARIGLLARLENVEL--SPGDAPAKV 261

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VT  +T    S
Sbjct: 262 VVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTPQSTIKATS 321

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +    F       L+ ++  +N +G     +++IL+ +K AGAL +E+
Sbjct: 322 EGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAEL 369


>gi|51246536|ref|YP_066420.1| flagellar basal body P-ring protein [Desulfotalea psychrophila
           LSv54]
 gi|81641309|sp|Q6AJR7|FLGI_DESPS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|50877573|emb|CAG37413.1| probable flagellar P-ring protein (FlgI) [Desulfotalea psychrophila
           LSv54]
          Length = 390

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 144/369 (39%), Positives = 219/369 (59%), Gaps = 13/369 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           LIF+ I     +    SRIKD+  L   R NQLIGYGL+ GL GTGD ++ S FT Q++ 
Sbjct: 26  LIFTGINFSTSNDVQASRIKDIAQLHGVRSNQLIGYGLITGLNGTGDDMKKSAFTLQAIY 85

Query: 68  SLLQNLGISTPGGRLGS---KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           +++   GI+     + S   KNVAAVMVTA+LPPFAS GS+ID+ ++S+GDA SL GG L
Sbjct: 86  NMMTRSGITLNPSEMKSIKIKNVAAVMVTASLPPFASSGSKIDIQVSSMGDAKSLAGGTL 145

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           +MT L G D  +YA+AQG + +      G+S+   +     G+I +GA VE  +      
Sbjct: 146 LMTPLKGVDNRVYAIAQGPLAIGAFSFGGKSAQAQKNHPNAGRIPDGATVEDTVLVDIGA 205

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLM 242
              L  QL N DF+TA  +   IN     +F +  A   DS +V ++ P +    + + +
Sbjct: 206 DGTLTYQLANADFTTANNMTRAIN----KKFGKDTAYPLDSGSVTINIPPHFSKRVVQFV 261

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           + VE + +  D+ ARV++NERTGT+V+G NVR+S V VS+GNL + I E+  V QP    
Sbjct: 262 ANVESIDITADSVARVVVNERTGTVVMGQNVRLSTVAVSHGNLNLIIRESFDVSQPAPL- 320

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPD---LNSLISGMNSIGLKTDGIISILQGIKAA 359
           ++G TV   +T++ V++ +G   +++  +   +  + + +N+IG     +I+I Q IKAA
Sbjct: 321 ADGETVITPSTEISVTEEEGQLVVLNMKNDVSIGEIANALNAIGATPRDLIAIFQAIKAA 380

Query: 360 GALQSEIII 368
           GA+  E+I+
Sbjct: 381 GAMHGELIV 389


>gi|312884830|ref|ZP_07744522.1| flagellar basal body P-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367482|gb|EFP95042.1| flagellar basal body P-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 396

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 145/373 (38%), Positives = 229/373 (61%), Gaps = 23/373 (6%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+  L+     + +  + I D+V +Q  R+NQL+GYGLVVGL G GD      FT QS+
Sbjct: 35  LLLACLVSSSVFATKTTTPIMDLVDVQGVRENQLVGYGLVVGLDGQGDR-NQVKFTAQSI 93

Query: 67  RSLLQNLGI-----STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            ++L+  G+     + P  R    NVA+V VTA++ P A PG +++V ++S+GDA SLRG
Sbjct: 94  TNMLRQFGVQIDDSTNPKLR----NVASVSVTASVDPMAGPGQKLNVVVSSIGDAKSLRG 149

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPK 180
           G L++T L G DG +YAVAQG+VVV G+  +G+S S  +    T G+I  GA++ERE+  
Sbjct: 150 GTLLLTPLRGIDGEVYAVAQGNVVVGGISAEGKSGSKVVINTPTSGRIPGGAMLEREVVS 209

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----I 236
            F D   +IL LR P F+TA  I  ++N+     F   +A A ++  + +  P +    +
Sbjct: 210 DFADKEHIILNLRKPSFTTAKNIVREVNAV----FGPKVAVAKNNVRIDIQAPKDSQQRV 265

Query: 237 DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
            +  ++ E+++   +   PAR++ N RTGT+VIG +V++S+  VS+GNLTV I E ++V 
Sbjct: 266 VMMSMLEEIQV--TQGRKPARIVFNSRTGTVVIGKSVQVSEAAVSHGNLTVTIAEAKKVS 323

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQG 355
           QPNAF SNG T T + + L VS+ +    +  A  +LN++++ +NS+G     ++SILQ 
Sbjct: 324 QPNAF-SNGQTQTTDQSKLDVSEERAQMVVWPAGTELNTIVNAVNSLGATPTDLMSILQA 382

Query: 356 IKAAGALQSEIII 368
           +  AGAL +E+++
Sbjct: 383 LHEAGALNAELVV 395


>gi|253990123|ref|YP_003041479.1| flagellar basal body P-ring protein [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253781573|emb|CAQ84736.1| flagellar p-ring protein precursor (basal body p-ring protein)
           [Photorhabdus asymbiotica]
          Length = 371

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 155/349 (44%), Positives = 223/349 (63%), Gaps = 10/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLG 83
           RI+D+ ++Q  R+N LIGYGLVVGL GTGD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 27  RIRDLTTVQGVRENALIGYGLVVGLDGTGDQTTQTPFTTQSLSNMLSQLGITVPPGTNMQ 86

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LPPF   G  IDV ++SLG+A SLRGG L+MT L G D  IYA+AQG+
Sbjct: 87  LKNVAAVMVTAKLPPFGRAGQNIDVVVSSLGNAKSLRGGTLLMTPLKGVDNQIYALAQGN 146

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       SS       GG+I NGA++ERELP +F ++  L LQL N DFS A +I
Sbjct: 147 ILVGGAGASTGGSSVKVNQLAGGRISNGAVIERELPTQFGENGILNLQLNNEDFSLAQQI 206

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDT-PARVIIN 261
           +D IN       + P+    D+RTV++  P +  +  + +S V+ LT+  D   A+VIIN
Sbjct: 207 SDTINRMRGTGTATPL----DARTVQLRMPRDKSEQVKFLSHVQNLTIRVDVGDAKVIIN 262

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV-QPNAFSSNGSTVTQNNTDLKVSDN 320
            RTG++V+  NV +    V+ GNL+V + EN+ VV QPN   + GSTV   NT + V + 
Sbjct: 263 SRTGSVVMNRNVMLDSCAVAQGNLSVTV-ENQTVVNQPNTPLAGGSTVVTRNTGVAVREQ 321

Query: 321 KGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G+   ++A   LNS++  +N++G   + ++SILQ +++AG L++++ I
Sbjct: 322 GGALQRVNASASLNSVVQALNALGATPNDLMSILQAMESAGCLRAKLEI 370


>gi|238764396|ref|ZP_04625346.1| Flagellar P-ring protein [Yersinia kristensenii ATCC 33638]
 gi|238697422|gb|EEP90189.1| Flagellar P-ring protein [Yersinia kristensenii ATCC 33638]
          Length = 373

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 155/370 (41%), Positives = 223/370 (60%), Gaps = 10/370 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVS--RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           I   I  LI L  + +   S  RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT
Sbjct: 7   ITLFIMQLIVLFTLVSFPASAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFT 66

Query: 63  EQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+RG
Sbjct: 67  TQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRTGQTIDVVVSSMGNAKSIRG 126

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L G D  +YA+AQG+V+V G       SS      TGG+I NGA +ERELP  
Sbjct: 127 GTLLMTPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISNGATIERELPTT 186

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTR 240
           F     + LQL   DF+TA +++D IN      F    A A D+RT++V  P  N    R
Sbjct: 187 FGTDGVINLQLNTEDFTTAQQVSDAINRQ--RGFGS--ATAIDARTIQVLVPRGNSSQVR 242

Query: 241 LMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +++++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V I +   V QP+
Sbjct: 243 FLADIQNIPVNIDAGDAKVIINSRTGSVVMNRNVMLDSCAVAQGNLSVVIDKQNTVSQPD 302

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKA 358
                G TV   NT + V    G+   ++A P+LN+++  +NS+G     ++SILQ +++
Sbjct: 303 TPFGGGQTVVTPNTQISVQQQGGALQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQS 362

Query: 359 AGALQSEIII 368
           AG L++++ I
Sbjct: 363 AGCLRAKLEI 372


>gi|115353114|ref|YP_774953.1| flagellar basal body P-ring protein [Burkholderia ambifaria AMMD]
 gi|115283102|gb|ABI88619.1| flagellar P-ring protein [Burkholderia ambifaria AMMD]
          Length = 392

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 150/371 (40%), Positives = 213/371 (57%), Gaps = 25/371 (6%)

Query: 10  FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSL 69
           F   G H        R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++
Sbjct: 30  FGAPGAH------AERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANM 83

Query: 70  LQNLGISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           L NLGIS   G           +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SL
Sbjct: 84  LANLGISINNGSANGGPSSLSNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSL 143

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L++T L GADG +YA+AQG++ V G       S         G+IV GAIVER +P
Sbjct: 144 RGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERAVP 203

Query: 180 KKFKD-SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-ID 237
                 +  L LQL + D+ TA RI   +NS     F    A A D RT++++ P +   
Sbjct: 204 NAIAQMNGVLQLQLNDMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLAAPADSAQ 259

Query: 238 LTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V 
Sbjct: 260 QVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVS 319

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQG 355
           QP  F SNG TV    + +++  + G+  ++ A  +L  ++  +NS+G     ++SILQ 
Sbjct: 320 QPGPF-SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNSLGATPADLMSILQA 378

Query: 356 IKAAGALQSEI 366
           +KAAGAL++++
Sbjct: 379 MKAAGALRADL 389


>gi|66046702|ref|YP_236543.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           syringae B728a]
 gi|75501291|sp|Q4ZQR7|FLGI_PSEU2 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|63257409|gb|AAY38505.1| Flagellar P-ring protein [Pseudomonas syringae pv. syringae B728a]
          Length = 369

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 147/367 (40%), Positives = 215/367 (58%), Gaps = 15/367 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+ +  G+H        R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+ 
Sbjct: 12  LLLSTAFGVH------AERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPFTLQTF 65

Query: 67  RSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SLRGG L
Sbjct: 66  NNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSLRGGAL 125

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFK 183
           +MT + G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +P  F 
Sbjct: 126 LMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSVPSGFN 185

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               L L L   DF+TA RI D+IN          +A+A D  +V+V+ P +       +
Sbjct: 186 QGNTLTLNLNRSDFTTAKRIVDKINEL----LGPGVAQALDGGSVRVTAPLDPGQRVDYL 241

Query: 243 SEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E L V+   T A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP A 
Sbjct: 242 SILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGAL 301

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S   + V   +      +    F       L+ ++  +N +G     +++IL+ +K AGA
Sbjct: 302 SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGA 361

Query: 362 LQSEIII 368
           LQ+++I+
Sbjct: 362 LQADLIV 368


>gi|172061968|ref|YP_001809620.1| flagellar basal body P-ring protein [Burkholderia ambifaria MC40-6]
 gi|171994485|gb|ACB65404.1| flagellar P-ring protein [Burkholderia ambifaria MC40-6]
          Length = 394

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 150/371 (40%), Positives = 213/371 (57%), Gaps = 25/371 (6%)

Query: 10  FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSL 69
           F   G H        R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++
Sbjct: 32  FGAPGAH------AERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANM 85

Query: 70  LQNLGISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           L NLGIS   G           +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SL
Sbjct: 86  LANLGISINNGSANGGPSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSL 145

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L++T L GADG +YA+AQG++ V G       S         G+IV GAIVER +P
Sbjct: 146 RGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERSVP 205

Query: 180 KKFKD-SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-ID 237
                 +  L LQL + D+ TA RI   +NS     F    A A D RT++++ P +   
Sbjct: 206 NAIAQMNGVLQLQLNDMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLAAPADSAQ 261

Query: 238 LTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V 
Sbjct: 262 QVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVS 321

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQG 355
           QP  F SNG TV    + +++  + G+  ++ A  +L  ++  +NS+G     ++SILQ 
Sbjct: 322 QPGPF-SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNSLGATPADLMSILQA 380

Query: 356 IKAAGALQSEI 366
           +KAAGAL++++
Sbjct: 381 MKAAGALRADL 391


>gi|325916943|ref|ZP_08179187.1| flagellar basal-body P-ring protein [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536846|gb|EGD08598.1| flagellar basal-body P-ring protein [Xanthomonas vesicatoria ATCC
           35937]
          Length = 372

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 145/348 (41%), Positives = 205/348 (58%), Gaps = 12/348 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P      
Sbjct: 28  RIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPANVNPQ 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV + A LPPFA PG  ID++++S+ +A SLRGG L+M  L GADG +YA+AQG+
Sbjct: 88  LKNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRGGSLLMAPLKGADGQVYAMAQGN 147

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G   +G+  S +   I + G+I NGA VER LP  F  S ++ L L   DF+T  R
Sbjct: 148 LVVGGFGAQGKDGSRVSVNIPSVGRIPNGATVERALPDVFAGSGEITLNLHQNDFTTVSR 207

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLTVETDTPARV 258
           +   I+S     F    A A D  TV V  PT+    I L   +  VE+     D PA+V
Sbjct: 208 MVAAIDSS----FGAGTARAVDGVTVSVRSPTDPGARIGLLARLENVEL--SPGDAPAKV 261

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VT  +T    S
Sbjct: 262 VVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTPQSTITATS 321

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +    F       L+ ++  +N +G     +++IL+ +K AGAL +E+
Sbjct: 322 EGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAEL 369


>gi|167835116|ref|ZP_02461999.1| flagellar basal body P-ring protein [Burkholderia thailandensis
           MSMB43]
          Length = 401

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 47  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 106

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 107 GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 166

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 167 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAIAQMNGVLQLQL 226

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 227 NDMDYGTAQRIVSAVNSS----FGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 282

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 283 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 341

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 342 QQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|152997578|ref|YP_001342413.1| flagellar P-ring protein [Marinomonas sp. MWYL1]
 gi|189044485|sp|A6W199|FLGI_MARMS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|150838502|gb|ABR72478.1| flagellar P-ring protein [Marinomonas sp. MWYL1]
          Length = 362

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 145/364 (39%), Positives = 225/364 (61%), Gaps = 13/364 (3%)

Query: 11  SLIGLHEISAQV-VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSL 69
           +LI L+ +S  V   R+KD+ S+Q  R+NQL GYGLV+GL GTGDS   + FT QS  S+
Sbjct: 5   ALIVLYFLSFSVQAERLKDIASVQGVRENQLFGYGLVIGLNGTGDS---TAFTNQSFVSM 61

Query: 70  LQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTS 128
           L   G++ P G    SKNVAAV +TA LP F+ PG +IDV+++S+G+AS+LRGG L++++
Sbjct: 62  LSRFGVTLPEGVNATSKNVAAVSLTATLPAFSKPGQKIDVTVSSIGNASALRGGTLLLST 121

Query: 129 LLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEG-ISTGGKIVNGAIVERELPKKFKDSAD 187
           L GADG +YA+AQG++VV GL   G   S   G + T G+I NGA VER +P  F     
Sbjct: 122 LKGADGAVYAIAQGNLVVGGLGANGADGSRTTGNVPTVGRIPNGASVERIVPSSFNTGDT 181

Query: 188 LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVE 246
           L   L  PDF+TA ++ D+IN    N     +A   D+ +++VS P +       +S +E
Sbjct: 182 LTFNLNRPDFTTAKQVTDKIN----NLLGPGVATTLDATSIRVSAPRDSSQRVTYLSILE 237

Query: 247 MLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
            L VE  +  AR+++N RTGTI+IG +V++S   +++G+LTV I E   VV  +   + G
Sbjct: 238 NLDVEVAEERARIVVNSRTGTIIIGQHVKVSPAAITHGSLTVTIKEVPPVVGKDGTITGG 297

Query: 306 STVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
            T+      ++++ N G   + D    L+ ++  +N +G     +++IL+G+K AGA+ +
Sbjct: 298 QTIVSPREGIEIAPNSGHMFVFDPGASLDDIVRAVNQVGAAPGDVMAILEGLKQAGAINA 357

Query: 365 EIII 368
           ++++
Sbjct: 358 DLVV 361


>gi|226327740|ref|ZP_03803258.1| hypothetical protein PROPEN_01613 [Proteus penneri ATCC 35198]
 gi|225203444|gb|EEG85798.1| hypothetical protein PROPEN_01613 [Proteus penneri ATCC 35198]
          Length = 373

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 150/368 (40%), Positives = 221/368 (60%), Gaps = 16/368 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           F++ + +G    SA    RI+D+ S++  R+N LIGYGLVVGL GTGD    +PFT QS+
Sbjct: 15  FIVMTCVGF---SAHA-ERIRDLTSVEGVRENALIGYGLVVGLDGTGDQTMQTPFTTQSL 70

Query: 67  RSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  IDV ++SLG+A SLRGG L+
Sbjct: 71  NNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPPFGRTGQSIDVVVSSLGNAKSLRGGTLL 130

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MT L G D  IYA+AQG++VV G       +S       GG+I +GAI+ERELP +F  +
Sbjct: 131 MTPLKGVDNQIYALAQGNIVVGGAGASAGGNSVKVNQLAGGRISSGAIIERELPSQFGQT 190

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEA--YDSRTVKVSKPT-NIDLTRLM 242
             L LQL   +F+ A  I+D +N        R +  A   D+RTV++  P    +  R +
Sbjct: 191 GLLNLQLNEENFTLAQHISDTVNKL------RGVGTAIPLDARTVQLRVPIGKSEQVRFL 244

Query: 243 SEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           +EV+ L ++     A+VIIN RTG++V+  +V +    ++ GNL+V +     V QPN  
Sbjct: 245 AEVQNLEIKRVVADAKVIINARTGSVVMNRDVTLGSCAIAQGNLSVTVNSQVNVSQPNTP 304

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            + GSTV   NT + +S+  GS   ++A   LN ++  +N++G     ++SILQ +++AG
Sbjct: 305 FAGGSTVVTRNTSVNMSEQGGSLQQVNASASLNEVVRTLNALGATPTDLMSILQAMESAG 364

Query: 361 ALQSEIII 368
            L++ + I
Sbjct: 365 CLRARLEI 372


>gi|71735315|ref|YP_275557.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257484942|ref|ZP_05638983.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289627768|ref|ZP_06460722.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651641|ref|ZP_06482984.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|115311528|sp|Q48GC6|FLGI_PSE14 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|49205096|dbj|BAC75960.2| flagellar P-ring protein FlgI [Pseudomonas syringae pv. tabaci]
 gi|71555868|gb|AAZ35079.1| flagellar P-ring protein FlgI [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320325098|gb|EFW81167.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329357|gb|EFW85350.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330866427|gb|EGH01136.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330880531|gb|EGH14680.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330889078|gb|EGH21739.1| flagellar basal body P-ring protein [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330972418|gb|EGH72484.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           aceris str. M302273PT]
 gi|330986473|gb|EGH84576.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011047|gb|EGH91103.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 369

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 147/367 (40%), Positives = 215/367 (58%), Gaps = 15/367 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+ +  G+H        R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+ 
Sbjct: 12  LLLSTAFGVH------AERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPFTLQTF 65

Query: 67  RSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SLRGG L
Sbjct: 66  NNMLSQFGIKVPSGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSLRGGAL 125

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFK 183
           +MT + G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +P  F 
Sbjct: 126 LMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSVPSGFN 185

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               L L L   DF+TA RI D+IN          +A+A D  +V+V+ P +       +
Sbjct: 186 QGNTLTLNLNRSDFTTAKRIVDKINEL----LGPGVAQALDGGSVRVTAPLDPGQRVDYL 241

Query: 243 SEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E L V+   T A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP A 
Sbjct: 242 SILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGAL 301

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S   + V   +      +    F       L+ ++  +N +G     +++IL+ +K AGA
Sbjct: 302 SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGA 361

Query: 362 LQSEIII 368
           LQ+++I+
Sbjct: 362 LQADLIV 368


>gi|325923278|ref|ZP_08184951.1| flagellar basal-body P-ring protein [Xanthomonas gardneri ATCC
           19865]
 gi|325546205|gb|EGD17386.1| flagellar basal-body P-ring protein [Xanthomonas gardneri ATCC
           19865]
          Length = 372

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 144/348 (41%), Positives = 205/348 (58%), Gaps = 12/348 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P      
Sbjct: 28  RIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPANVNPQ 87

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV + A LPPFA PG  ID++++S+ +A SLRGG L+M  L GADG +YA+AQG+
Sbjct: 88  LKNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRGGSLLMAPLKGADGQVYAMAQGN 147

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G   +G+  S +   I + G+I NGA VER LP  F  + ++ L L   DF+T  R
Sbjct: 148 LVVGGFGAQGKDGSRVSVNIPSVGRIPNGATVERALPDVFAGTGEITLNLHQNDFTTVSR 207

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLTVETDTPARV 258
           +   I+    N F    A A D  TV V  PT+    I L   +  VE+     D PA+V
Sbjct: 208 MVAAID----NSFGAGTARAVDGVTVSVRSPTDPGARIGLLARLENVEL--SPGDAPAKV 261

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VT  +T    S
Sbjct: 262 VVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTPQSTITATS 321

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +    F       L+ ++  +N +G     +++IL+ +K AGAL +E+
Sbjct: 322 EGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAEL 369


>gi|206558972|ref|YP_002229732.1| flagellar basal body P-ring protein [Burkholderia cenocepacia
           J2315]
 gi|198035009|emb|CAR50881.1| flagellar P-ring protein precursor (basal body P-ring protein)
           [Burkholderia cenocepacia J2315]
          Length = 398

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 147/358 (41%), Positives = 211/358 (58%), Gaps = 19/358 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 45  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 104

Query: 81  ------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
                  +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SLRGG L++T L GADG
Sbjct: 105 GPSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSLRGGTLLLTPLKGADG 164

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQLR 193
            +YA+AQG++ V G       S         G+IV GAIVER +P      +  L LQL 
Sbjct: 165 QVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERAVPNAIAQMNGVLQLQLN 224

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET 252
           + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V  
Sbjct: 225 DMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLAAPADSAQQVAFMARLQNLDVSP 280

Query: 253 D-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
           D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV   
Sbjct: 281 DKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVAQ 339

Query: 312 NTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + +++  + G+  ++ A  +L  ++  +N++G     ++SILQ +KAAGAL++++ I
Sbjct: 340 QSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSILQAMKAAGALRADLEI 397


>gi|330808199|ref|YP_004352661.1| flagellar P-ring protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376307|gb|AEA67657.1| flagellar P-ring protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 371

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 146/369 (39%), Positives = 223/369 (60%), Gaps = 14/369 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            LI +L+     +AQ   R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+ 
Sbjct: 9   LLIGALVMSAAFTAQA-ERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPFTLQTF 67

Query: 67  RSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            ++L   GI  P G   +  KNVAAV ++A+LP FA PG ++D++++S+G++ SLRGG L
Sbjct: 68  NNMLSQFGIKVPAGSGNVQLKNVAAVSISADLPAFAKPGQQVDITVSSIGNSKSLRGGTL 127

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFK 183
           ++T L G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +P  F 
Sbjct: 128 LLTPLKGIDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAVPSGFN 187

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMS 243
               L L L   DF+TA RI D+IN    +     +A+A D  +++V+ P  +D ++ + 
Sbjct: 188 QGNSLTLNLNRSDFTTAKRIVDKIN----DMLGPGVAQALDGGSIRVTAP--LDPSQRVD 241

Query: 244 EVEML-TVETD---TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            + +L  +E D     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP 
Sbjct: 242 YLSILENLEVDPGQAVAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPG 301

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
             S+  + V   +      + K  F       L+ ++  +N +G     +++IL+ +K A
Sbjct: 302 PLSNGQTAVVPRSRVNAEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQA 361

Query: 360 GALQSEIII 368
           GALQ+++I+
Sbjct: 362 GALQADLIV 370


>gi|285018205|ref|YP_003375916.1| flagellar p-ring protein precursor (basal body p-ring protein
           [Xanthomonas albilineans GPE PC73]
 gi|283473423|emb|CBA15928.1| probable flagellar p-ring protein precursor (basal body p-ring
           protein [Xanthomonas albilineans]
          Length = 372

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 149/359 (41%), Positives = 214/359 (59%), Gaps = 20/359 (5%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
           ++     RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS++++L  LG++ 
Sbjct: 21  VAPAAAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNMLGELGVNV 80

Query: 78  PGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
           P     +L  KNVAAV ++A LPPFA PG  IDV+++S+G+A SLRGG L+MT L GADG
Sbjct: 81  PANVNPQL--KNVAAVAISAQLPPFAKPGQPIDVTVSSIGNAISLRGGSLLMTPLKGADG 138

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLR 193
            +YA+AQG++VV G   +G+  S +   + + G I NGA VER LP  F  S+++ L L 
Sbjct: 139 QVYAIAQGNLVVGGFGAQGKDGSRISVNVPSVGLIPNGATVERALPDVFGSSSEITLNLH 198

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLT 249
             DF+T  R+   +     N F    A A D  TV V  P++    I L   +  VE+  
Sbjct: 199 QADFTTVSRMVAALE----NTFGPGSAHAVDGSTVAVRSPSDQSARIGLLARIENVEL-- 252

Query: 250 VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
                PA+V++N RTGT+VIG  VR+S   +S+G+LTV I+E   V QPNA  SNG TV 
Sbjct: 253 SPGAAPAKVVVNARTGTVVIGAQVRVSPAAISHGSLTVTISEGTDVSQPNAL-SNGQTVA 311

Query: 310 QNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              + +  + N+GS  F       L+ ++  +N +G     +I+IL+ +K AGAL +E+
Sbjct: 312 TPKSTITAT-NEGSRMFKFEGGTSLDQIVRAVNEVGAAPGDLIAILEALKQAGALSAEL 369


>gi|33592483|ref|NP_880127.1| flagellar basal body P-ring protein [Bordetella pertussis Tohama I]
 gi|33572129|emb|CAE41671.1| flagellar P-ring protein precursor [Bordetella pertussis Tohama I]
 gi|332381900|gb|AEE66747.1| flagellar basal body P-ring protein [Bordetella pertussis CS]
          Length = 377

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 150/367 (40%), Positives = 217/367 (59%), Gaps = 11/367 (2%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           A L   L+G     A+   R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R + FT+QS
Sbjct: 17  AVLALELLGAGAAHAE---RLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTLFTQQS 73

Query: 66  MRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           + ++L  LGI+ P G  +  KNVAAVMVTA LP FA PG  +DV ++S+G+A SLRGG L
Sbjct: 74  LTNMLSQLGITVPQGSNMQLKNVAAVMVTATLPSFARPGQTVDVVVSSMGNAKSLRGGTL 133

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           +MT L GAD  +Y +AQG+++V G       SS       GG+I NGAIVER +P  +  
Sbjct: 134 LMTPLKGADNQVYVIAQGNLLVGGAGASAGGSSVQINQLNGGRISNGAIVERAVPTMYAQ 193

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT-RLMS 243
              + L++ N DF T    A  IN     +F    A A D R ++V  P +  +    MS
Sbjct: 194 DGMVYLEMNNTDFGTTQNAATAIN----RQFGAGTAMALDGRVIQVRGPLDPSMMPAFMS 249

Query: 244 EVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +VE L V      A+VIIN RTG++V+   V I +  V++GNL+V I    QV QP+   
Sbjct: 250 QVENLQVARAPATAKVIINARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVFQPDTPF 309

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           + G TV   NT ++V  + G+   +  + +L  ++  +N++G     +++ILQ +K AGA
Sbjct: 310 TEGQTVVVPNTQIEVRQDGGALQRVTTSANLADVVKALNALGATPQDLLAILQAMKTAGA 369

Query: 362 LQSEIII 368
           L++++ I
Sbjct: 370 LRADLEI 376


>gi|167568427|ref|ZP_02361301.1| flagellar basal body P-ring protein [Burkholderia oklahomensis
           C6786]
          Length = 398

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 147/358 (41%), Positives = 210/358 (58%), Gaps = 19/358 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+K++  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 45  RLKELAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 104

Query: 81  ------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
                  +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GADG
Sbjct: 105 GSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGADG 164

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQLR 193
            +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL 
Sbjct: 165 QVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAIAQMNGVLQLQLN 224

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET 252
           + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V  
Sbjct: 225 DMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVSP 280

Query: 253 D-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
           D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV   
Sbjct: 281 DKAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVAQ 339

Query: 312 NTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + +++  + G+  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 340 QSQIQLKQDNGALRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 397


>gi|302185578|ref|ZP_07262251.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           syringae 642]
 gi|330943212|gb|EGH45619.1| flagellar basal body P-ring protein [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 369

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 146/367 (39%), Positives = 215/367 (58%), Gaps = 15/367 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+ +  G+H        R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+ 
Sbjct: 12  LLLSTAFGVH------AERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPFTLQTF 65

Query: 67  RSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SLRGG L
Sbjct: 66  NNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSLRGGAL 125

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFK 183
           +MT + G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +P  F 
Sbjct: 126 LMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSVPSGFN 185

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               L L L   DF+TA R+ D+IN          +A+A D  +V+V+ P +       +
Sbjct: 186 QGNTLTLNLNRSDFTTAKRVVDKINEL----LGPGVAQALDGGSVRVTAPLDPGQRVDYL 241

Query: 243 SEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E L V+   T A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP A 
Sbjct: 242 SILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGAL 301

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S   + V   +      +    F       L+ ++  +N +G     +++IL+ +K AGA
Sbjct: 302 SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGA 361

Query: 362 LQSEIII 368
           LQ+++I+
Sbjct: 362 LQADLIV 368


>gi|238755320|ref|ZP_04616663.1| Flagellar P-ring protein [Yersinia ruckeri ATCC 29473]
 gi|238706456|gb|EEP98830.1| Flagellar P-ring protein [Yersinia ruckeri ATCC 29473]
          Length = 369

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 154/367 (41%), Positives = 223/367 (60%), Gaps = 13/367 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L  +L+ L  + A    RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+ 
Sbjct: 9   LFAALLSLVWLPASA-ERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSLS 67

Query: 68  SLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+RGG L+M
Sbjct: 68  NMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRTGQTIDVVVSSMGNAKSIRGGTLLM 127

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L G D  +YA+AQG+V+V G       SS       GG+I NGA +ERELP  F +S 
Sbjct: 128 TPLKGVDNQVYALAQGNVLVGGAGASSGGSSVTVNQLAGGRISNGATIERELPTTFGNSG 187

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPI--AEAYDSRTVKVSKPT-NIDLTRLMS 243
            + LQL N DF+ A +I+D IN       SR    A A D+RT++V  PT      R ++
Sbjct: 188 VINLQLNNEDFTLAQQISDAINR------SRGFGSATAIDARTIQVLVPTGGSSQVRFLA 241

Query: 244 EVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP+   
Sbjct: 242 DIQNIPVNVDPGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVSQPDTPF 301

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
             G TV   NT + V    G+   ++A P+LN++I  +N++G     ++SILQ +++AG 
Sbjct: 302 GGGQTVVTPNTQISVRQEGGALQKVNASPNLNNVIRALNTLGATPIDLMSILQAMESAGC 361

Query: 362 LQSEIII 368
           L +++ I
Sbjct: 362 LHAKLEI 368


>gi|330967095|gb|EGH67355.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 369

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 146/367 (39%), Positives = 215/367 (58%), Gaps = 15/367 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+ +  G+H        R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+ 
Sbjct: 12  LLLSAAFGVH------AERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPFTLQTF 65

Query: 67  RSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SLRGG L
Sbjct: 66  NNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSLRGGAL 125

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFK 183
           +MT + G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +P  F 
Sbjct: 126 LMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSVPSGFN 185

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               L L L   DF+TA R+ D+IN          +A+A D  +V+V+ P +       +
Sbjct: 186 QGNTLTLNLNRSDFTTAKRVVDKINDL----LGPGVAQALDGGSVRVTAPLDPGQRVDYL 241

Query: 243 SEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E L V+   T A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP A 
Sbjct: 242 SILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGAL 301

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S   + V   +      +    F       L+ ++  +N +G     +++IL+ +K AGA
Sbjct: 302 SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGA 361

Query: 362 LQSEIII 368
           LQ+++I+
Sbjct: 362 LQADLIV 368


>gi|90112112|sp|Q7VYG2|FLGI_BORPE RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 368

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 150/367 (40%), Positives = 217/367 (59%), Gaps = 11/367 (2%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           A L   L+G     A+   R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R + FT+QS
Sbjct: 8   AVLALELLGAGAAHAE---RLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTLFTQQS 64

Query: 66  MRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           + ++L  LGI+ P G  +  KNVAAVMVTA LP FA PG  +DV ++S+G+A SLRGG L
Sbjct: 65  LTNMLSQLGITVPQGSNMQLKNVAAVMVTATLPSFARPGQTVDVVVSSMGNAKSLRGGTL 124

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           +MT L GAD  +Y +AQG+++V G       SS       GG+I NGAIVER +P  +  
Sbjct: 125 LMTPLKGADNQVYVIAQGNLLVGGAGASAGGSSVQINQLNGGRISNGAIVERAVPTMYAQ 184

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT-RLMS 243
              + L++ N DF T    A  IN     +F    A A D R ++V  P +  +    MS
Sbjct: 185 DGMVYLEMNNTDFGTTQNAATAIN----RQFGAGTAMALDGRVIQVRGPLDPSMMPAFMS 240

Query: 244 EVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +VE L V      A+VIIN RTG++V+   V I +  V++GNL+V I    QV QP+   
Sbjct: 241 QVENLQVARAPATAKVIINARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVFQPDTPF 300

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           + G TV   NT ++V  + G+   +  + +L  ++  +N++G     +++ILQ +K AGA
Sbjct: 301 TEGQTVVVPNTQIEVRQDGGALQRVTTSANLADVVKALNALGATPQDLLAILQAMKTAGA 360

Query: 362 LQSEIII 368
           L++++ I
Sbjct: 361 LRADLEI 367


>gi|161579513|ref|YP_104802.2| flagellar basal body P-ring protein [Burkholderia mallei ATCC
           23344]
          Length = 397

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 43  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 102

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 103 GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 162

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 163 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 222

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 223 NDMDYGTAQRIVSAVNSS----FGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 278

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 279 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 337

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 338 QQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 396


>gi|325529018|gb|EGD06031.1| flagellar basal body P-ring protein [Burkholderia sp. TJI49]
          Length = 390

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 145/358 (40%), Positives = 211/358 (58%), Gaps = 19/358 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 37  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 96

Query: 81  ------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
                  +  KNVAAVM TA LPPFA PG  +DV+++SLG+A SLRGG L++T L GADG
Sbjct: 97  GASQLNNMQLKNVAAVMETATLPPFARPGEALDVTVSSLGNAKSLRGGTLLLTPLKGADG 156

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLI-LQLR 193
            +YA+AQG++ V G       S         G+IV GAIVER +P        ++ LQL 
Sbjct: 157 QVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERSVPNALAQMNGMLQLQLN 216

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET 252
           + D+ TA RI   +NS     F   +A A D RT++++ P +       M+ ++ L V  
Sbjct: 217 DMDYGTAQRIVSAVNS----NFGPGVATALDGRTIQLAAPADPAQQVAFMARLQNLDVSP 272

Query: 253 D-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
           D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV   
Sbjct: 273 DKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVAQ 331

Query: 312 NTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + +++  + G+  ++ A  +L  ++  +N++G     ++SILQ +KAAGAL++++ I
Sbjct: 332 QSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSILQAMKAAGALRADLEI 389


>gi|170703100|ref|ZP_02893920.1| flagellar P-ring protein [Burkholderia ambifaria IOP40-10]
 gi|170131997|gb|EDT00505.1| flagellar P-ring protein [Burkholderia ambifaria IOP40-10]
          Length = 394

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 149/371 (40%), Positives = 213/371 (57%), Gaps = 25/371 (6%)

Query: 10  FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSL 69
           F   G H        R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++
Sbjct: 32  FGAPGAH------AERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANM 85

Query: 70  LQNLGISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           L NLGIS   G           +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SL
Sbjct: 86  LANLGISINNGSANGGPSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSL 145

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L++T L GADG +YA+AQG++ V G       S         G+IV GAIVER +P
Sbjct: 146 RGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERSVP 205

Query: 180 KKFKD-SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-ID 237
                 +  L LQL + D+ TA RI   +NS     F    A A D RT++++ P +   
Sbjct: 206 NAIAQMNGVLQLQLNDMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLAAPADSAQ 261

Query: 238 LTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V 
Sbjct: 262 QVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVS 321

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQG 355
           QP  F SNG TV    + +++  + G+  ++ A  +L  ++  +N++G     ++SILQ 
Sbjct: 322 QPGPF-SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSILQA 380

Query: 356 IKAAGALQSEI 366
           +KAAGAL++++
Sbjct: 381 MKAAGALRADL 391


>gi|330961203|gb|EGH61463.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 369

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 146/367 (39%), Positives = 215/367 (58%), Gaps = 15/367 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+ +  G+H        R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+ 
Sbjct: 12  LLLSTAFGVH------AERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPFTLQTF 65

Query: 67  RSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SLRGG L
Sbjct: 66  NNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSLRGGAL 125

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFK 183
           +MT + G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +P  F 
Sbjct: 126 LMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSVPSGFN 185

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               L L L   DF+TA R+ D+IN          +A+A D  +V+V+ P +       +
Sbjct: 186 QGNTLTLNLNRSDFTTAKRVVDKINDL----LGPGVAQALDGGSVRVTAPLDPGQRVDYL 241

Query: 243 SEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E L V+   T A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP A 
Sbjct: 242 SILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGAL 301

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S   + V   +      +    F       L+ ++  +N +G     +++IL+ +K AGA
Sbjct: 302 SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGA 361

Query: 362 LQSEIII 368
           LQ+++I+
Sbjct: 362 LQADLIV 368


>gi|76579516|gb|ABA48991.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1710b]
          Length = 369

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 15  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 74

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 75  GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 134

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 135 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 194

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 195 NDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 250

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 251 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 309

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 310 QQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 368


>gi|330953729|gb|EGH53989.1| flagellar basal body P-ring protein [Pseudomonas syringae Cit 7]
          Length = 369

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 144/369 (39%), Positives = 217/369 (58%), Gaps = 19/369 (5%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+ +  G+H        R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+ 
Sbjct: 12  LLLSAAFGVH------AERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPFTLQTF 65

Query: 67  RSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SLRGG L
Sbjct: 66  NNMLSQFGIKVPSGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSLRGGAL 125

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFK 183
           +MT + G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +P  F 
Sbjct: 126 LMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERAVPSGFN 185

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLT 239
               L L L   DF+TA R+ D+IN    +     +A+A D  +V+V+ P +    +D  
Sbjct: 186 QGNTLTLNLNRSDFTTAKRVVDKIN----DMLGPGVAQALDGGSVRVTAPLDPSQRVDYL 241

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            ++  +E+   +  T A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP 
Sbjct: 242 SILENLEIDPGQ--TAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPG 299

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           A S   + V   +      +    F       L+ ++  +N +G     +++IL+ +K A
Sbjct: 300 ALSGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQA 359

Query: 360 GALQSEIII 368
           GALQ+++I+
Sbjct: 360 GALQADLIV 368


>gi|126441723|ref|YP_001057326.1| flagellar basal body P-ring protein [Burkholderia pseudomallei 668]
 gi|126221216|gb|ABN84722.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 668]
          Length = 400

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 46  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 105

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 106 GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 165

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 166 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 225

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 226 NDMDYGTAQRIVSAVNSS----FGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 281

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 282 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 340

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 341 QQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 399


>gi|124383419|ref|YP_001028056.1| flagellar basal body P-ring protein [Burkholderia mallei NCTC
           10229]
 gi|134283650|ref|ZP_01770349.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 305]
 gi|254182136|ref|ZP_04888733.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1655]
 gi|254207234|ref|ZP_04913585.1| flagellar P-ring protein [Burkholderia mallei JHU]
 gi|124291439|gb|ABN00708.1| flagellar P-ring protein [Burkholderia mallei NCTC 10229]
 gi|134245059|gb|EBA45154.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 305]
 gi|147752776|gb|EDK59842.1| flagellar P-ring protein [Burkholderia mallei JHU]
 gi|184212674|gb|EDU09717.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1655]
          Length = 400

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 46  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 105

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 106 GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 165

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 166 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 225

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 226 NDMDYGTAQRIVSAVNSS----FGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 281

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 282 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 340

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 341 QQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 399


>gi|121598477|ref|YP_994295.1| flagellar basal body P-ring protein [Burkholderia mallei SAVP1]
 gi|167001542|ref|ZP_02267337.1| flagellar P-ring protein [Burkholderia mallei PRL-20]
 gi|167717665|ref|ZP_02400901.1| flagellar basal body P-ring protein [Burkholderia pseudomallei
           DM98]
 gi|167736708|ref|ZP_02409482.1| flagellar basal body P-ring protein [Burkholderia pseudomallei 14]
 gi|167892416|ref|ZP_02479818.1| flagellar basal body P-ring protein [Burkholderia pseudomallei
           7894]
 gi|217424961|ref|ZP_03456457.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 576]
 gi|237810465|ref|YP_002894916.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei MSHR346]
 gi|238562528|ref|ZP_00440319.2| flagellar P-ring protein FlgI [Burkholderia mallei GB8 horse 4]
 gi|254201899|ref|ZP_04908263.1| flagellar P-ring protein [Burkholderia mallei FMH]
 gi|121227287|gb|ABM49805.1| flagellar P-ring protein [Burkholderia mallei SAVP1]
 gi|147747793|gb|EDK54869.1| flagellar P-ring protein [Burkholderia mallei FMH]
 gi|217391981|gb|EEC32007.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 576]
 gi|237505619|gb|ACQ97937.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei MSHR346]
 gi|238522493|gb|EEP85937.1| flagellar P-ring protein FlgI [Burkholderia mallei GB8 horse 4]
 gi|243062742|gb|EES44928.1| flagellar P-ring protein [Burkholderia mallei PRL-20]
          Length = 401

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 47  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 106

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 107 GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 166

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 167 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 226

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 227 NDMDYGTAQRIVSAVNSS----FGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 282

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 283 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 341

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 342 QQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|260779343|ref|ZP_05888235.1| flagellar P-ring protein FlgI [Vibrio coralliilyticus ATCC BAA-450]
 gi|260605507|gb|EEX31802.1| flagellar P-ring protein FlgI [Vibrio coralliilyticus ATCC BAA-450]
          Length = 403

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 229/372 (61%), Gaps = 21/372 (5%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+ SL       A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      FT QS+
Sbjct: 42  LLVLSLGAALPAQAEVEIPIMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKFTAQSI 100

Query: 67  RSLLQNLGI-----STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            ++L+  G+     + P  R    NVA+V VTA + P A  G  ++V ++S+GDA SLRG
Sbjct: 101 TNMLRQFGVQIDDSTNPKLR----NVASVSVTATVEPMAGAGQTLNVVVSSIGDAKSLRG 156

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPK 180
           G L++T L G DG +YAVAQG+VVV G+  +G+S S  +    T G+I  GA +ERE+P 
Sbjct: 157 GTLLLTPLRGIDGEVYAVAQGNVVVGGVSAEGKSGSKIVINTPTSGRIPGGATLEREVPN 216

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLT 239
            F +  +++L LR P F+TA  IA +IN    N F   +A A ++  + V  P +     
Sbjct: 217 DFSEQDNVVLNLRKPSFTTAKNIAREIN----NIFGPKVAVAKNNVRISVKAPKDSQQRV 272

Query: 240 RLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
            +MS +E ++V E   PAR++ N RTGT+VIG +V++S+  VS+GNLTV I E++QV QP
Sbjct: 273 VMMSMLEEISVAEGRKPARIVFNSRTGTVVIGKSVKVSEAAVSHGNLTVTIAESQQVSQP 332

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISILQGI 356
           NAF ++G T   + + L VS+ +    +I  P  +LN+++S +NS+G     ++SILQ +
Sbjct: 333 NAF-ADGETKVVDQSLLDVSEEQAQM-VIWPPGTELNTIVSAVNSLGATPTDLMSILQAL 390

Query: 357 KAAGALQSEIII 368
             AGAL +E+++
Sbjct: 391 HEAGALNAELVV 402


>gi|81603728|sp|Q62ES6|FLGI_BURMA RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|52427992|gb|AAU48585.1| flagellar P-ring protein [Burkholderia mallei ATCC 23344]
          Length = 389

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 35  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 94

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 95  GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 154

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 155 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 214

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 215 NDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 270

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 271 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 329

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 330 QQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 388


>gi|157376212|ref|YP_001474812.1| flagellar basal body P-ring protein [Shewanella sediminis HAW-EB3]
 gi|157318586|gb|ABV37684.1| flagellar P-ring protein [Shewanella sediminis HAW-EB3]
          Length = 363

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 151/366 (41%), Positives = 219/366 (59%), Gaps = 16/366 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           FL+  + G  +       RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   +TEQ+ 
Sbjct: 9   FLLLLVCGTSQ-----AQRIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTR---YTEQTF 60

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           +++L+N GI+ P   R   KNVA V V+A +P F  PG  +DV+++SLG+A SLRGG+L+
Sbjct: 61  KTMLKNFGINLPDNFRPKIKNVAVVAVSAVMPAFIKPGQTLDVTVSSLGEAKSLRGGMLL 120

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
            T + G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGA+VER +   F  
Sbjct: 121 QTFMKGVDGNVYAIAQGSMVVSGFSAEGLDGSKVIQNTPTVGRIPNGAMVERTVTTPFST 180

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMS 243
              L   LR  DFSTA R+AD IN       +RP+    D+ +V+VS P ++      ++
Sbjct: 181 GDHLTFNLRRADFSTAKRLADAINELLGPGMARPL----DAASVQVSAPRDVSQRVSFLA 236

Query: 244 EVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E + VE  +  A+VI+N RTGTIV+G +VR+    V++G LTV I E  QV QPN  +
Sbjct: 237 TLENIQVEPASESAKVIVNSRTGTIVVGKDVRLLPAAVTHGGLTVTIAEATQVSQPNPLA 296

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
              + VT N+T     ++   F       L+ L+  +N +G     +++IL+ +K AGAL
Sbjct: 297 GGQTVVTSNSTIDASEEDSRMFMFNPGTSLDELVRAVNLVGAAPSDVLAILEALKVAGAL 356

Query: 363 QSEIII 368
             E+II
Sbjct: 357 HGELII 362


>gi|254251195|ref|ZP_04944513.1| Flagellar basal-body P-ring protein [Burkholderia dolosa AUO158]
 gi|124893804|gb|EAY67684.1| Flagellar basal-body P-ring protein [Burkholderia dolosa AUO158]
          Length = 398

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 145/358 (40%), Positives = 211/358 (58%), Gaps = 19/358 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 45  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 104

Query: 81  ------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
                  +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SLRGG L++T L GADG
Sbjct: 105 GSSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSLRGGTLLLTPLKGADG 164

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLI-LQLR 193
            +YA+AQG++ V G       S         G+IV GAIVER +P        ++ LQL 
Sbjct: 165 QVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERAVPNAVAQMNGMLQLQLN 224

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET 252
           + D+ TA RI   +N+     F    A A D RT++++ P +       M+ ++ L V  
Sbjct: 225 DMDYGTAQRIVSAVNA----SFGPGTATALDGRTIQLAAPADSAQQVAFMARLQNLDVSP 280

Query: 253 D-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
           D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV   
Sbjct: 281 DKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVAQ 339

Query: 312 NTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + +++  + G+  ++ A  +L  ++  +N++G     ++SILQ +KAAGAL++++ I
Sbjct: 340 QSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSILQAMKAAGALRADLEI 397


>gi|32490794|ref|NP_871048.1| flagellar basal body P-ring protein [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|31340089|sp|Q8D3F6|FLGI_WIGBR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|25166000|dbj|BAC24191.1| flgI [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 370

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 146/358 (40%), Positives = 214/358 (59%), Gaps = 14/358 (3%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           SA    RI+D+ ++   RDN LIGYGLVVGL GTGD    +PFT QS+R++L  LG+S P
Sbjct: 18  SASKAERIRDLTTIVGVRDNVLIGYGLVVGLDGTGDQTTQTPFTIQSLRNMLSQLGVSIP 77

Query: 79  GG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
            G  +  KN+AAVMVTA LPPF   G +IDV ++SLG A SLRGG L++T L G D  IY
Sbjct: 78  SGINMQLKNIAAVMVTAKLPPFVKIGQKIDVMVSSLGSAKSLRGGTLLITPLKGVDNQIY 137

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           A+AQG+++VSG   +   ++       GG+I  GAI+E+ +   F     + LQL N DF
Sbjct: 138 ALAQGNILVSGFGAQSGGNTSQVNQLNGGRISEGAIIEKSIKTDFDKREIITLQLNNNDF 197

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKV------SKPTNIDLTRLMSEVEMLTVE 251
           S A +I+D IN+Y    F +  A   DSRT+ V       K   +     +  + ++   
Sbjct: 198 SLAQQISDAINTY----FGKKSAYPTDSRTINVILSASYDKSEKVKFIARLQNIPIIIGP 253

Query: 252 TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
           +D  A ++IN RTG++VI   V ++   V++G LTV+I +  +V QPN     GSTV   
Sbjct: 254 SD--AIIVINSRTGSVVINKEVMLNSCAVAHGELTVEIKKRTKVNQPNTILGGGSTVVTP 311

Query: 312 NTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            T++ + +   S   I  + +LN +IS +NSIG K + +++IL+ +K+AG L +++ I
Sbjct: 312 ETEILIKNQGDSLQEISSSTNLNEVISSLNSIGAKPNDLMAILESMKSAGCLNAKLEI 369


>gi|254188068|ref|ZP_04894580.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei Pasteur
           52237]
 gi|157935748|gb|EDO91418.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei Pasteur
           52237]
          Length = 400

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 46  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 105

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 106 GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 165

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 166 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 225

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 226 NDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 281

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 282 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 340

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 341 QQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 399


>gi|126451759|ref|YP_001064568.1| flagellar basal body P-ring protein [Burkholderia pseudomallei
           1106a]
 gi|167813807|ref|ZP_02445487.1| flagellar basal body P-ring protein [Burkholderia pseudomallei 91]
 gi|167822324|ref|ZP_02453795.1| flagellar basal body P-ring protein [Burkholderia pseudomallei 9]
 gi|167909132|ref|ZP_02496223.1| flagellar basal body P-ring protein [Burkholderia pseudomallei 112]
 gi|226199750|ref|ZP_03795301.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei Pakistan
           9]
 gi|242315232|ref|ZP_04814248.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1106b]
 gi|254259711|ref|ZP_04950765.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1710a]
 gi|126225401|gb|ABN88941.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1106a]
 gi|225928101|gb|EEH24137.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei Pakistan
           9]
 gi|242138471|gb|EES24873.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1106b]
 gi|254218400|gb|EET07784.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1710a]
          Length = 401

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 47  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 106

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 107 GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 166

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 167 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 226

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 227 NDMDYGTAQRIVSAVNSS----FGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 282

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 283 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 341

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 342 QQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|270262397|ref|ZP_06190668.1| flagellar basal body P-ring protein [Serratia odorifera 4Rx13]
 gi|270043081|gb|EFA16174.1| flagellar basal body P-ring protein [Serratia odorifera 4Rx13]
          Length = 366

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 152/366 (41%), Positives = 220/366 (60%), Gaps = 9/366 (2%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           FL+  +I    + A    RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+
Sbjct: 5   FLMALVICALSLPA-TAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSL 63

Query: 67  RSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++L  LGI+ P G  +  KNVAAVMVTA LPPF+  G  IDV ++S+G+A SLRGG L+
Sbjct: 64  SNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPPFSRTGQNIDVVVSSMGNAKSLRGGTLL 123

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MT L G D  +YA+AQG+V+V G       SS       GG+I NGA +ERELP  F + 
Sbjct: 124 MTPLKGVDNQVYALAQGNVLVGGAGAASGGSSVQVNQLAGGRISNGATIERELPTTFGNG 183

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSE 244
             + LQL N DF+ A +I+D IN       + P+    D+RT++V  P  N    R ++E
Sbjct: 184 GVINLQLNNEDFTLAQQISDAINRQRGGGTASPL----DARTIQVLVPQGNSSQVRFLAE 239

Query: 245 VEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           ++ + V      A+VIIN RTG++V+  +V +    V+ GNL+V +     V QPN    
Sbjct: 240 IQNINVSVGAIDAKVIINSRTGSVVMNRDVILDSCAVAQGNLSVVVDRQNTVSQPNTPFG 299

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G TV   NT + V    GS   ++A  +LN++I  +N++G     ++SILQ +++AG L
Sbjct: 300 GGQTVVTPNTQISVQQQGGSLQKVNASANLNNVIRALNALGATPIDLMSILQAMQSAGCL 359

Query: 363 QSEIII 368
           ++++ I
Sbjct: 360 RAKLEI 365


>gi|161723212|ref|YP_106904.2| flagellar basal body P-ring protein [Burkholderia pseudomallei
           K96243]
 gi|162210073|ref|YP_331884.2| flagellar basal body P-ring protein [Burkholderia pseudomallei
           1710b]
          Length = 397

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 43  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 102

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 103 GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 162

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 163 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 222

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 223 NDMDYGTAQRIVSAVNSS----FGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 278

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 279 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 337

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 338 QQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 396


>gi|126450185|ref|YP_001082863.1| flagellar basal body P-ring protein [Burkholderia mallei NCTC
           10247]
 gi|167917168|ref|ZP_02504259.1| flagellar basal body P-ring protein [Burkholderia pseudomallei
           BCC215]
 gi|254174943|ref|ZP_04881604.1| flagellar P-ring protein [Burkholderia mallei ATCC 10399]
 gi|254359736|ref|ZP_04976007.1| flagellar P-ring protein [Burkholderia mallei 2002721280]
 gi|126243055|gb|ABO06148.1| flagellar P-ring protein [Burkholderia mallei NCTC 10247]
 gi|148028950|gb|EDK86882.1| flagellar P-ring protein [Burkholderia mallei 2002721280]
 gi|160695988|gb|EDP85958.1| flagellar P-ring protein [Burkholderia mallei ATCC 10399]
          Length = 394

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 40  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 99

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 100 GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 159

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 160 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 219

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 220 NDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 275

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 276 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 334

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 335 QQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 393


>gi|254196982|ref|ZP_04903406.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei S13]
 gi|254295818|ref|ZP_04963275.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 406e]
 gi|52208332|emb|CAH34265.1| flagellar P-ring protein precuror [Burkholderia pseudomallei
           K96243]
 gi|157805661|gb|EDO82831.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 406e]
 gi|169653725|gb|EDS86418.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei S13]
          Length = 394

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 40  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 99

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 100 GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 159

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 160 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 219

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 220 NDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 275

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 276 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 334

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 335 QQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 393


>gi|167900913|ref|ZP_02488118.1| flagellar basal body P-ring protein [Burkholderia pseudomallei NCTC
           13177]
          Length = 401

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 47  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 106

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 107 GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 166

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 167 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 226

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 227 NDMDYGTAQRIVSAVNSS----FGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 282

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 283 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 341

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 342 QQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|90112113|sp|Q63YB1|FLGI_BURPS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 389

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 35  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 94

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 95  GGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 154

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 155 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 214

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 215 NDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 270

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 271 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 329

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 330 QQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 388


>gi|238751766|ref|ZP_04613254.1| Flagellar P-ring protein [Yersinia rohdei ATCC 43380]
 gi|238710037|gb|EEQ02267.1| Flagellar P-ring protein [Yersinia rohdei ATCC 43380]
          Length = 373

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 150/364 (41%), Positives = 223/364 (61%), Gaps = 9/364 (2%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           + ++I L  +SA    RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+ +
Sbjct: 14  LIAVISLLPLSASA-ERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSLSN 72

Query: 69  LLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+RGG L+MT
Sbjct: 73  MLSQLGITVPAGTNMQLKNVAAVMVTAKLPAFSRTGQTIDVVVSSMGNAKSIRGGTLLMT 132

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD 187
            L G D  +YA+AQG+V+V G       SS      TGG+I NGA +ERELP  F     
Sbjct: 133 PLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISNGATIERELPTTFGTDGV 192

Query: 188 LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVE 246
           + LQL   DF+TA +++D IN     +     A A D+RT++V  P  +    R +++++
Sbjct: 193 INLQLNTDDFTTAQQVSDAIN----RQRGLGSATAIDARTIQVLVPRGSSSQVRFLADIQ 248

Query: 247 MLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
            + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP+     G
Sbjct: 249 NIPVNVDAGDAKVIINSRTGSVVMNRNVMLDSCAVAQGNLSVVVDKQNTVSQPDTPFGGG 308

Query: 306 STVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
            TV   NT + V    G+   ++A P+LN+++  +NS+G     ++SILQ +++AG L++
Sbjct: 309 QTVVTPNTQISVQQQGGALQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQSAGCLRA 368

Query: 365 EIII 368
           ++ I
Sbjct: 369 KLEI 372


>gi|322432972|ref|YP_004210221.1| flagellar P-ring protein [Acidobacterium sp. MP5ACTX9]
 gi|321165199|gb|ADW70903.1| flagellar P-ring protein [Acidobacterium sp. MP5ACTX9]
          Length = 382

 Score =  245 bits (626), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 143/345 (41%), Positives = 217/345 (62%), Gaps = 10/345 (2%)

Query: 26  IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSK 85
           ++D+  ++  RDNQL+GYGLVVGL+GTGD  + + FT Q++ + ++ +G+    G++  K
Sbjct: 41  LRDITDIEGVRDNQLVGYGLVVGLRGTGDR-QQTYFTVQTLANAMKRMGVQIAPGQVVVK 99

Query: 86  NVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVV 145
           NVAAV +T +LPPFA PGS++D++++S GDA SL GG+L+MTSL G DG +YA AQG + 
Sbjct: 100 NVAAVFITGSLPPFARPGSKLDITVSSAGDAKSLEGGVLLMTSLRGPDGQVYAEAQGPLA 159

Query: 146 VSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           + G + +G +         T G+I  GAIVER+          + L LRNPDF+ A  +A
Sbjct: 160 LGG-YSEGTAGQLHSVNHPTVGRIPEGAIVERDANVDLSHFHTVSLMLRNPDFTAARDMA 218

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVK--VSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           + IN      F   +A   DSRTV+  V+      +  L+S V+ L++   +PA+V INE
Sbjct: 219 EAIN----KDFQHTVATPIDSRTVQIDVAGAGASSVPILISRVQSLSIPFHSPAKVTINE 274

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGTIV+G +V +S V V +G+L++++     V QP  FSS G+T    NT L V D   
Sbjct: 275 RTGTIVMGGSVTLSPVSVLHGSLSIEVETTYTVSQPLPFSSGGTTQPVANTVLAVKDLPA 334

Query: 323 -SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            S  L +  +++ LI G+++IG  +  I++ILQ IK+AG LQ+++
Sbjct: 335 QSIRLENGANVDDLIRGLHAIGATSHDIVAILQAIKSAGGLQADL 379


>gi|121997315|ref|YP_001002102.1| flagellar basal body P-ring protein [Halorhodospira halophila SL1]
 gi|121588720|gb|ABM61300.1| flagellar P-ring protein [Halorhodospira halophila SL1]
          Length = 371

 Score =  245 bits (626), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 149/355 (41%), Positives = 208/355 (58%), Gaps = 14/355 (3%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           S     RIKD+ S+   R NQL+GYGLVVGL GTGD    +PFTEQS+RS+L + G++ P
Sbjct: 25  SVSAAERIKDIASVGGVRSNQLVGYGLVVGLDGTGDD---TPFTEQSVRSMLASQGVNIP 81

Query: 79  GG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
                 + N AAVM+TA LP F  PG +IDVS++SLGDA SL+GG L+MT L  ADG +Y
Sbjct: 82  HDVDPDADNTAAVMITAELPAFTRPGQQIDVSVSSLGDADSLQGGELLMTPLRAADGEVY 141

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           AVAQG VV+ G     + +        GG I NGA+VER +   F+D  +++L L  PDF
Sbjct: 142 AVAQGRVVIGGF--GAEDTEIPVDNQLGGSIPNGAMVERRIDTGFQDRDEVVLNLHEPDF 199

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET-DTP 255
           +TA R A+ IN     R +R    A D+ +V+V  P + D     +S +E L VE  + P
Sbjct: 200 TTARRTAEVINHNLGPRTAR----AEDAGSVRVRAPQDSDQRVSFISFLEELRVEPGEAP 255

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN--EQVVQPNAFSSNGSTVTQNNT 313
           A VI+N RTGTIV+G NVR+    VS+GN+TV I     EQ+ +          V     
Sbjct: 256 AEVIVNARTGTIVMGSNVRVRPAAVSHGNMTVAIGAGGPEQIAEDPFGLDEPLMVPDEEM 315

Query: 314 DLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           D  +     +F      DL+ ++  +N++G     +++IL+ +K AGAL++E+ I
Sbjct: 316 DEGLEGENPAFVFQAGADLDEIVDAINAVGAAPGDLVAILEALKRAGALRAELTI 370


>gi|28869146|ref|NP_791765.1| flagellar P-ring protein FlgI [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213967577|ref|ZP_03395725.1| flagellar P-ring protein FlgI [Pseudomonas syringae pv. tomato T1]
 gi|301385718|ref|ZP_07234136.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           tomato Max13]
 gi|302060069|ref|ZP_07251610.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           tomato K40]
 gi|302134828|ref|ZP_07260818.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|38372194|sp|Q884Z4|FLGI_PSESM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|28852386|gb|AAO55460.1| flagellar P-ring protein FlgI [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213927878|gb|EEB61425.1| flagellar P-ring protein FlgI [Pseudomonas syringae pv. tomato T1]
 gi|331017020|gb|EGH97076.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 369

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 146/367 (39%), Positives = 214/367 (58%), Gaps = 15/367 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+ +  G H        R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+ 
Sbjct: 12  LLLSAAFGAH------AERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPFTLQTF 65

Query: 67  RSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SLRGG L
Sbjct: 66  NNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSLRGGAL 125

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFK 183
           +MT + G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +P  F 
Sbjct: 126 LMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSVPSGFN 185

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               L L L   DF+TA R+ D+IN          +A+A D  +V+V+ P +       +
Sbjct: 186 QGNTLTLNLNRSDFTTAKRVVDKINEL----LGPGVAQALDGGSVRVTAPLDPGQRVDYL 241

Query: 243 SEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E L V+   T A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP A 
Sbjct: 242 SILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGAL 301

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S   + V   +      +    F       L+ ++  +N +G     +++IL+ +K AGA
Sbjct: 302 SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGA 361

Query: 362 LQSEIII 368
           LQ+++I+
Sbjct: 362 LQADLIV 368


>gi|330875988|gb|EGH10137.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 369

 Score =  245 bits (625), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 146/367 (39%), Positives = 214/367 (58%), Gaps = 15/367 (4%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+ +  G H        R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+ 
Sbjct: 12  LLLSAAFGAH------AERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPFTLQTF 65

Query: 67  RSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SLRGG L
Sbjct: 66  NNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSLRGGAL 125

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFK 183
           +MT + G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +P  F 
Sbjct: 126 LMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSVPSGFN 185

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               L L L   DF+TA R+ D+IN          +A+A D  +V+V+ P +       +
Sbjct: 186 QGNTLTLNLNRSDFTTAKRVVDKINDL----LGPGVAQALDGGSVRVTAPLDPGQRVDYL 241

Query: 243 SEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E L V+   T A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP A 
Sbjct: 242 SILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGAL 301

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S   + V   +      +    F       L+ ++  +N +G     +++IL+ +K AGA
Sbjct: 302 SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGA 361

Query: 362 LQSEIII 368
           LQ+++I+
Sbjct: 362 LQADLIV 368


>gi|238919263|ref|YP_002932778.1| flagellar basal body P-ring protein [Edwardsiella ictaluri 93-146]
 gi|238868832|gb|ACR68543.1| flagellar P-ring protein FlgI [Edwardsiella ictaluri 93-146]
          Length = 379

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 152/370 (41%), Positives = 224/370 (60%), Gaps = 10/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           F +  ++ +L GL    AQ   RI+D+ ++Q  R N LIGYGLVVGL GTGD    +PFT
Sbjct: 15  FWLTGVLLAL-GLLSQGAQA-ERIRDLTTIQGVRSNALIGYGLVVGLDGTGDQTMQTPFT 72

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+ ++L  LGI+ P G  +  KNVAAVMVTANLPPFA PG  IDV ++S+G+A SLRG
Sbjct: 73  TQSLTNMLSQLGITVPAGTNMQLKNVAAVMVTANLPPFARPGQTIDVVVSSMGNAKSLRG 132

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L G D  +YA+AQG+++V G       SS       GG+I  GA +ER +P  
Sbjct: 133 GTLLMTPLKGVDNQVYALAQGNILVGGAGASAGGSSVQVNQLAGGRISGGATIERSVPTT 192

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTR 240
           F     + L+L N +F+ A RI+D IN  +    + P+    D+RTV+V  P    +  R
Sbjct: 193 FGHGNVINLELNNENFTLAERISDAINRANGLGSATPL----DARTVQVLVPQGGSNQVR 248

Query: 241 LMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
           +++ ++ + V   T  A+VIIN RTG++V+  NV +    V+ GNL+V +     V QPN
Sbjct: 249 VLANIQNIEVNAGTFDAKVIINSRTGSVVMNRNVELDSCAVAQGNLSVVVDRQLNVSQPN 308

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKA 358
                G TV   NT + V+ + G+   + A  +LNS++  +N++G   + ++SILQ +K+
Sbjct: 309 TPLGGGQTVVTPNTQISVNQSGGALHQVRAGANLNSVVRALNALGATPNDLMSILQAMKS 368

Query: 359 AGALQSEIII 368
           AG L++++ I
Sbjct: 369 AGCLRAKLEI 378


>gi|167617590|ref|ZP_02386221.1| flagellar basal body P-ring protein [Burkholderia thailandensis
           Bt4]
 gi|257140544|ref|ZP_05588806.1| flagellar basal body P-ring protein [Burkholderia thailandensis
           E264]
 gi|284159410|ref|YP_440805.3| flagellar basal body P-ring protein [Burkholderia thailandensis
           E264]
 gi|83653620|gb|ABC37683.1| flagellar P-ring protein FlgI [Burkholderia thailandensis E264]
          Length = 401

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 146/359 (40%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 47  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 106

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 107 AGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 166

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 167 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 226

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +N+     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 227 NDMDYGTAQRIVSAVNAS----FGAGTAMALDGRTIQLTAPADSAQQVAFMARLQNLEVS 282

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    +++GNL+V +     V QP  F SNG TV  
Sbjct: 283 PEKAAAKVILNARTGSIVMNQMVTLQNCAIAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 341

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 342 QQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|123442780|ref|YP_001006757.1| flagellar basal body P-ring protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089741|emb|CAL12594.1| flagellar P-ring protein precursor [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 358

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 151/365 (41%), Positives = 221/365 (60%), Gaps = 12/365 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           ++F+L+     S     RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+ 
Sbjct: 1   MLFTLVS----SPASAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSLS 56

Query: 68  SLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+RGG L+M
Sbjct: 57  NMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSIRGGTLLM 116

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L G D  +YA+AQG+V+V G       SS      TGG+I NGA +ERELP  F    
Sbjct: 117 TPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISNGATIERELPTTFGSDG 176

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEV 245
            + LQL   DF+TA +++D IN      F    A A D+RT++V  P  N    R ++++
Sbjct: 177 VINLQLNTEDFTTAQQVSDAINRQ--RGFGS--ASAIDARTIQVLVPRGNSSQVRFLADI 232

Query: 246 EMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           + + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP+     
Sbjct: 233 QNIPVNIDAGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVSQPDTPFGG 292

Query: 305 GSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G TV   NT + V    G    ++A P+LN+++  +NS+G     ++SILQ +++AG L+
Sbjct: 293 GQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQSAGCLR 352

Query: 364 SEIII 368
           +++ I
Sbjct: 353 AKLEI 357


>gi|269138586|ref|YP_003295286.1| flagellar basal body P-ring protein [Edwardsiella tarda EIB202]
 gi|267984246|gb|ACY84075.1| flagellar basal body P-ring protein [Edwardsiella tarda EIB202]
 gi|304558596|gb|ADM41260.1| Flagellar P-ring protein FlgI [Edwardsiella tarda FL6-60]
          Length = 379

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 151/360 (41%), Positives = 221/360 (61%), Gaps = 9/360 (2%)

Query: 13  IGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQN 72
           +GL    AQ   RI+D+ S+Q  R+N LIGYGLVVGL GTGD    +PFT QS+ ++L  
Sbjct: 24  LGLLSQGAQA-ERIRDLTSIQGVRNNALIGYGLVVGLDGTGDQTMQTPFTTQSLNNMLSQ 82

Query: 73  LGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
           LGI+ P G  +  KNVAAVMVTANLPPF+ PG  IDV ++S+G+A SLRGG L+MT L G
Sbjct: 83  LGITVPPGTNMQLKNVAAVMVTANLPPFSRPGQTIDVVVSSMGNAKSLRGGTLLMTPLKG 142

Query: 132 ADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQ 191
            D  +YA+AQG+V+V G       SS      +GG+I  GA +ER +P  F +S  + L+
Sbjct: 143 VDNQVYALAQGNVLVGGAGASAGGSSVQVNQLSGGRISGGATIERAVPTTFGNSNVINLE 202

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVEMLTV 250
           L N DF+ A  I+D IN  +    + P+    D+RTV+V  P    +  R ++ ++ + V
Sbjct: 203 LNNEDFTLAQHISDAINRANGLGAATPL----DARTVQVLVPQGGSNQVRALANIQNIEV 258

Query: 251 ETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
              T  A+VIIN RTG++V+  NV +    V+ GNL+V +     V QPN     G TV 
Sbjct: 259 NVGTFDAKVIINSRTGSVVMNRNVELDSCAVAQGNLSVVVDRQLNVSQPNTPFGGGQTVV 318

Query: 310 QNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             NT + V+ + G+   + A  +LNS++  +N++G   + ++SILQ +++AG L++++ I
Sbjct: 319 TPNTQISVNQSGGALHQVRAGANLNSVVRALNALGATPNDLMSILQAMQSAGCLRAKLEI 378


>gi|237799213|ref|ZP_04587674.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022068|gb|EGI02125.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 369

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 143/349 (40%), Positives = 209/349 (59%), Gaps = 9/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR--L 82
           R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+  ++L   GI  P G   +
Sbjct: 24  RLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPFTLQTFNNMLSQFGIKVPAGSGTV 83

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAV V A+LP FA PG  +D++++S+G++ SLRGG L+MT + G DGN+YA+AQG
Sbjct: 84  QLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSLRGGALLMTPMKGVDGNVYAIAQG 143

Query: 143 SVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VV G   +G+  S +   + + G+I  GA VER +P  F     L L L   DF+TA 
Sbjct: 144 NLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSVPSGFNQGNTLTLNLNRSDFTTAK 203

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVET-DTPARVI 259
           R+ D+IN          +A+A D  +V+V+ P +       +S +E L V+   T A+VI
Sbjct: 204 RVVDKINDL----LGPGVAQALDGGSVRVTAPLDPGQRVDYLSILENLEVDPGQTAAKVI 259

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           IN RTGTIVIG NV++S   V++G+LTV ITE+  V QP A S   + V   +      +
Sbjct: 260 INSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGALSGGQTAVVPRSRVNAQQE 319

Query: 320 NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
               F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 320 LHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGALQADLIV 368


>gi|167579493|ref|ZP_02372367.1| flagellar basal body P-ring protein [Burkholderia thailandensis
           TXDOH]
          Length = 401

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 146/359 (40%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 47  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 106

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 107 AGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 166

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 167 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 226

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +N+     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 227 NDMDYGTAQRIVSAVNAS----FGAGTAMALDGRTIQLTAPADSAQQVAFMARLQNLEVS 282

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    +++GNL+V +     V QP  F SNG TV  
Sbjct: 283 PEKAAAKVILNARTGSIVMNQMVTLQNCAIAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 341

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 342 QQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|145297458|ref|YP_001140299.1| flagellar basal body P-ring protein [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850230|gb|ABO88551.1| lateral flagellar P-ring protein, LfgI [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 368

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 222/376 (59%), Gaps = 22/376 (5%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS-PF 61
           + I  L  SL      +      + D+  +Q  R NQL+GYGLVVGL GTGD  RS   F
Sbjct: 4   WFITLLCLSLPWWANAAPPAKRALLDIADVQGMRTNQLVGYGLVVGLSGTGD--RSQVKF 61

Query: 62  TEQSMRSLLQNLGISTPGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           T QSM ++L+  G+  P     +L  KNVAAV V A LP  A  G  +DV++ S+GDA S
Sbjct: 62  TGQSMANMLKQFGVQLPDDLDPKL--KNVAAVSVQATLPALAGKGQLVDVTVTSIGDAKS 119

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERE 177
           LRGG L++T L G DG++YAVAQG++VV+G+  +GQS SS    + T G I NGAI+ERE
Sbjct: 120 LRGGSLLLTPLRGIDGDVYAVAQGNLVVAGVKAEGQSGSSVTINVPTAGIIPNGAIIERE 179

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-- 235
               F D  ++ L L  P+F TA  +  +IN     R   P+A A  +  ++V+ P +  
Sbjct: 180 AVSNFADKPEVTLNLHQPNFKTARNVEREIN-----RQLGPVARAVSAGRIQVTAPKDES 234

Query: 236 --IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENE 293
             I    L+ +++ + +  + P RV+ N RTGT+V+G  V++ K  VS+G+LTV I E++
Sbjct: 235 QRISFMALLQDIQ-VDMGKERP-RVVFNSRTGTVVMGQGVKVHKAAVSHGSLTVTIGESQ 292

Query: 294 QVVQPNAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISI 352
            V QPNAF SNG T T  N+ ++V   + + F   D   L  ++  +NS+G   D +++I
Sbjct: 293 NVSQPNAF-SNGQTTTTPNSKVQVDRERNNMFVWPDGTSLEVIVKAVNSLGATPDDVMAI 351

Query: 353 LQGIKAAGALQSEIII 368
           LQ +  AGAL+ E+++
Sbjct: 352 LQALDEAGALEGELVV 367


>gi|320107045|ref|YP_004182635.1| flagellar P-ring protein [Terriglobus saanensis SP1PR4]
 gi|319925566|gb|ADV82641.1| flagellar P-ring protein [Terriglobus saanensis SP1PR4]
          Length = 371

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 213/361 (59%), Gaps = 7/361 (1%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           FLI +L    ++  Q ++RIKD+ S++  R+NQL+GYG+VVGLQGTGDS ++S F  Q++
Sbjct: 14  FLIGALSHASDLPQQHLARIKDIASVEGIRENQLVGYGIVVGLQGTGDSQQTS-FPVQTL 72

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
            + L  +G+S P   +  +N+AAV V+A+LPPF+ PG+RID++++S GDA SL GG+L+M
Sbjct: 73  AATLLRMGVSVPASSIRVQNLAAVFVSASLPPFSRPGTRIDLTVSSAGDAKSLEGGLLLM 132

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L GADG IYA AQG +V+ G  V    ++      T  ++  G  VER +P    +  
Sbjct: 133 TPLYGADGRIYAQAQGPLVLGGYSVTANGNTKQTNHPTTARVPLGGSVERGVPLDLTNRQ 192

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVE 246
            L L +   DF +A  +AD IN+       R +A A DSR + ++     D+  L++ VE
Sbjct: 193 SLSLLMHEADFRSAEAMADAINTT----LHRTVAHAADSRRIDLTLVPGEDVPSLLARVE 248

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            + V     ++V++NERTGT+VIG NV +    + +G L V I    QV QP  F SNG+
Sbjct: 249 AIEVPFYPRSKVVVNERTGTVVIGGNVVLQPASILHGGLAVNIISENQVSQPGPF-SNGT 307

Query: 307 TVTQNNTDLKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSE 365
           T     T +   D       L     ++ L+  +  IG     +ISILQ +K+AGA+++E
Sbjct: 308 TQVVQQTRIDAKDKPVNRIDLQQGSTVDDLVRSLQMIGATARDVISILQAMKSAGAMEAE 367

Query: 366 I 366
           I
Sbjct: 368 I 368


>gi|90119073|sp|Q5ZW64|FLGI_LEGPH RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 367

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 159/374 (42%), Positives = 226/374 (60%), Gaps = 16/374 (4%)

Query: 3   FRIAFLIFSLIGLHEISAQVVS-RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            R   +I  ++ +H I+ QV + RIKD+ +L   R NQL+GYGLVVGL GTGD    + F
Sbjct: 1   MRRMLVIRWILAIHLIATQVFAERIKDIATLAGVRVNQLVGYGLVVGLSGTGDK-TGTKF 59

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           TE S  ++L  LGI+ P G RL SKN+AAVMVTANL  F   G  +DV+I+S+GD+ SL 
Sbjct: 60  TEDSFANMLTQLGINIPPGVRLNSKNIAAVMVTANLSSFMKKGQTMDVNISSIGDSKSLL 119

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L GADG +YA++QG+VVVSG+   G   SS    + +GG+I NGA +E ++P
Sbjct: 120 GGTLLLTPLKGADGRVYAMSQGNVVVSGISASGSDGSSVTVNVPSGGRIPNGATIEADIP 179

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN---- 235
             F  S  L   L NPDF+TA R++D IN           A+A D+ +V V+ P      
Sbjct: 180 NPFYYSNSLTYNLHNPDFTTAKRMSDAINEL----MGPGTAKAIDAGSVVVTAPKKLSQR 235

Query: 236 IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
           +D   ++  +E    E    A++IIN RTGT+VI  NV +    VS+GNL V ITE   +
Sbjct: 236 VDYVSVLENIEFKPGE--AMAKIIINARTGTVVISSNVIVKSAAVSHGNLVVSITETPVI 293

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQ 354
            QPNAF+S G TV+   + + +   N  +F L     L  ++ G+N++G     +ISIL+
Sbjct: 294 SQPNAFAS-GRTVSTQQSQVNIQQKNNRAFILPKGTTLKDIVRGINAVGATPADVISILE 352

Query: 355 GIKAAGALQSEIII 368
            ++ AGAL + +I+
Sbjct: 353 ALQQAGALSATLIV 366


>gi|70729008|ref|YP_258742.1| flagellar basal body P-ring protein [Pseudomonas fluorescens Pf-5]
 gi|115311529|sp|Q4KG91|FLGI_PSEF5 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|68343307|gb|AAY90913.1| flagellar P-ring protein FlgI [Pseudomonas fluorescens Pf-5]
          Length = 362

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 140/351 (39%), Positives = 213/351 (60%), Gaps = 13/351 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--RL 82
           R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+  ++L   GI  P G   +
Sbjct: 17  RLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPFTLQTFNNMLSQFGIKVPAGSGNV 76

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAV V+A+LP FA PG ++D++++S+G++ SLRGG L++T L G DGN+YA+AQG
Sbjct: 77  QLKNVAAVSVSADLPAFAKPGQQVDITVSSIGNSKSLRGGTLLLTPLKGIDGNVYAIAQG 136

Query: 143 SVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VV G   +G+  S +   + + G+I  GA VER +P  F     L L L   DF+TA 
Sbjct: 137 NLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAVPSGFNQGNSLTLNLNRSDFTTAK 196

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN----IDLTRLMSEVEMLTVETDTPAR 257
           RI D+IN    +     +A+A D  +++V+ P +    +D   ++  +E+   +    A+
Sbjct: 197 RIVDKIN----DMLGPGVAQAIDGGSIRVTAPLDPSQRVDYLSILENLEIDPGQAV--AK 250

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP   S+  + V   +     
Sbjct: 251 VIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGPLSNGQTAVVPRSRVNAQ 310

Query: 318 SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 311 QEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGALQADLIV 361


>gi|78067833|ref|YP_370602.1| flagellar basal body P-ring protein [Burkholderia sp. 383]
 gi|77968578|gb|ABB09958.1| Flagellar P-ring protein [Burkholderia sp. 383]
          Length = 392

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 146/358 (40%), Positives = 210/358 (58%), Gaps = 19/358 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 39  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 98

Query: 81  ------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
                  +  KNVAAVMVT  LPPFA PG  +DV+++SLG+A SLRGG L++T L GADG
Sbjct: 99  GASQLSNMQLKNVAAVMVTGTLPPFARPGEALDVTVSSLGNAKSLRGGTLLLTPLKGADG 158

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQLR 193
            +YA+AQG++ V G       S         G+IV GAIVER +P      +  L LQL 
Sbjct: 159 QVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERGVPNAIAQMNGVLQLQLN 218

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET 252
           + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V  
Sbjct: 219 DMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLTAPADSAQQVAFMARLQNLDVSP 274

Query: 253 D-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
           D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV   
Sbjct: 275 DKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVAQ 333

Query: 312 NTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + +++  + G+  ++ A  +L  ++  +N++G     ++SILQ +KAAGAL++++ I
Sbjct: 334 QSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSILQAMKAAGALRADLEI 391


>gi|197285506|ref|YP_002151378.1| flagellar basal body P-ring protein [Proteus mirabilis HI4320]
 gi|194682993|emb|CAR43436.1| flagellar P-ring protein precursor (basal body P-ring protein)
           [Proteus mirabilis HI4320]
          Length = 368

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 221/366 (60%), Gaps = 12/366 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           F++ + +G    SA    RI+D+ S++  R+N LIGYGLVVGL GTGD    +PFT QS+
Sbjct: 10  FIVMTCVGF---SAHA-ERIRDLTSVEGVRENALIGYGLVVGLDGTGDQTMQTPFTTQSL 65

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  IDV ++SLG+A SLRGG L+
Sbjct: 66  NNMLSQLGITVPAGTNMQLKNVAAVMVTAKLPPFGRTGQSIDVVVSSLGNAKSLRGGTLL 125

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MT L G D  +YAVAQG++VV G       SS       GG+I NGAI+ERELP +F  +
Sbjct: 126 MTPLKGVDSQVYAVAQGNIVVGGSGASAGGSSVKVNQLAGGRISNGAIIERELPSQFGQT 185

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSE 244
             L LQL   +F+ A  IAD IN       + P+    D+RTV++  P    +  R +++
Sbjct: 186 GLLNLQLNEENFTLAQSIADAINKLRGVGTALPL----DARTVQLRVPLGKSEQVRFLAD 241

Query: 245 VEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           V+ L V+     A+VIIN RTG++V+  +V +    ++ GNL+V +     V QPN   +
Sbjct: 242 VQNLEVKRVIADAKVIINARTGSVVMNRDVVLGSCAIAQGNLSVTVDSQVNVSQPNTPFA 301

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            GSTV   NT + V++  GS   ++A   LN +I  +N++G     ++SILQ +++AG L
Sbjct: 302 GGSTVVSRNTSVNVNEKGGSLQKVNASASLNEVIRSLNALGATPTDLMSILQAMESAGCL 361

Query: 363 QSEIII 368
           ++ + I
Sbjct: 362 RARLEI 367


>gi|309388849|gb|ADO76729.1| flagellar P-ring protein [Halanaerobium praevalens DSM 2228]
          Length = 383

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 154/373 (41%), Positives = 224/373 (60%), Gaps = 13/373 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +IF I    F  + L     +V   I ++  L+  R NQLIGYG+VVGL G+GDS RS  
Sbjct: 20  IIFSIFLFSFGSLVLAAQDPEV--EIGNITRLRGERPNQLIGYGIVVGLNGSGDSNRSQA 77

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
            T QS+ ++LQN G++    ++ S+N+AAVMVTA LP  A  G  ++++++S+GDA SL+
Sbjct: 78  -TVQSVANMLQNFGVNVTDNQVASQNIAAVMVTAELPSVAHNGDELNITVSSIGDADSLQ 136

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L++T L   +G +YA AQG + V G    G  +S  +   T GKI NGA+VERE+  
Sbjct: 137 GGTLLLTPLQAPNGKVYASAQGPLSVGGYSAGGGGNSQQQNHPTVGKIPNGALVEREISS 196

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DL 238
              D+ +L   L NP + TA +IA +IN    N F    A+A ++ TV +SKP N   D+
Sbjct: 197 HL-DAKNLTYVLTNPSYKTASQIASKIN----NSFGTGTAKALNNSTVNISKPDNFSYDM 251

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
              ++EV  L V     ARV+I+ERTGT+V   NV IS V V++GNL+V I+  E V QP
Sbjct: 252 VDFIAEVNSLKVRPALKARVVIDERTGTVVFSHNVHISTVAVAHGNLSVSISTQENVSQP 311

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPD--LNSLISGMNSIGLKTDGIISILQGI 356
           N  S  G T T  +  ++V + +    LI + +  +  L++ +N+IG     IISI+Q I
Sbjct: 312 NPLSE-GETTTTEDVQIEVDEGQEGNMLIVSQENTIEDLVTALNAIGATPRDIISIIQKI 370

Query: 357 KAAGALQSEIIIQ 369
            AAGAL +++II+
Sbjct: 371 DAAGALHADLIIE 383


>gi|114330365|ref|YP_746587.1| flagellar basal body P-ring protein [Nitrosomonas eutropha C91]
 gi|114307379|gb|ABI58622.1| flagellar P-ring protein [Nitrosomonas eutropha C91]
          Length = 375

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 151/348 (43%), Positives = 212/348 (60%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+V++Q  R NQLIGYGLVVGL GTGD  + +PFT QS+ S+L  LG++ P G  L 
Sbjct: 31  RIKDLVNIQGVRANQLIGYGLVVGLDGTGDQTQQTPFTVQSILSMLGQLGVNLPPGVNLQ 90

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            +NVA+VMVTA LP FA PG +IDV+++S+G+A SLRGG L+MT L G D  +YAVAQGS
Sbjct: 91  LRNVASVMVTATLPAFAKPGQQIDVTVSSMGNAKSLRGGTLLMTPLKGIDNQVYAVAQGS 150

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           +V+ G       SS        G+I  GAIVER +P        + L+L + DF+TA RI
Sbjct: 151 LVIGGAGASSAGSSVQINHLGAGRISAGAIVERAVPTLLGQGEYINLELHDTDFTTARRI 210

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVEMLTV-ETDTPARVIIN 261
            + INS    RFS   A A D R +++  P  N      +S++E L V      A+VIIN
Sbjct: 211 VETINS----RFSYGTATALDGRVIQLRAPVDNNQRVTFISQIEGLDVMPAQGVAKVIIN 266

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+   V +    V++GNL+V I     V QP  FS  G TV    + ++V   +
Sbjct: 267 ARTGSVVMNQMVTLEPSAVAHGNLSVIINTQPIVSQPGPFSQRGETVVVPQSQIEVRSEE 326

Query: 322 GSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           G+  L+  +  L  ++  +N+IG     +++ILQ +KAAG+L++E+ I
Sbjct: 327 GNLMLLPGSASLADVVKALNAIGATPQDLLAILQALKAAGSLRAELEI 374


>gi|77457731|ref|YP_347236.1| flagellar basal body P-ring protein [Pseudomonas fluorescens Pf0-1]
 gi|115311639|sp|Q3KG59|FLGI_PSEPF RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|77381734|gb|ABA73247.1| flagellar P-ring protein precuror [Pseudomonas fluorescens Pf0-1]
          Length = 362

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 142/351 (40%), Positives = 215/351 (61%), Gaps = 13/351 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP--GGRL 82
           R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+  ++L   GI  P   G +
Sbjct: 17  RLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPFTLQTFNNMLSQFGIKVPPGSGNV 76

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAV V+A+LP FA PG ++D++++S+G++ SLRGG L++T L G DGN+YA+AQG
Sbjct: 77  QLKNVAAVSVSADLPAFAKPGQQVDITVSSIGNSKSLRGGTLLLTPLKGIDGNVYAIAQG 136

Query: 143 SVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VV G   +G+  S +   + + G+I  GA VER +P  F     L L L   DF+TA 
Sbjct: 137 NLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERSVPSGFNQGNSLTLNLNRSDFTTAK 196

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEML-TVETDTP---AR 257
           RI D+IN    +     +A+A D  +++V+ P  +D ++ +  + +L  +E D     A+
Sbjct: 197 RIVDKIN----DMLGPGVAQAIDGGSIRVTAP--LDPSQRVDYLSILENLEVDPGQAVAK 250

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP   S+  + V   +     
Sbjct: 251 VIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGPLSNGQTAVVPRSRVNAE 310

Query: 318 SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 311 QEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGALQADLIV 361


>gi|238799111|ref|ZP_04642567.1| Flagellar P-ring protein [Yersinia mollaretii ATCC 43969]
 gi|238717058|gb|EEQ08918.1| Flagellar P-ring protein [Yersinia mollaretii ATCC 43969]
          Length = 369

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 152/365 (41%), Positives = 220/365 (60%), Gaps = 9/365 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           LI +L  L  + AQ   RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+ 
Sbjct: 9   LIITLFSLVWMPAQA-ERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSLS 67

Query: 68  SLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+RGG L+M
Sbjct: 68  NMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSIRGGTLLM 127

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L G D  +YA+AQG+V+V G       SS      TGG+I  GA +ERELP  F    
Sbjct: 128 TPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISGGATIERELPTTFGSDG 187

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEV 245
            + LQL   DF+ A +++D IN      F    A A D+RT++V  P  N    R ++++
Sbjct: 188 VINLQLNTEDFTMAQQVSDAINRQ--RGFGS--ATAIDARTIQVLVPRGNSSQVRFLADI 243

Query: 246 EMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           + + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP+     
Sbjct: 244 QNIPVNVDAGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVSQPDTPFGG 303

Query: 305 GSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G TV   NT + V    G    ++A P+LN+++  +NS+G     ++SILQ +++AG L+
Sbjct: 304 GQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQSAGCLR 363

Query: 364 SEIII 368
           +++ I
Sbjct: 364 AKLEI 368


>gi|52841455|ref|YP_095254.1| flagellar basal body P-ring protein [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52628566|gb|AAU27307.1| flagellar P-ring protein (precursor) FlgI [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 394

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 159/374 (42%), Positives = 226/374 (60%), Gaps = 16/374 (4%)

Query: 3   FRIAFLIFSLIGLHEISAQVVS-RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            R   +I  ++ +H I+ QV + RIKD+ +L   R NQL+GYGLVVGL GTGD    + F
Sbjct: 28  MRRMLVIRWILAIHLIATQVFAERIKDIATLAGVRVNQLVGYGLVVGLSGTGDKT-GTKF 86

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           TE S  ++L  LGI+ P G RL SKN+AAVMVTANL  F   G  +DV+I+S+GD+ SL 
Sbjct: 87  TEDSFANMLTQLGINIPPGVRLNSKNIAAVMVTANLSSFMKKGQTMDVNISSIGDSKSLL 146

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L GADG +YA++QG+VVVSG+   G   SS    + +GG+I NGA +E ++P
Sbjct: 147 GGTLLLTPLKGADGRVYAMSQGNVVVSGISASGSDGSSVTVNVPSGGRIPNGATIEADIP 206

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN---- 235
             F  S  L   L NPDF+TA R++D IN           A+A D+ +V V+ P      
Sbjct: 207 NPFYYSNSLTYNLHNPDFTTAKRMSDAINEL----MGPGTAKAIDAGSVVVTAPKKLSQR 262

Query: 236 IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
           +D   ++  +E    E    A++IIN RTGT+VI  NV +    VS+GNL V ITE   +
Sbjct: 263 VDYVSVLENIEFKPGE--AMAKIIINARTGTVVISSNVIVKSAAVSHGNLVVSITETPVI 320

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQ 354
            QPNAF+S G TV+   + + +   N  +F L     L  ++ G+N++G     +ISIL+
Sbjct: 321 SQPNAFAS-GRTVSTQQSQVNIQQKNNRAFILPKGTTLKDIVRGINAVGATPADVISILE 379

Query: 355 GIKAAGALQSEIII 368
            ++ AGAL + +I+
Sbjct: 380 ALQQAGALSATLIV 393


>gi|251789172|ref|YP_003003893.1| flagellar basal body P-ring protein [Dickeya zeae Ech1591]
 gi|247537793|gb|ACT06414.1| flagellar P-ring protein [Dickeya zeae Ech1591]
          Length = 369

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 151/366 (41%), Positives = 223/366 (60%), Gaps = 8/366 (2%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           F +F  + +  +      RI+D+V++Q  RDN LIGYGLVVGL GTGD    +PFT QS+
Sbjct: 7   FTVFLALLVMAVPPASAERIRDLVTIQGVRDNALIGYGLVVGLDGTGDQTTQTPFTTQSL 66

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++L  LGI+ P G  +  KNVAAVMVTA LPPFA  G  +DV ++S+G+A SLRGG L+
Sbjct: 67  NNMLSQLGITVPAGTNMQLKNVAAVMVTAKLPPFARSGQAVDVVVSSMGNAKSLRGGTLL 126

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MT L G D  IYA+AQG+V++ G       SS      +GG+I  GAIVERELP  F   
Sbjct: 127 MTPLKGVDNQIYAIAQGNVLIGGAGASAGGSSVQVNQVSGGRISGGAIVERELPNTFGTG 186

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSE 244
             ++LQL   DF+ A  I+D IN +     + P+    DSRT++V  P  N    R +++
Sbjct: 187 NTIMLQLNQDDFTMAQSISDAINRFGRGGSAAPL----DSRTIRVVVPAGNSSQVRFLAD 242

Query: 245 VEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           ++ + V   T  A+VIIN RTG++V+  NV++    V+ GNL+V I +   V QPN   +
Sbjct: 243 MQNIEVNVGTLDAKVIINSRTGSVVMNRNVQLENCAVAQGNLSVTINQQNVVSQPNTPLA 302

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G TV    T++ +    G+   ++ + +LNS++  +NS+G     ++SILQ +++AG L
Sbjct: 303 GGQTVVTPQTEISMRQEGGALQRVNSSANLNSVVRALNSLGATPMDLMSILQAMESAGCL 362

Query: 363 QSEIII 368
           ++++ I
Sbjct: 363 RAKLEI 368


>gi|332161326|ref|YP_004297903.1| flagellar basal body P-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318605246|emb|CBY26744.1| flagellar P-ring protein FlgI [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665556|gb|ADZ42200.1| flagellar basal body P-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861551|emb|CBX71755.1| flagellar P-ring protein 2 [Yersinia enterocolitica W22703]
          Length = 373

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 151/365 (41%), Positives = 221/365 (60%), Gaps = 12/365 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           ++F+L+     S     RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+ 
Sbjct: 16  VLFTLVS----SPASAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSLS 71

Query: 68  SLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+RGG L+M
Sbjct: 72  NMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSIRGGTLLM 131

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L G D  +YA+AQG+V+V G       SS      TGG+I NGA +ERELP  F    
Sbjct: 132 TPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISNGATIERELPTTFGTDG 191

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEV 245
            + LQL   DF+TA +++D IN      F    A A D+RT++V  P  N    R ++++
Sbjct: 192 VINLQLNTEDFTTAQQVSDAINRQ--RGFGS--ASAIDARTIQVLVPRGNSSQVRFLADI 247

Query: 246 EMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           + + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP+     
Sbjct: 248 QNIPVNIDAGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVSQPDTPFGG 307

Query: 305 GSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G TV   NT + V    G    ++A P+LN+++  +NS+G     ++SILQ +++AG L+
Sbjct: 308 GQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQSAGCLR 367

Query: 364 SEIII 368
           +++ I
Sbjct: 368 AKLEI 372


>gi|332531622|ref|ZP_08407519.1| flagellar basal body P-ring protein [Hylemonella gracilis ATCC
           19624]
 gi|332038985|gb|EGI75414.1| flagellar basal body P-ring protein [Hylemonella gracilis ATCC
           19624]
          Length = 376

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 147/349 (42%), Positives = 211/349 (60%), Gaps = 11/349 (3%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS---TPGG 80
           +RIK+V S++  R NQL GYGLV+GL GTGD     P+T Q++ + LQ LGI+   T   
Sbjct: 30  ARIKEVASIEGVRSNQLTGYGLVIGLDGTGDQTTQMPYTSQTLANYLQQLGITLDPTLAS 89

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
           RL  KNVAAV+VTA LP FA PG RID++++SLG+A SL+GG LV T L GADG IYA+ 
Sbjct: 90  RLQLKNVAAVLVTAELPAFARPGQRIDITVSSLGNAKSLKGGTLVATPLRGADGQIYALG 149

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QGS+VV+G       SS      + G++  GA+VER +P    +   + L L + DF TA
Sbjct: 150 QGSLVVAGAGASAAGSSVQINHLSAGRVPGGALVERSVPTPLMEGGSVRLSLNSDDFLTA 209

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-ARV 258
            R+A+ IN     RF   +A A D R++ V  PT   D    ++++E L V+  TP A+V
Sbjct: 210 SRVAEAIN----QRFGTGVANAMDGRSIDVRAPTAPNDRIAFLAQMEELNVQDTTPAAKV 265

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           IIN RTG+IV+   V +    +++GNL+V I     + QP    S G TV      ++V+
Sbjct: 266 IINSRTGSIVLNQAVTLGPCAIAHGNLSVSINSTPVISQPAPL-SQGQTVVTEQASIQVT 324

Query: 319 DNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              G+  ++  +P L  ++  +N++G     +++ILQ IKAAGAL +E+
Sbjct: 325 QEPGNLINVPGSPTLQEVVRALNALGATPQDLLAILQAIKAAGALNAEL 373


>gi|294084414|ref|YP_003551172.1| flagellar P-ring protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663987|gb|ADE39088.1| flagellar P-ring protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 378

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 159/378 (42%), Positives = 227/378 (60%), Gaps = 24/378 (6%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           A LI        I + V  R+KD+ S+   R NQL+GYGLVVGL GTGD   +S  T QS
Sbjct: 9   ASLIVMFSAFAGIGSAVADRLKDMTSIAGVRSNQLVGYGLVVGLSGTGDG--NSGLTLQS 66

Query: 66  MRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           ++S++   G+ T    L  KN AAVMVTA+LP F  PG RID++++++G A SLRGG L+
Sbjct: 67  LQSMVSQFGLVTDASNLSGKNAAAVMVTADLPAFTKPGQRIDITVSTIGAAKSLRGGTLL 126

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKD 184
           MT LLGADG  YAVAQG++VV GL V G   SS +  I T G+I  GA VE+ +   F+ 
Sbjct: 127 MTPLLGADGETYAVAQGNMVVGGLGVTGNDGSSVIVNIPTVGRIPRGASVEKMVESPFQS 186

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSE 244
           S +LIL L   DFSTAIR++D IN      F   ++ A D+ ++KV  P  +D  + +S 
Sbjct: 187 SNNLILNLHQGDFSTAIRVSDAINDI----FGPDVSVALDASSIKVRAP--VDPKQKVSF 240

Query: 245 VEML-TVETDTPAR----VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
           V +L  VE D PAR    VI+N RTGTIVIG +VR++  VV++G+LTV++TE+  V    
Sbjct: 241 VSLLENVEVD-PARPSAKVIVNSRTGTIVIGGDVRVTPAVVTHGSLTVKVTEDMDVTATG 299

Query: 300 AFSSN--------GSTV-TQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGII 350
             ++N        G  V T +       +   +F      DL  ++  +N++G     ++
Sbjct: 300 TTTTNANGTVTTPGDAVQTADTEIEIEEETAKAFVFDTGVDLADIVDSINAVGASAADLV 359

Query: 351 SILQGIKAAGALQSEIII 368
           +IL+ ++ AG+L++EII+
Sbjct: 360 AILEALREAGSLRAEIIV 377


>gi|121607557|ref|YP_995364.1| flagellar basal body P-ring protein [Verminephrobacter eiseniae
           EF01-2]
 gi|121552197|gb|ABM56346.1| flagellar P-ring protein [Verminephrobacter eiseniae EF01-2]
          Length = 385

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 144/348 (41%), Positives = 214/348 (61%), Gaps = 11/348 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---R 81
           RIK+V ++Q  R NQL GYGLVVGL GTGD     P+T Q++ + LQ +G+S P G   +
Sbjct: 40  RIKEVAAVQGVRSNQLTGYGLVVGLDGTGDQTTQMPYTTQALSNYLQQMGLSLPPGAASQ 99

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
           L  KNVAAV+VTA LP FA PG  +DV+++S+G+A SL+GG LV T L GADG IYA+AQ
Sbjct: 100 LQPKNVAAVIVTAQLPAFAQPGQTMDVNVSSVGNARSLKGGTLVATPLRGADGEIYALAQ 159

Query: 142 GSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           G+VVV G       S       + G+I  GA VE+ +P    +   + LQL + DF TA 
Sbjct: 160 GNVVVGGAGAAAGGSKVQINHLSAGRIPLGAQVEQAVPTPLNEGQSIRLQLNSMDFQTAR 219

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLMSEVEMLTVETDTP-ARVI 259
           R+A  IN+    +  + +A A D RTV+V  P + D     ++++E L +E+  P A+V+
Sbjct: 220 RVAQAINA----KLGQGLATALDGRTVQVQAPIDPDARVGFIADLEELPLESSAPAAKVV 275

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           IN RTG++V+  +V +    +++GNL++ I++   + QPN  SS G TV    +D+ +  
Sbjct: 276 INARTGSVVLNQSVTLGPCAIAHGNLSITISQTPVISQPNPLSS-GQTVLAQKSDISIRQ 334

Query: 320 NKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
             G+   + A P L  ++  +N++G     ++SILQ I+AAGAL +E+
Sbjct: 335 EAGNVIQVPASPRLADVVKALNALGATPGDLLSILQAIQAAGALNAEL 382


>gi|94969953|ref|YP_592001.1| flagellar basal body P-ring protein [Candidatus Koribacter
           versatilis Ellin345]
 gi|94552003|gb|ABF41927.1| flagellar P-ring protein [Candidatus Koribacter versatilis
           Ellin345]
          Length = 351

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 143/356 (40%), Positives = 217/356 (60%), Gaps = 9/356 (2%)

Query: 12  LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
           +IG  E    V   I+D+ +++  R+N LIGYG+VVGL GTGD  ++  FT Q++  +LQ
Sbjct: 1   MIGAQEAPRMVT--IRDITTIEGVRENPLIGYGMVVGLNGTGDRTQTF-FTTQTLSGILQ 57

Query: 72  NLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
            +G+  P G +   NVA+VMVTA LPPFA  G RIDV+++S+GDA SL GG+L++T L G
Sbjct: 58  RMGVQVPSGSMRVNNVASVMVTAVLPPFAVHGGRIDVTVSSIGDAKSLDGGMLLLTPLYG 117

Query: 132 ADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQ 191
           ADG +YA AQG++ + G       +S      T G+I  G ++E++L    +  + + L 
Sbjct: 118 ADGQVYAAAQGALAIGGYSASSNGNSKQSNHPTVGRIPEGGVIEKDLSVGLEKLSSVSLL 177

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVE 251
           LR+P+F+TA  IA ++N       + P+A A D+R V V       +  L+++++ L + 
Sbjct: 178 LRDPEFATATSIAAEVN----RSLASPVARAVDARRVVVGVRPETSVPELLAKIQSLEIP 233

Query: 252 TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
               +R+I+NERTGTIV+G  V++S V V +GNL+V+IT +  V QP    SNGSTV   
Sbjct: 234 LRERSRIIVNERTGTIVMGAKVQLSAVAVLHGNLSVEITSSMAVSQPAPL-SNGSTVRGT 292

Query: 312 NTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            T+L+  +       L +   +  L+ G+  IG     ++SILQ +KAAGALQ+E+
Sbjct: 293 ETNLEAREAPVKLLELKEGATVAQLVEGLQKIGATARDVVSILQAMKAAGALQAEV 348


>gi|238794002|ref|ZP_04637620.1| Flagellar P-ring protein [Yersinia intermedia ATCC 29909]
 gi|238726634|gb|EEQ18170.1| Flagellar P-ring protein [Yersinia intermedia ATCC 29909]
          Length = 373

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 150/370 (40%), Positives = 220/370 (59%), Gaps = 10/370 (2%)

Query: 5   IAFLIFSLIGLHEISA--QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           +   +  LI L  + +      RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT
Sbjct: 7   VTLFVIQLIALLTLVSLPATAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFT 66

Query: 63  EQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  ID+ ++S+G+A S+RG
Sbjct: 67  TQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDIVVSSMGNAKSIRG 126

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L G D  +YA+AQG+V+V G       SS      TGG+I NGA +ERELP  
Sbjct: 127 GTLLMTPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISNGATIERELPTT 186

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTR 240
           F     + LQL   DF+ A +++D IN      F    A A D+RT++V  P  N    R
Sbjct: 187 FGTDGVINLQLNTEDFTMAQQVSDAINRQ--RGFGS--ATAIDARTIQVLVPRGNSSQVR 242

Query: 241 LMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +++++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V I +   V QP+
Sbjct: 243 FLADIQNIPVNVDAGDAKVIINSRTGSVVMNRNVMLDSCAVAQGNLSVVIDKQNTVSQPD 302

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKA 358
                G TV   NT + V    G    ++A P+LN+++  +NS+G     ++SILQ +++
Sbjct: 303 TPLGGGQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQS 362

Query: 359 AGALQSEIII 368
           AG L++++ I
Sbjct: 363 AGCLRAKLEI 372


>gi|74101662|gb|AAZ99752.1| FlgIL [Aeromonas hydrophila]
          Length = 385

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 151/376 (40%), Positives = 222/376 (59%), Gaps = 22/376 (5%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS-PF 61
           + I  +  SL      +      + D+  +Q  R NQL+GYGLVVGL GTGD  RS   F
Sbjct: 21  WFITLICLSLPWWANAAPPAKRALLDIADVQGMRTNQLVGYGLVVGLSGTGD--RSQVKF 78

Query: 62  TEQSMRSLLQNLGISTPGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           T QSM ++L+  G+  P     +L  KNVAAV V A LP  A  G  +DV++ S+GDA S
Sbjct: 79  TGQSMANMLKQFGVQLPDDLDPKL--KNVAAVSVQATLPALAGKGQLVDVTVTSIGDAKS 136

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERE 177
           LRGG L++T L G DG++YAVAQG++VV+G+  +GQS SS    + T G I NGAI+ERE
Sbjct: 137 LRGGSLLLTPLRGIDGDVYAVAQGNLVVAGVKAEGQSGSSVTINVPTAGIIPNGAIIERE 196

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-- 235
               F D  ++ L L  P+F TA  +  +IN     R   P+A A  +  ++V+ P +  
Sbjct: 197 AVSNFADKPEVTLNLHQPNFKTARNVEREIN-----RQLGPVARAVSAGRIQVTAPKDES 251

Query: 236 --IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENE 293
             I    L+ +++ + +  + P RV+ N RTGT+V+G  V++ K  VS+G+LTV I E++
Sbjct: 252 QRISFMALLQDIQ-VDMGKERP-RVVFNSRTGTVVMGQGVKVHKAAVSHGSLTVTIGESQ 309

Query: 294 QVVQPNAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISI 352
            V QPNAF SNG T T  N+ ++V   + + F   D   L  ++  +NS+G   D +++I
Sbjct: 310 NVSQPNAF-SNGQTTTTPNSKVQVDRERNNMFVWPDGTSLEVIVKAVNSLGATPDDVMAI 368

Query: 353 LQGIKAAGALQSEIII 368
           LQ +  AGAL+ E+++
Sbjct: 369 LQALDEAGALEGELVV 384


>gi|325982367|ref|YP_004294769.1| flagellar P-ring protein [Nitrosomonas sp. AL212]
 gi|325531886|gb|ADZ26607.1| flagellar P-ring protein [Nitrosomonas sp. AL212]
          Length = 369

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 147/349 (42%), Positives = 213/349 (61%), Gaps = 11/349 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS-TPGGRLG 83
           RIKD+ S+Q  R+NQLIGYGLVVGL G+GD    +PFT QS+ S+L  LG++  PG  L 
Sbjct: 26  RIKDLASIQGVRNNQLIGYGLVVGLDGSGDMTTQTPFTVQSIISMLGQLGVNLPPGTNLQ 85

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            +NVAAVMVTA LP F   G  IDV+++S+G+A SLRGG L+MT L GAD  +YA+AQGS
Sbjct: 86  LRNVAAVMVTATLPAFTKTGQHIDVTVSSMGNAKSLRGGTLLMTPLKGADNQVYAMAQGS 145

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+V G+      SS      + G+I  G IVERE+P        + L+L + DF+T  RI
Sbjct: 146 VLVGGIGAAAGGSSVQVNHLSVGRITGGGIVEREIPTVVGQGDYINLELNSTDFTTVNRI 205

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLM--SEVE-MLTVETDTPARVII 260
            D INS     F    A A D R V+V  P +    R+M  S++E M  V     A+VI+
Sbjct: 206 VDAINS-----FYPASAVAVDGRVVQVKAPADTS-QRIMFISQIESMDVVPAKATAKVIV 259

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG+IV+  +V +    +++GNL++ I     + QP  F+  G TV    + +++  +
Sbjct: 260 NSRTGSIVMNQSVTLETSAIAHGNLSIIINTEPVISQPGPFAQRGETVVTQRSQVEIRTD 319

Query: 321 KGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +G+  L+ +  DL  ++  + +IG  T  ++SILQ +KAAG+L++++ I
Sbjct: 320 EGNLMLLPNGADLGEVVKALTAIGATTQDLLSILQALKAAGSLRADLEI 368


>gi|319764543|ref|YP_004128480.1| flagellar p-ring protein [Alicycliphilus denitrificans BC]
 gi|330826759|ref|YP_004390062.1| flagellar P-ring protein [Alicycliphilus denitrificans K601]
 gi|317119104|gb|ADV01593.1| flagellar P-ring protein [Alicycliphilus denitrificans BC]
 gi|329312131|gb|AEB86546.1| flagellar P-ring protein [Alicycliphilus denitrificans K601]
          Length = 381

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 144/347 (41%), Positives = 202/347 (58%), Gaps = 10/347 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIK+V ++Q  R NQL GYGLVVGL GTGD     P T Q+M++ LQ  GIS P G    
Sbjct: 37  RIKEVAAVQGVRSNQLTGYGLVVGLDGTGDQTTQMPITTQAMQNYLQQAGISLPAGTTAP 96

Query: 85  --KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVA V+VTA LPPFA PG  IDVS+ S+G+A SL+GG L+ T L GADG IYA+AQG
Sbjct: 97  QLKNVATVIVTAELPPFAQPGQAIDVSVASMGNAKSLKGGTLIATPLRGADGEIYALAQG 156

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++VV G       S       + G+I  GA VER +P    D   + L L   DF TA +
Sbjct: 157 NMVVGGAGASAGGSKVQINHLSAGRIPGGAQVERSVPTPLHDGETITLGLNASDFQTARK 216

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-ARVII 260
           +A  IN+    R    +A A D RTV+V  P +       ++E+E L +   TP A+V+I
Sbjct: 217 VASTINT----RIGSGLATALDGRTVQVRAPMDPGSRVNFIAELEELPLPDSTPAAKVVI 272

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG+IV+   V +    +++GNL++ I+    + QP    S G TV    +D+++  +
Sbjct: 273 NARTGSIVLNQAVTLGPCAIAHGNLSITISSTPVISQPAPL-SQGQTVVAQKSDIQLKQD 331

Query: 321 KGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            G    + A P L  ++  +N++G     +++ILQ IKA+GAL +E+
Sbjct: 332 GGKVIQVPASPQLADVVRALNTLGATPQDLLAILQAIKASGALNAEL 378


>gi|317492424|ref|ZP_07950853.1| flagellar P-ring protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919763|gb|EFV41093.1| flagellar P-ring protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 367

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 145/348 (41%), Positives = 215/348 (61%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RI+D+ ++Q  RDN LIGYGLVVGL G+GD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 23  RIRDLTTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSLNNMLSQLGITVPAGTNMQ 82

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LPPF+  G  IDV ++S+G+A SLRGG L+MT L G D  +YA+AQG+
Sbjct: 83  LKNVAAVMVTAKLPPFSRAGQSIDVVVSSMGNAKSLRGGTLLMTPLKGVDNQVYALAQGN 142

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+V G       SS       GG+I  GA +ERE+   F +S  + LQL + DFS A RI
Sbjct: 143 VLVGGAGASAGGSSVQVNQLAGGRISGGATIEREVQSTFGNSNVINLQLNDEDFSLAQRI 202

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVEMLTVETDT-PARVIIN 261
           +D IN +     + P+    D+RTV+V  P  N +  R+++ ++ + V   +  A+VI+N
Sbjct: 203 SDSINRFGGMGSATPL----DARTVQVLVPQGNSNQVRVLANIQNIEVSVGSFDAKVIVN 258

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+  NV +    V+ GNL+V +     V QPN     G TV   NT + V   +
Sbjct: 259 SRTGSVVMNRNVELDSCAVAQGNLSVVVDRQNTVSQPNTPFGGGQTVVTPNTQISVQQGQ 318

Query: 322 GSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           GS   +  + +LNS++  +N++G   + ++SILQ +++AG L++++ I
Sbjct: 319 GSLQQVRSSANLNSVVRTLNALGATPNDLMSILQAMQSAGCLRAKLEI 366


>gi|312962291|ref|ZP_07776782.1| flagellar P-ring protein precursor FlgI [Pseudomonas fluorescens
           WH6]
 gi|311283218|gb|EFQ61808.1| flagellar P-ring protein precursor FlgI [Pseudomonas fluorescens
           WH6]
          Length = 371

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 140/351 (39%), Positives = 214/351 (60%), Gaps = 13/351 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--RL 82
           R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+  ++L   GI  P G   +
Sbjct: 26  RLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPFTLQTFNNMLSQFGIKVPAGSGNV 85

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAV ++A+LP F+ PG  +D++++S+G++ SLRGG L+MT L G DGN+YA+AQG
Sbjct: 86  QLKNVAAVSISADLPAFSKPGQVVDITVSSIGNSKSLRGGTLLMTPLKGIDGNVYAIAQG 145

Query: 143 SVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VV G   +G+  S +   + + G+I  GA VER +P  F     L L L   DF+TA 
Sbjct: 146 NLVVGGFDAEGRDGSKITVNVPSAGRIPGGATVERTVPSGFNQGNSLTLNLNRSDFTTAK 205

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEML-TVETD---TPAR 257
           R+ D+IN    +     +A+A D  +++V+ P  +D ++ +  + +L  +E D     A+
Sbjct: 206 RVVDKIN----DMLGPGVAQALDGGSIRVTAP--LDPSQRVDYLSILENLEVDPGQAVAK 259

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP   S+  + V   +     
Sbjct: 260 VIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGPLSNGQTAVVPRSRVNAQ 319

Query: 318 SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 320 QEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGALQADLIV 370


>gi|308273547|emb|CBX30149.1| Flagellar P-ring protein [uncultured Desulfobacterium sp.]
          Length = 371

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 152/368 (41%), Positives = 227/368 (61%), Gaps = 28/368 (7%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+ S++  R NQL GYGL++GL G+GD    + FT Q++ ++++N+GI      + 
Sbjct: 8   ARIKDLSSIKGIRSNQLFGYGLIIGLNGSGDK-NGTTFTIQALANMMENMGIHVSPSDIK 66

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
             N+AAVMV A LPPFA  G +IDV+++S+GDA SL GG L++T L G DG IYA+AQG 
Sbjct: 67  VNNIAAVMVNAELPPFARTGKKIDVTVSSIGDAKSLLGGTLLLTPLKGVDGKIYALAQGP 126

Query: 144 VVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G    G +     +   T G+IVNGA VE+E+    ++  DL L L NPDF TA R
Sbjct: 127 IVVGGFSSGGDAGGGVTKNHPTVGRIVNGATVEKEVLLSLENRNDLTLMLDNPDFVTATR 186

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVII 260
           +A+ I +    +F   +A+  DS T+K++ P     D+  L++++  L V+ D  A+VI+
Sbjct: 187 VAEAIKT----QFGEDLAKPVDSGTLKITVPQAYQNDVVGLLAKLGDLEVKPDIVAKVIV 242

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF------------------- 301
           NE+TGT+VIG+NV IS V V++GNL +QI E + V QP+                     
Sbjct: 243 NEKTGTVVIGENVTISIVAVAHGNLNIQIKETKDVSQPSPLGVSRSINTAPTQMKNGTVV 302

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           +  G+TV   NT++  ++ K S  LI++   +  L+  +N+IG+    +I+ILQ IKAAG
Sbjct: 303 APGGATVVTPNTEINTNEEKASLLLINSGKTVGELVRALNAIGVTPRDLITILQTIKAAG 362

Query: 361 ALQSEIII 368
           ALQ+E+ I
Sbjct: 363 ALQAELEI 370


>gi|157147098|ref|YP_001454417.1| flagellar basal body P-ring protein [Citrobacter koseri ATCC
           BAA-895]
 gi|157084303|gb|ABV13981.1| hypothetical protein CKO_02875 [Citrobacter koseri ATCC BAA-895]
          Length = 367

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 156/372 (41%), Positives = 215/372 (57%), Gaps = 14/372 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R   L F LI     +AQ   R+ DVV +Q  R NQL+GY LVVGL GTGD      F
Sbjct: 4   MMRKLALFFLLICSMNAAAQ---RLGDVVDIQGVRGNQLVGYSLVVGLDGTGDK-NQVKF 59

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+  P       KNVAAV ++A LPP  + G  IDV+++S+GDA SLR
Sbjct: 60  TSQSVTNMLRQFGVQLPAKIDPKVKNVAAVAISATLPPGYARGQSIDVTVSSIGDAKSLR 119

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L GADG +YA+AQG+VVV G+  +G S SS     +T G++ NG  VERE+P
Sbjct: 120 GGTLLLTQLRGADGEVYALAQGNVVVGGVKAEGNSGSSVTINTATVGRVPNGGSVEREVP 179

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F+    ++L L+ P F TA  +A  +N    N F    A A  +  V V  P    D 
Sbjct: 180 SDFQQEPVVMLNLKRPSFKTANSVAVALN----NAFGSGTATAQSATNVAVRAPMGAGDR 235

Query: 239 TRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              MS +E + +     P RV+ N RTGT+VIGD V +    VS+GNLTV I E+  V Q
Sbjct: 236 VAFMSSLEDVQINAGKQPPRVVFNARTGTVVIGDGVVVRAAAVSHGNLTVTIRESSNVSQ 295

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGI 356
           P AF S G TV    +D+ V+  +G    I A   L S+++ +NS+G   D  ++ILQ +
Sbjct: 296 PGAF-SQGRTVVTPESDVNVNRGRGQMVTIAAGTSLRSIVNTINSLGAAPDDTMAILQAL 354

Query: 357 KAAGALQSEIII 368
             AGAL +E+++
Sbjct: 355 HEAGALDAELVV 366


>gi|271500070|ref|YP_003333095.1| flagellar P-ring protein [Dickeya dadantii Ech586]
 gi|270343625|gb|ACZ76390.1| flagellar P-ring protein [Dickeya dadantii Ech586]
          Length = 369

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 147/348 (42%), Positives = 217/348 (62%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RI+D+V++Q  RDN LIGYGLVVGL GTGD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 25  RIRDLVTIQGVRDNALIGYGLVVGLDGTGDQTTQTPFTTQSLNNMLSQLGITVPAGTNMQ 84

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LPPFA  G  +DV ++S+G+A SLRGG L+MT L G D  +YA+AQG+
Sbjct: 85  LKNVAAVMVTAKLPPFARAGQAVDVVVSSMGNAKSLRGGTLLMTPLKGVDNQVYAIAQGN 144

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           +++ G       SS      +GG+I  GAI+ERELP  F     ++LQL   DF+ A  I
Sbjct: 145 LLIGGAGAAAGGSSVQVNQLSGGRISGGAIIERELPNTFGTGNTIMLQLNQDDFTMAQSI 204

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVEMLTVETDT-PARVIIN 261
           +D IN +     + P+    DSRTV+V  P  N    R +++++ + V   T  A+VIIN
Sbjct: 205 SDAINRFGRGGSAAPL----DSRTVRVIVPAGNSAQVRFLADMQNIEVNVGTLDAKVIIN 260

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+  NV++    V+ GNL+V I +   V QPN   + G TV    T++ +    
Sbjct: 261 SRTGSVVMNRNVQLENCAVAQGNLSVTINQQNVVSQPNTPLAGGQTVVTPQTEISMRQEG 320

Query: 322 GSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           G+   ++ + +LNS++  +NS+G     ++SILQ +++AG L++++ I
Sbjct: 321 GALQRVNSSANLNSVVRALNSLGATPMDLMSILQAMESAGCLRAKLEI 368


>gi|300311356|ref|YP_003775448.1| flagellar basal-body P-ring protein [Herbaspirillum seropedicae
           SmR1]
 gi|300074141|gb|ADJ63540.1| flagellar basal-body P-ring protein [Herbaspirillum seropedicae
           SmR1]
          Length = 376

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 147/351 (41%), Positives = 212/351 (60%), Gaps = 17/351 (4%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---R 81
           R+KD+ S+Q  R NQL+GYGLVVGL G+GD    +PFT QS+ S+LQ LG++ P G    
Sbjct: 31  RLKDLASIQGVRQNQLVGYGLVVGLDGSGDQTTQTPFTVQSVISMLQQLGVNVPTGTSSN 90

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
           +  KNVAA MVTANLP FA PG  IDV+++S+G+A S+RGG L+M  L GADG IYA+AQ
Sbjct: 91  MQLKNVAAAMVTANLPAFAQPGQLIDVTVSSIGNAKSIRGGTLLMAPLKGADGQIYAIAQ 150

Query: 142 GSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           G++VV G       SS +    + G+I  GA VER +P     S  ++L+L + DFSTA 
Sbjct: 151 GNIVVGGAGGSAAGSSTVINQLSAGRISGGATVERAVPSSLGSSDMIVLELNDNDFSTAS 210

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVEMLTVETDTP----A 256
           R+ D +N     RF    A A D R ++V  P ++ D    +  +E + V   TP    A
Sbjct: 211 RVVDALN----KRFGNETAVAQDGRVIRVRAPISSGDRVAFLGALENVDV---TPGKLAA 263

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +VI+N RTG++V+  +V +    VS+GNL+V I  +  V QPNA +  G T    N  + 
Sbjct: 264 KVILNARTGSVVMNQSVMLDTCAVSHGNLSVVIQADNAVSQPNALAG-GQTAGVQNAQIS 322

Query: 317 VSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           ++   G   L+     L  ++  +N+IG     +++ILQ +KAAG+L++E+
Sbjct: 323 INKEPGKVMLLKGGASLAEVVKALNAIGATPQDLLAILQAMKAAGSLRAEL 373


>gi|238785493|ref|ZP_04629476.1| Flagellar P-ring protein [Yersinia bercovieri ATCC 43970]
 gi|238713595|gb|EEQ05624.1| Flagellar P-ring protein [Yersinia bercovieri ATCC 43970]
          Length = 369

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 150/365 (41%), Positives = 220/365 (60%), Gaps = 9/365 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L  +L+ L  + AQ   RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+ 
Sbjct: 9   LFITLLSLVWMPAQA-ERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSLS 67

Query: 68  SLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+RGG L+M
Sbjct: 68  NMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSIRGGTLLM 127

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L G D  +YA+AQG+V+V G       SS      TGG+I  GA +ERELP  F    
Sbjct: 128 TPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISGGATIERELPTTFGSDG 187

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEV 245
            + LQL   DF+ A +++D IN      F    A A D+RT+++  P  N    R ++++
Sbjct: 188 VINLQLNTEDFTMAQQVSDAINRQ--RGFGS--ATAIDARTIQILVPRGNSSQVRFLADI 243

Query: 246 EMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           + + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP+     
Sbjct: 244 QNIPVNVDAGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVSQPDTPFGG 303

Query: 305 GSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G TV   NT + V    G    ++A P+LN+++  +NS+G     ++SILQ +++AG L+
Sbjct: 304 GQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQSAGCLR 363

Query: 364 SEIII 368
           +++ I
Sbjct: 364 AKLEI 368


>gi|330719499|gb|EGG98115.1| Flagellar P-ring protein FlgI [gamma proteobacterium IMCC2047]
          Length = 370

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 146/373 (39%), Positives = 226/373 (60%), Gaps = 15/373 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++ + AF + +++ + +    +  R+KD+ S+   R NQL+GYGLVVGL GTGD    + 
Sbjct: 7   LMHKKAFWVLAVLVVCQ--PVMADRLKDLASVAGVRTNQLLGYGLVVGLDGTGDK---TT 61

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+QS ++LL   GI+ P G     KNVAAV V A+L  FA PG +IDV+++SLGD+ SL
Sbjct: 62  FTQQSFKNLLTQFGIALPAGVTPNPKNVAAVAVHADLQSFAKPGQQIDVTVSSLGDSKSL 121

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVEREL 178
           RGG L++T L G D  IYA+AQG++VV G   +G   S +   + + G++ NGA VER +
Sbjct: 122 RGGTLLITPLKGLDDQIYAIAQGNLVVGGFGAQGADGSRITVNVPSVGRVPNGATVERSV 181

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L   L  PDF+TA R+AD+IN    N      A A DS +++V+ P N   
Sbjct: 182 PNSFALGDTLTFNLNAPDFTTAKRVADKIN----NLLGANTAFAMDSTSIQVTAPRNASQ 237

Query: 238 LTRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L ++  +  A+VIIN RTGTIVIG +VR++   +++GNL V I+E+ QV 
Sbjct: 238 RVTYLSVLENLEIDPAEATAKVIINSRTGTIVIGKHVRVAPAAITHGNLAVTISESPQVS 297

Query: 297 QPNAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP  F S G TV   ++ + + + +  +F       L+ ++  +N +G     +++IL+ 
Sbjct: 298 QPAPF-SEGDTVITPSSQIGIDEGDSRAFVFNPGVSLDEIVQAVNQVGAAPGDLMAILEA 356

Query: 356 IKAAGALQSEIII 368
           +K AGAL++ +++
Sbjct: 357 LKQAGALRASLVV 369


>gi|54294167|ref|YP_126582.1| flagellar basal body P-ring protein [Legionella pneumophila str.
           Lens]
 gi|81601408|sp|Q5WX67|FLGI_LEGPL RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|53753999|emb|CAH15470.1| flagellar P-ring protein precursor FlgI [Legionella pneumophila
           str. Lens]
          Length = 367

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 222/373 (59%), Gaps = 14/373 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVS-RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            R   +I  ++ +H I+ QV + RIKD+ +L   R NQL+GYGLVVGL GTGD    + F
Sbjct: 1   MRRMLVIRWILAIHLIATQVFAERIKDIATLAGVRVNQLVGYGLVVGLSGTGDK-TGTKF 59

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           TE S  ++L  LGI+ P G RL SKN+AAVMVTANL  F   G  +DV+I+S+GD+ SL 
Sbjct: 60  TEDSFANMLTQLGINVPPGVRLNSKNIAAVMVTANLSSFMKKGQTMDVNISSIGDSKSLL 119

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L GADG +YA++QG+VVVSG+   G   SS    I +GG+I NGA +E ++P
Sbjct: 120 GGTLLLTPLKGADGRVYAMSQGNVVVSGISASGSDGSSVTVNIPSGGRIPNGATIEADIP 179

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN---- 235
             F  S  L   L  PDF+TA R++D IN           A+A D+ +V V+ P      
Sbjct: 180 NPFYYSNSLTYNLHTPDFTTAKRMSDAINEL----MGPGTAKAIDAGSVVVTAPKKLSQR 235

Query: 236 IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
           +D   ++  +E    E    A++IIN RTGT+VI  NV +    VS+GNL V ITE   +
Sbjct: 236 VDYVSVLENIEFKPGE--AMAKIIINARTGTVVISSNVIVKSAAVSHGNLVVSITETPVI 293

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
            QPNAF+S  +  TQ +       N  +F L     L  ++ G+N++G     +ISIL+ 
Sbjct: 294 SQPNAFASGRTVATQQSQVNIQQKNNRAFILPKGTTLKDIVRGINAVGATPADVISILEA 353

Query: 356 IKAAGALQSEIII 368
           ++ AGAL + +I+
Sbjct: 354 LQQAGALSATLIV 366


>gi|229591867|ref|YP_002873986.1| flagellar basal body P-ring protein [Pseudomonas fluorescens SBW25]
 gi|229363733|emb|CAY51137.1| flagellar P-ring protein precuror [Pseudomonas fluorescens SBW25]
          Length = 368

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 140/351 (39%), Positives = 214/351 (60%), Gaps = 13/351 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--RL 82
           R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+  ++L   GI  P G   +
Sbjct: 23  RLKDIASISGVRSNQLIGYGLVVGLSGTGDQTTQTPFTLQTFNNMLSQFGIKVPAGSGNV 82

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAV ++A+LP F+ PG  +D++++S+G++ SLRGG L+MT L G DGN+YA+AQG
Sbjct: 83  QLKNVAAVSISADLPAFSKPGQVVDITVSSIGNSKSLRGGTLLMTPLKGIDGNVYAIAQG 142

Query: 143 SVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VV G   +G+  S +   + + G+I  GA VER +P  F     L L L   DF+TA 
Sbjct: 143 NLVVGGFDAEGRDGSKITVNVPSAGRIPGGATVERTVPSGFNQGNSLTLNLNRSDFTTAK 202

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEML-TVETD---TPAR 257
           R+ D+IN    +     +A+A D  +++V+ P  +D ++ +  + +L  +E D     A+
Sbjct: 203 RVVDKIN----DMLGPGVAQAIDGGSIRVTAP--LDPSQRVDYLSILENLEVDPGQAVAK 256

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP   S+  + V   +     
Sbjct: 257 VIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGPLSNGQTAVVPRSRVNAQ 316

Query: 318 SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 317 QEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGALQADLIV 367


>gi|163856439|ref|YP_001630737.1| flagellar basal body P-ring protein [Bordetella petrii DSM 12804]
 gi|163260167|emb|CAP42469.1| flagellar basal-body P-ring protein FlgI [Bordetella petrii]
          Length = 377

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 145/348 (41%), Positives = 210/348 (60%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLG 83
           RIKD+ S+Q  R N LIGYGLVVGL G+GD +R +PFT+QS+ ++L  LGI+ P G  + 
Sbjct: 33  RIKDLASIQGVRGNPLIGYGLVVGLDGSGDQVRQTPFTQQSLTNMLSQLGITVPPGSNMQ 92

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LP FA PG R+DV ++S+G+A SLRGG L+MT L GAD  +YA+AQG+
Sbjct: 93  LKNVAAVMVTATLPAFARPGQRLDVVVSSMGNAKSLRGGTLLMTPLKGADSQVYAIAQGN 152

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       SS       GG+I +GAIVER +P  F     + L++   DF T   +
Sbjct: 153 ILVGGAGASAGGSSVQINQLNGGRINDGAIVERGVPTSFSRDGLIYLEMDVTDFGTTQNV 212

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV-ETDTPARVIIN 261
              +N     +F    AEA D R V+V  P +  +    ++ VE L V      A+VIIN
Sbjct: 213 VAALN----RQFGAGTAEAVDGRVVQVRGPLDAAEQAAFLARVENLQVRRAPATAKVIIN 268

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+   V I +  V++GNL+V I    QV QP+     G TV   NT ++V    
Sbjct: 269 ARTGSVVMNQTVMIDEAAVAHGNLSVIINRQTQVSQPDTPFGGGQTVVVPNTQIEVRQED 328

Query: 322 GSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           G+   +  + +L  ++  +N++G     +++ILQ +K+AGAL++++ I
Sbjct: 329 GALHRVRTSANLADVVKALNALGATPQDLLAILQAMKSAGALRADLEI 376


>gi|222823435|ref|YP_002575009.1| flagellar P-ring protein FlgI [Campylobacter lari RM2100]
 gi|254789290|sp|B9KFC3|FLGI_CAMLR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|222538657|gb|ACM63758.1| flagellar P-ring protein FlgI [Campylobacter lari RM2100]
          Length = 348

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 141/343 (41%), Positives = 210/343 (61%), Gaps = 18/343 (5%)

Query: 26  IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSK 85
           IK++ ++   RDNQLIGYGLVVGL G+GD   SS FT QS+ ++LQ + +    G + SK
Sbjct: 19  IKELTNVVGVRDNQLIGYGLVVGLNGSGDG-TSSEFTLQSISNMLQGMNVKVSPGDIKSK 77

Query: 86  NVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVV 145
           N AAVMVTA LP FA  G ++DVS+ SLGDA SL+GG L+MT+L G DG IYAVAQGS+ 
Sbjct: 78  NTAAVMVTAKLPAFARSGDKLDVSVASLGDAKSLQGGTLLMTALKGVDGEIYAVAQGSLA 137

Query: 146 VSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIAD 205
           + GL  +  ++      ST   ++NGA+VERE+P+ F  S DLIL L+  DF TA  I  
Sbjct: 138 IGGLSPRPGAAGTH---STSANVINGAVVEREIPQNFSQSEDLILSLKEADFKTANNIER 194

Query: 206 QINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERTG 265
            +N+     F   IA+A DSRT+K++KP        M+ V    +     ++VII+ERTG
Sbjct: 195 VLNTI----FDTDIAKALDSRTIKLTKPEEFSHVEFMARVLEQDIAYTPESKVIIDERTG 250

Query: 266 TIVIGDNVRISKVVVSYGNLTVQITENEQVV--QPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TIV G N+ +  +++++ ++T++I  N  V   Q      +G  +   +  LK+++NK +
Sbjct: 251 TIVAGVNIEVEPILITHKDITIKIDPNNTVALGQNEIDMKDGGILDPVSNTLKITNNKTT 310

Query: 324 FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            +        ++   +N +G   + II+I+Q +K AGA+ +E+
Sbjct: 311 VA--------NIARMLNKLGAAPNDIIAIMQNLKRAGAISAEL 345


>gi|148358810|ref|YP_001250017.1| flagellar P-ring protein FlgI [Legionella pneumophila str. Corby]
 gi|296106855|ref|YP_003618555.1| flagellar P-ring protein precursor FlgI [Legionella pneumophila
           2300/99 Alcoy]
 gi|166214836|sp|A5IBC1|FLGI_LEGPC RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|148280583|gb|ABQ54671.1| flagellar P-ring protein (precursor) FlgI [Legionella pneumophila
           str. Corby]
 gi|295648756|gb|ADG24603.1| flagellar P-ring protein precursor FlgI [Legionella pneumophila
           2300/99 Alcoy]
          Length = 367

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 222/373 (59%), Gaps = 14/373 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVS-RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            R   +I  ++ +H I+ QV + RIKD+ +L   R NQL+GYGLVVGL GTGD    + F
Sbjct: 1   MRRMLVIRWILAIHLIATQVFAERIKDIATLAGVRVNQLVGYGLVVGLSGTGDK-TGTKF 59

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           TE S  ++L  LGI+ P G RL SKN+AAVMVTANL  F   G  +DV+I+S+GD+ SL 
Sbjct: 60  TEDSFANMLTQLGINVPPGVRLNSKNIAAVMVTANLSSFMKKGQTMDVNISSIGDSKSLL 119

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L GADG +YA++QG+VVVSG+   G   SS    + +GG+I NGA +E ++P
Sbjct: 120 GGTLLLTPLKGADGRVYAMSQGNVVVSGISASGSDGSSVTVNVPSGGRIPNGATIEADIP 179

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN---- 235
             F  S  L   L  PDF+TA R++D IN           A+A D+ +V V+ P      
Sbjct: 180 NPFYYSNSLTYNLHTPDFTTAKRMSDAINEL----MGPGTAKAIDAGSVVVTAPKKLSQR 235

Query: 236 IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
           +D   ++  +E    E    A++IIN RTGT+VI  NV +    VS+GNL V ITE   +
Sbjct: 236 VDYVSVLENIEFKPGE--AMAKIIINARTGTVVISSNVIVKSAAVSHGNLVVSITETPVI 293

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
            QPNAF+S  +  TQ +       N  +F L     L  ++ G+N++G     +ISIL+ 
Sbjct: 294 SQPNAFASGRTVATQQSQVNIQQKNNRAFILPKGTTLKDIVRGINAVGATPADVISILEA 353

Query: 356 IKAAGALQSEIII 368
           ++ AGAL + +I+
Sbjct: 354 LQQAGALSATLIV 366


>gi|167843914|ref|ZP_02469422.1| flagellar basal body P-ring protein [Burkholderia pseudomallei
           B7210]
          Length = 401

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 147/359 (40%), Positives = 209/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 47  RLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANG 106

Query: 81  -------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
                   +  KNVAAVMVTA LPPFA  G  IDV+++SLG+A SLRGG L++T L GAD
Sbjct: 107 GGSSAMTNMQLKNVAAVMVTATLPPFARSGEAIDVTVSSLGNAKSLRGGTLLLTPLKGAD 166

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQL 192
           G +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL
Sbjct: 167 GQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQL 226

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE 251
            + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V 
Sbjct: 227 NDMDYGTAQRIVSAVNSS----FGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEVS 282

Query: 252 TD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
            +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV  
Sbjct: 283 PERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVVA 341

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + GS  ++ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 342 QQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|312880332|ref|ZP_07740132.1| flagellar P-ring protein [Aminomonas paucivorans DSM 12260]
 gi|310783623|gb|EFQ24021.1| flagellar P-ring protein [Aminomonas paucivorans DSM 12260]
          Length = 371

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 139/348 (39%), Positives = 204/348 (58%), Gaps = 12/348 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KDV  L+  R NQL+G GLVVGLQGTGD         + M ++    G++     + S
Sbjct: 33  RVKDVAVLEGARPNQLVGMGLVVGLQGTGDK---GDMAMRMMSNMSSRFGLTIDPKLVKS 89

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVA V VT  LPPF  PG  +DV +++ GDA SL+GG+L+ T L  A+G +YAVAQGS+
Sbjct: 90  KNVALVSVTCELPPFVVPGQTLDVLVSAAGDAKSLQGGVLLQTPLKAANGKVYAVAQGSL 149

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
            + G    GQ +   + ++T G++  GAIVE+     F     + L LR PDF+TA R+A
Sbjct: 150 SLGGFSAGGQGAQVSKNVTTVGRVPGGAIVEQGTESSFVPGGRMSLLLRQPDFTTATRVA 209

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIINE 262
             IN +        +A   D+  V+V+ P +        ++ +E LT+  D+ ARV++NE
Sbjct: 210 KAINKHHGQ-----VARVVDAGRVEVAVPASYGDSPASFVAALEGLTLVPDSVARVVVNE 264

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+V+G NVRI    V++GNLTV+++EN QV QPN     G T     TDL+  + +G
Sbjct: 265 RTGTVVMGGNVRIGSAAVAHGNLTVRVSENPQVSQPNPL-GQGQTAVVPRTDLQAQEGQG 323

Query: 323 S-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              +L ++  +  L+  +N++G     +I ILQ +  AGAL  ++IIQ
Sbjct: 324 QVVALPESSTVTDLVRALNAVGATPRDLIPILQALDQAGALHGQLIIQ 371


>gi|307609981|emb|CBW99510.1| flagellar P-ring protein precursor FlgI [Legionella pneumophila
           130b]
          Length = 367

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 222/373 (59%), Gaps = 14/373 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVS-RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            R   +I  ++ +H I+ QV + RIKD+ +L   R NQL+GYGLVVGL GTGD    + F
Sbjct: 1   MRRMLVIRWILAIHLIATQVFAERIKDIATLAGVRVNQLVGYGLVVGLSGTGDK-TGTKF 59

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           TE S  ++L  LGI+ P G RL SKN+AAVMVTANL  F   G  +DV+I+S+GD+ SL 
Sbjct: 60  TEDSFANMLTQLGINIPPGVRLNSKNIAAVMVTANLSSFMKKGQTMDVNISSIGDSKSLL 119

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L GADG +YA++QG+VVVSG+   G   SS    + +GG+I NGA +E ++P
Sbjct: 120 GGTLLLTPLKGADGRVYAMSQGNVVVSGISASGSDGSSVTVNVPSGGRIPNGATIEADIP 179

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN---- 235
             F  S  L   L  PDF+TA R++D IN           A+A D+ +V V+ P      
Sbjct: 180 NPFYYSNSLTYNLHTPDFTTAKRMSDAINEL----MGPGTAKAIDAGSVVVTAPKKLSQR 235

Query: 236 IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
           +D   ++  +E    E    A++IIN RTGT+VI  NV +    VS+GNL V ITE   +
Sbjct: 236 VDYVSVLENIEFKPGE--AMAKIIINARTGTVVISSNVIVKSAAVSHGNLVVSITETPVI 293

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
            QPNAF+S  +  TQ +       N  +F L     L  ++ G+N++G     +ISIL+ 
Sbjct: 294 SQPNAFASGRTVATQQSQVNIQQKNNRAFILPKGTTLKDIVRGINAVGATPADVISILEA 353

Query: 356 IKAAGALQSEIII 368
           ++ AGAL + +I+
Sbjct: 354 LQQAGALSATLIV 366


>gi|330899408|gb|EGH30827.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 345

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 142/348 (40%), Positives = 208/348 (59%), Gaps = 9/348 (2%)

Query: 26  IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR--LG 83
           +KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+  ++L   GI  P G   + 
Sbjct: 1   MKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPFTLQTFNNMLSQFGIKVPAGSGTVQ 60

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV V A+LP FA PG  +D++++S+G++ SLRGG L+MT + G DGN+YA+AQG+
Sbjct: 61  LKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSLRGGALLMTPMKGVDGNVYAIAQGN 120

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G   +G+  S +   + + G+I  GA VER +P  F     L L L   DF+TA R
Sbjct: 121 LVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSVPSGFNQGNTLTLNLNRSDFTTAKR 180

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVET-DTPARVII 260
           + D+IN          +A+A D  +V+V+ P +       +S +E L V+   T A+VII
Sbjct: 181 VVDKINEL----LGPGVAQALDGGSVRVTAPLDPGQRVDYLSILENLEVDPGQTAAKVII 236

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTGTIVIG NV++S   V++G+LTV ITE+  V QP A S   + V   +      + 
Sbjct: 237 NSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGALSGGQTAVVPRSRVNAQQEL 296

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 297 HPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGALQADLIV 344


>gi|2494541|sp|Q52082|FLGI_PSEPU RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|405550|gb|AAA62846.1| flagellar P-ring protein [Pseudomonas putida]
          Length = 367

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 147/374 (39%), Positives = 219/374 (58%), Gaps = 15/374 (4%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F +  LI + + L    A    R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MFNVRQLIATTLLLSCAFAAQAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LPPFA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPAGSGNVQLKNVAAVSVHADLPPFAKPGQVVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVEREL 178
           RGG L+MT L G DGN+YA+AQG++VV G   +G+  S +   + + G+I  GA VER +
Sbjct: 121 RGGSLLMTPLKGIDGNVYAIAQGNLVVGGFDAQGRDGSKITVNVPSAGRIPGGASVERAV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN--- 235
           P  F     L L L  PDF+TA RI D++N          +A+A    +V+VS P +   
Sbjct: 181 PSGFNQGNTLTLNLNRPDFTTAKRIVDKVNDL----LGPGVAQAVHGGSVRVSAPMDPSQ 236

Query: 236 -IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQ 294
            +D   ++  +E+   +    A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  
Sbjct: 237 RVDYLSILENLEIDPGQAV--AKVIINSRTGTIVIGQNVKVSP-AVTHGSLTVTITEDPI 293

Query: 295 VVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQ 354
           V QP AFS+  + V   +      + K  F       L+ ++  +N +G     +++IL+
Sbjct: 294 VSQPGAFSNGQTAVVPRSRVNAEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGNLMAILE 353

Query: 355 GIKAAGALQSEIII 368
            +K    LQ+++I+
Sbjct: 354 ALKHR-PLQADLIV 366


>gi|157371203|ref|YP_001479192.1| flagellar basal body P-ring protein [Serratia proteamaculans 568]
 gi|157322967|gb|ABV42064.1| flagellar P-ring protein [Serratia proteamaculans 568]
          Length = 366

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 152/372 (40%), Positives = 222/372 (59%), Gaps = 11/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ +I   ++  IGL  + A    RI+D+V++Q  RDN LIGYGLVVGL G+GD    +P
Sbjct: 1   MLKKILLTLW--IGLVCLPA-TAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTP 57

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF+  G  IDV ++S+G+A SL
Sbjct: 58  FTTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTARLPPFSRTGQNIDVVVSSMGNAKSL 117

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA +ERELP
Sbjct: 118 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISNGATIERELP 177

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
             F     + LQL + DF+ A +I+D IN       + P+    D+RT++V  P  N   
Sbjct: 178 TTFGAGGVINLQLNDEDFTLAQQISDAINRQRGGGTASPL----DARTIQVLVPQGNSSQ 233

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R ++E++ + V      A+VIIN RTG++V+  +V +    V+ GNL+V +     V Q
Sbjct: 234 VRFLAEIQNINVSVGAMDAKVIINSRTGSVVMNRDVILDSCAVAQGNLSVVVDRQNTVSQ 293

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGI 356
           P      G TV   NT + V    GS   ++A  +LN++I  +N++G     ++SILQ +
Sbjct: 294 PTTPFGGGQTVVTPNTQISVQQQGGSLQKVNASANLNNVIRALNALGATPIDLMSILQAM 353

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 354 QSAGCLRAKLEI 365


>gi|221069318|ref|ZP_03545423.1| flagellar P-ring protein [Comamonas testosteroni KF-1]
 gi|220714341|gb|EED69709.1| flagellar P-ring protein [Comamonas testosteroni KF-1]
          Length = 382

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 142/371 (38%), Positives = 217/371 (58%), Gaps = 13/371 (3%)

Query: 4   RIAFLIFSLIGLHEISAQV-VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             A L+ + +G   ++     +RIK+V ++Q  R NQL GYGLVVGL GTGD     P+T
Sbjct: 14  HTALLVVAALGASGLTLPAHATRIKEVAAIQGVRSNQLTGYGLVVGLDGTGDQTTQMPYT 73

Query: 63  EQSMRSLLQNLGISTPG----GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           +Q++ + L+ +GI+ P      +L  KNVAAV++TA LP FA PG  ID++++S+G+A S
Sbjct: 74  KQALANYLEQMGIALPATGNAAQLQLKNVAAVIITAELPAFAQPGQAIDINVSSMGNAKS 133

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           L+GG LV T L GADG IYA+AQG+VVV G       S         G++  GA VER +
Sbjct: 134 LKGGTLVATPLRGADGEIYALAQGNVVVGGAGAAAGGSKVQVNHLNAGRVPQGAQVERAV 193

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P      + + L L   DF TA ++   IN     R     A A D RTV+V+ P +   
Sbjct: 194 PTPVNQGSTITLGLNQTDFQTADKMVRAIN----QRLGAGTAMALDGRTVQVNAPIDPGS 249

Query: 238 LTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
             R+++E++ + +ET  P A+V+IN RTG+IV+   V +    +++GNL++ I+    + 
Sbjct: 250 RVRMIAEIQEMPIETSKPAAKVVINARTGSIVLNQAVTLGPCAIAHGNLSITISTTPVIS 309

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP  F S G TV    +D++V    G   ++ ++P L  ++  +NS+G     +++ILQ 
Sbjct: 310 QPAPF-SQGQTVVAQKSDIQVKQEPGKVINMPNSPQLTDVVRALNSLGATPQDLLAILQA 368

Query: 356 IKAAGALQSEI 366
           IKAAGA+ +E+
Sbjct: 369 IKAAGAMDAEL 379


>gi|124268250|ref|YP_001022254.1| flagellar basal body P-ring protein [Methylibium petroleiphilum
           PM1]
 gi|124261025|gb|ABM96019.1| flagellar basal-body P-ring protein [Methylibium petroleiphilum
           PM1]
          Length = 384

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 152/370 (41%), Positives = 223/370 (60%), Gaps = 16/370 (4%)

Query: 5   IAFLIF--SLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           IAF +F  S      + AQ  +R+K+V ++Q  R NQLIGYGLVVGL GTGD    +PFT
Sbjct: 20  IAFSLFIASAAVWWPVDAQA-ARLKEVAAVQGVRSNQLIGYGLVVGLDGTGDQTTQTPFT 78

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+ ++LQ LG++ P G  +  +NVAAVMVTA+LPPFA PG +ID++++S+G+A SLRG
Sbjct: 79  TQSLNAMLQQLGVTVPPGTSVQLRNVAAVMVTASLPPFAQPGQQIDINVSSMGNAKSLRG 138

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G LV+T L GADG IYA+AQG++++ G       S         G++  GA VER +P  
Sbjct: 139 GTLVVTPLRGADGQIYALAQGNLIIGGAGASAGGSKVQVNTLNAGRVPGGATVERGVPTP 198

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TR 240
                 + L L   D+STA  +A  INS    +     A+A D RTV+V  P + +    
Sbjct: 199 LAQGDAIQLDLNAADYSTAREVARVINS----KMGANTAQALDGRTVRVLMPADANARVA 254

Query: 241 LMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            ++++E L ++   P ARV++N RTG++V+  +V ++   V++GNL+V I+    + QP 
Sbjct: 255 FLADIENLPIDLAAPAARVVVNARTGSVVVNQSVTLNPCAVAHGNLSVTISSQPVISQPG 314

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP---DLNSLISGMNSIGLKTDGIISILQGI 356
             SS G TV     D+ +  + G  SLI  P    L  ++  +NS+G     +++ILQ I
Sbjct: 315 PLSS-GQTVVAERADIAIKQDAG--SLIQLPAGTQLTDVVKALNSLGATPQELLAILQAI 371

Query: 357 KAAGALQSEI 366
           KAAGAL +E+
Sbjct: 372 KAAGALNAEL 381


>gi|225850282|ref|YP_002730516.1| flagellar P-ring protein FlgI [Persephonella marina EX-H1]
 gi|225644788|gb|ACO02974.1| flagellar P-ring protein FlgI [Persephonella marina EX-H1]
          Length = 362

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 141/353 (39%), Positives = 213/353 (60%), Gaps = 10/353 (2%)

Query: 20  AQVVSRIK--DVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
           A  V+R+K  + V +   R N L GYG+VVGL+GTGD   +S FT  S+ ++L+ +GI  
Sbjct: 15  AFAVNRVKIGNEVEVVGVRQNYLTGYGIVVGLKGTGDG-TTSRFTLISIANMLKKMGIYV 73

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
              ++ +KN AAV+VTA++PPFA  G R DV+++SLGDA SL  G+L+ T L+G DG IY
Sbjct: 74  DPRQVRTKNAAAVIVTASMPPFAKNGMRFDVTVSSLGDAKSLENGVLIRTPLMGPDGKIY 133

Query: 138 AVAQGSVVVSGLFVK-GQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           A AQG V + G F +  +     +   T G ++NG I+ER+LP  F+   DL L L+ PD
Sbjct: 134 AFAQGPVSLGGGFSESNKGGRVTKNFPTTGVVLNGGIIERDLPFSFESMKDLTLTLKIPD 193

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPA 256
           F+ A +I + IN +    F + +A+A D+ TVKV  P  ID     S++  L +E+D   
Sbjct: 194 FTKATKIQNAINRH----FGKQLAKAIDATTVKVKFPEGIDPVEFTSQIMNLEIESDNEP 249

Query: 257 RVIINERTGTIVIGDNVRI-SKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
            V+I ERTGT+++  +++I + + VS+GN+ V + +   V QP   S  G TVT    + 
Sbjct: 250 TVVIYERTGTVIMSGDIKIDTPIYVSHGNIYVSVLKTPVVSQPPPLSG-GETVTAEKVET 308

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            V + +G    I +P L  L+  +N +G+    +I+I+Q IK AG L ++III
Sbjct: 309 TVVEEEGRIFSIQSPSLKDLVQALNDLGVSPRDLIAIIQAIKNAGKLHAKIII 361


>gi|307131605|ref|YP_003883621.1| flagellar P-ring protein flgI [Dickeya dadantii 3937]
 gi|306529134|gb|ADM99064.1| Flagellar P-ring protein flgI [Dickeya dadantii 3937]
          Length = 369

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 157/372 (42%), Positives = 224/372 (60%), Gaps = 10/372 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVS--RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
            RI  +   L+ L  + A   S  RI+D+VS+Q  RDN LIGYGLVVGL GTGD    +P
Sbjct: 1   MRITSIFTVLLALLMVVAPPASAERIRDLVSIQGVRDNALIGYGLVVGLDGTGDQTTQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP FA  G  +DV ++SLG+A SL
Sbjct: 61  FTTQSLSNMLSQLGITVPAGTNMQLKNVAAVMVTAKLPAFARSGQPVDVVVSSLGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  IYA+AQG+V++ G       SS       GG+I  GAI+ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQIYAIAQGNVLIGGAGASAGGSSVQVNQLAGGRISGGAIIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
             F     ++LQL   DF+ A  I+D IN +     + P+    DSRTV+V  P  N   
Sbjct: 181 NTFGTGNTIMLQLNQDDFTMAQSISDAINRFGRGGSAAPL----DSRTVRVVVPAGNSAQ 236

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++++ + V   T  A+VIIN RTG++V+  NV++    V+ GNL+V I +   V Q
Sbjct: 237 VRFLADMQNIEVNVGTLDAKVIINSRTGSVVMNRNVQLENCAVAQGNLSVTINQQNVVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGI 356
           PN   + G TV    T++ V    G+   ++ + +LNS++  +NS+G     ++SILQ +
Sbjct: 297 PNTPLAGGQTVVTPQTEISVRQEGGALQRVNSSANLNSVVRALNSLGATPMDLMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 ESAGCLRAKLEI 368


>gi|54297186|ref|YP_123555.1| flagellar basal body P-ring protein [Legionella pneumophila str.
           Paris]
 gi|81601892|sp|Q5X5T9|FLGI_LEGPA RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|53750971|emb|CAH12382.1| flagellar P-ring protein precursor FlgI [Legionella pneumophila
           str. Paris]
          Length = 367

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 156/373 (41%), Positives = 222/373 (59%), Gaps = 14/373 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVS-RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            R   +I  ++ +H I+ QV + RIKD+ +L   R NQL+GYGLVVGL GTGD    + F
Sbjct: 1   MRRILVIRWILAIHLIATQVFAERIKDIATLAGVRVNQLVGYGLVVGLSGTGDK-TGTKF 59

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           TE S  ++L  LGI+ P G RL SKN+AAVMVTANL  F   G  +DV+I+S+GD+ SL 
Sbjct: 60  TEDSFANMLTQLGINIPPGVRLNSKNIAAVMVTANLSSFMKKGQTMDVNISSIGDSKSLL 119

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L GADG +YA++QG++VVSG+   G   SS    + +GG+I NGA +E ++P
Sbjct: 120 GGTLLLTPLKGADGRVYAMSQGNIVVSGISASGSDGSSVTVNVPSGGRIPNGATIEADIP 179

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN---- 235
             F  S  L   L  PDF+TA R++D IN           A+A D+ +V V+ P      
Sbjct: 180 NPFYYSNSLTYNLHTPDFTTAKRMSDAINEL----MGPGTAKAIDAGSVVVTAPKKLSQR 235

Query: 236 IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
           +D   ++  +E    E    A++IIN RTGT+VI  NV +    VS+GNL V ITE   +
Sbjct: 236 VDYVSVLENIEFKPGEPM--AKIIINARTGTVVISSNVIVKSAAVSHGNLVVSITETPVI 293

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
            QPNAF+S  +  TQ +       N  +F L     L  ++ G+N++G     +ISIL+ 
Sbjct: 294 SQPNAFASGRTVATQQSQVNIQQKNNRAFILPKGTTLKDIVRGINAVGATPADVISILEA 353

Query: 356 IKAAGALQSEIII 368
           ++ AGAL + +I+
Sbjct: 354 LQQAGALSATLIV 366


>gi|242238973|ref|YP_002987154.1| flagellar basal body P-ring protein [Dickeya dadantii Ech703]
 gi|242131030|gb|ACS85332.1| flagellar P-ring protein [Dickeya dadantii Ech703]
          Length = 369

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 150/372 (40%), Positives = 228/372 (61%), Gaps = 10/372 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVS--RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
            R+ +L    I L  + +   S  R++D+V +Q  RDN LIGYGLVVGL GTGD    +P
Sbjct: 1   MRVRWLTLFFITLSLMLSLTASAERLRDLVDIQGVRDNPLIGYGLVVGLDGTGDQTTQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTAN PPFA  G RIDV ++SLG A SL
Sbjct: 61  FTTQSLTNMLSQLGITVPSGTNMQLKNVAAVMVTANYPPFARAGQRIDVVVSSLGSAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           +GG LV+T L G D  +YA+AQG+++V G       S       +GG+I +GAI+ERELP
Sbjct: 121 KGGTLVLTPLKGVDNQVYALAQGNLLVGGAGASSGGSQVKINQLSGGRINSGAIIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
             F  S  LILQL++ +FS A R++D +N Y  +  +R I    D RT++V+ P  N   
Sbjct: 181 STFGTSNRLILQLKDDNFSLAQRVSDAVNRYGASGSARAI----DGRTIEVTIPANNTQQ 236

Query: 239 TRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++++ + ++  +  A+VIIN RTG++V+  NV +    V+ GNL+V +   + V Q
Sbjct: 237 VRFLAQIQDINIDVGEMDAKVIINSRTGSVVMNRNVTLDSCAVAQGNLSVVVNNQQNVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGI 356
           PN   + G T     T + V    G+   ++A  +LNS++  +N++G     ++SI+Q +
Sbjct: 297 PNTPLAGGQTTVTQQTQIDVRQEGGALQRVNASANLNSVVRALNALGATPMDLMSIIQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG +++++ I
Sbjct: 357 RSAGCIKAQVEI 368


>gi|224825781|ref|ZP_03698885.1| flagellar P-ring protein [Lutiella nitroferrum 2002]
 gi|224602005|gb|EEG08184.1| flagellar P-ring protein [Lutiella nitroferrum 2002]
          Length = 368

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 150/349 (42%), Positives = 214/349 (61%), Gaps = 14/349 (4%)

Query: 26  IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLGS 84
           ++++VS++  R+NQLIGYG+VVGL GTGD+ +   F+ QS+ +LL+  GI  P G     
Sbjct: 27  LRNLVSVEGIRENQLIGYGIVVGLDGTGDNSQVK-FSGQSVSNLLKQFGIKQPEGSSTKV 85

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAVMV+A+LPP    G  IDV+++SLGDA SLRGG L++T L  ADG +YA+AQG++
Sbjct: 86  KNVAAVMVSASLPPGYRHGQTIDVTVSSLGDAKSLRGGTLLLTPLRAADGEVYALAQGNL 145

Query: 145 VVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V+ GL  +G+S SS      T G+I NGA +ERE+P  F+    + L L+ P+F TA  I
Sbjct: 146 VIGGLSAQGKSGSSVTVNTPTSGRIPNGASIEREIPSDFESGPSVRLSLKRPNFETATNI 205

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKV-SKPTNIDLTRLMSEVEMLT--VETDTPARVII 260
            + IN +    + R IA   D+ +V+V + P        ++ +E L   V  +TP RVI 
Sbjct: 206 VNTINQH----YGR-IASTRDATSVEVLAPPDPTARVAFVARLEKLNIGVGEETP-RVIF 259

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTGT+VI   V +    VS+GNL V I E+ QV QPN F   G+TV    +D+ V  +
Sbjct: 260 NSRTGTVVISQGVTVRPAAVSHGNLRVVIAESSQVSQPNPF-GKGNTVVTPQSDVSVQQD 318

Query: 321 KGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +G  F       L ++I  +NS G   D I++ILQ +  AGAL  E+++
Sbjct: 319 QGRMFKWPAGAKLQTIIDTINSTGATPDDIMAILQALDQAGALDGELVV 367


>gi|262273524|ref|ZP_06051338.1| flagellar P-ring protein FlgI [Grimontia hollisae CIP 101886]
 gi|262222502|gb|EEY73813.1| flagellar P-ring protein FlgI [Grimontia hollisae CIP 101886]
          Length = 383

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 151/374 (40%), Positives = 220/374 (58%), Gaps = 21/374 (5%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           I   +FS++   +  A+ +  I DV  +   R+NQL+GYGLVVGL GTGD    + FT+Q
Sbjct: 20  ILLTLFSVLIPTQAMARPLLSIADVKGI---RENQLVGYGLVVGLSGTGDK-NQTKFTQQ 75

Query: 65  SMRSLLQNLGISTPGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           S++++L   G+  P     +L  KNVAAV V+A LP  A  G  +DV+++SLGDA SLRG
Sbjct: 76  SVKNMLSQFGVQLPANADPKL--KNVAAVAVSATLPAMAGKGQALDVTVSSLGDAKSLRG 133

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPK 180
           G L++T L GADG IYA+AQG++VV G+  +G S S +   I T G I NGAI+ERE+P 
Sbjct: 134 GTLLLTPLKGADGQIYAMAQGNLVVGGIQAQGSSGSGVTVNIPTAGLIPNGAIIEREVPT 193

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F    +++L L+ P+FSTA  +   IN      F   +A A     ++V  P +     
Sbjct: 194 SFTTEEEVVLNLKKPNFSTARNVEKAINKV----FGPDVAVAESHARIRVRAPMDTSQRV 249

Query: 240 RLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L VE  T   RV+ N RTGT+V+G +V I    VS+GNLTV + EN  V QP
Sbjct: 250 TFLSMLEELDVEETTRKDRVVFNARTGTVVVGQDVHIHTAAVSHGNLTVSVMENLNVSQP 309

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLI----DAPDLNSLISGMNSIGLKTDGIISILQ 354
           NAF    + +T ++T + V + KG   +     +   L +L+  +NS+G   + +++IL 
Sbjct: 310 NAFGQGNTAITPDST-VSVDEEKGKVFIWPESEEGTSLQTLVDAVNSLGASPNDLMAILI 368

Query: 355 GIKAAGALQSEIII 368
            +  AGAL  E++I
Sbjct: 369 ALDEAGALDGELVI 382


>gi|90415314|ref|ZP_01223248.1| flagellar P-ring protein precursor [marine gamma proteobacterium
           HTCC2207]
 gi|90332637|gb|EAS47807.1| flagellar P-ring protein precursor [marine gamma proteobacterium
           HTCC2207]
          Length = 388

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 146/367 (39%), Positives = 217/367 (59%), Gaps = 29/367 (7%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG----- 79
           RIKD+  +   R NQL+G+GLVVGLQGTGD  +  P + QS+++LL  LG+S  G     
Sbjct: 27  RIKDLTDVAGVRSNQLVGFGLVVGLQGTGDG-KDLPLSAQSLKTLLSGLGVSVDGPVSDF 85

Query: 80  ------GRLGSKN---------VAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
                   L S+N         VAAVMVTA +P FA PG RID++++++G A SLRGG L
Sbjct: 86  DLGDAMASLASQNAQKEMKLENVAAVMVTAEMPAFAKPGQRIDINVSAIGVAESLRGGSL 145

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           VMT L G DGN YA+AQG++ V+G+      SS   G+ T G+I NG +VER +   F  
Sbjct: 146 VMTQLRGVDGNTYALAQGAMTVTGISEDAAGSSVTIGVPTSGRIPNGGMVERLVETPFDS 205

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMS 243
           S  ++L +++ DFST+  I   IN+     F   +A A D+ ++ V  P++       MS
Sbjct: 206 SEYIVLNVKDNDFSTSNAITQVINTT----FGAGVASALDAVSIAVMAPSDSSQRVAFMS 261

Query: 244 EVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E L V   + PARV+IN RTGT VI  NVR++ V V++G ++V+IT   ++ QP  F 
Sbjct: 262 MIENLDVTPGEPPARVVINSRTGTAVINRNVRVNAVAVTHGTISVRITATNEISQPGPF- 320

Query: 303 SNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S+G T    N D+ V + N   F      DL  ++  +N +G     +I+IL+ +K++G+
Sbjct: 321 SDGVTAGVTNADIDVEEPNNQMFLFQPGVDLREIVDAVNQVGATPSSLIAILEALKSSGS 380

Query: 362 LQSEIII 368
           L++E+++
Sbjct: 381 LRAELVV 387


>gi|332525062|ref|ZP_08401242.1| flagellar basal body P-ring protein [Rubrivivax benzoatilyticus
           JA2]
 gi|332108351|gb|EGJ09575.1| flagellar basal body P-ring protein [Rubrivivax benzoatilyticus
           JA2]
          Length = 368

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 145/346 (41%), Positives = 212/346 (61%), Gaps = 9/346 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR-LG 83
           R+K+V ++Q  R N L+GYGLVVGL GTGD    +PFT QS+ ++LQ +G++ P G  + 
Sbjct: 25  RLKEVAAVQGVRANALVGYGLVVGLDGTGDQTTQTPFTTQSVTAMLQQMGVTVPAGSSMQ 84

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LP FA PG +ID++++S+G+A SLRGG L+ T L GADGN+YA+AQG+
Sbjct: 85  LKNVAAVMVTAQLPAFAQPGQQIDINVSSIGNAKSLRGGTLIATPLKGADGNVYALAQGN 144

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       S       + G+I  GA VER +P    +   + L L+  DF+TA  +
Sbjct: 145 LIVGGAGASANGSKVQINHLSAGRIPMGATVERTVPTPLLEGDGVQLGLQADDFATARAV 204

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-ARVIIN 261
           AD IN        +  A A D R+V+V  P    +    ++++E LTVE   P ARV++N
Sbjct: 205 ADAINRAK----GQGTAVALDGRSVRVRAPQAPGERIAFLADIENLTVEIAKPAARVVLN 260

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+ D V +    V++GNL+V I+   QV QPN F   G TV    +D+ ++   
Sbjct: 261 ARTGSVVMNDAVTLGACAVAHGNLSVTISTTPQVSQPNPF-GQGQTVESAKSDIAITQQG 319

Query: 322 GSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           GS   + A   L  ++  +NS+G     +++ILQ +K+AGAL +EI
Sbjct: 320 GSLVQLPAGTKLADVVKALNSLGATPMDLLAILQAMKSAGALNAEI 365


>gi|23092319|gb|AAN08644.1| FlgI [Aeromonas hydrophila]
          Length = 365

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 146/371 (39%), Positives = 219/371 (59%), Gaps = 15/371 (4%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R+  L+  L+ L    A   SRIKD +S++  R+NQLIGYGLVVGL GTG++  ++ FT
Sbjct: 4   LRLVTLLCCLMPLGMAHA---SRIKDSISVEGVRNNQLIGYGLVVGLPGTGEN--NNAFT 58

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQ+ R++L N GI  P   +    ++A V + A+LPPF+ PG  IDV+++++G+A SLRG
Sbjct: 59  EQTFRTMLNNFGIKVPDNVKPIINDLAPVAIFADLPPFSKPGQTIDVTVSAIGEAKSLRG 118

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVK-GQSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ + L G DG +YAVAQG++VV GL  +    S  +    T G+I NGA V+RE   
Sbjct: 119 GTLLQSFLKGLDGRVYAVAQGTLVVCGLGAEWADGSKVVVNTPTVGRISNGATVQRECRT 178

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L  PDF+TA R+AD +N           A A D+ +VKV  P +     
Sbjct: 179 PFFHGDTITFNLNRPDFTTARRLADVVNDL----VGPNTAHALDATSVKVYAPRDPGQRV 234

Query: 240 RLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++ +E L V+  +  A++I+N RTGTIVIG  VR+    +S+G LTV I EN+QV QP
Sbjct: 235 SYLATIENLEVDPASEAAKIIVNSRTGTIVIGSQVRLKPAAISHGGLTVTIAENQQVSQP 294

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N  S  G T   NN+ + V   +G  F L     L+ ++  +N +G+    +++IL+ ++
Sbjct: 295 NPLSG-GQTAVTNNSTINVQQEQGRMFKLDTGATLDDMVRAVNQVGVAPGDLMAILEALQ 353

Query: 358 AAGALQSEIII 368
            AGA+  +++I
Sbjct: 354 QAGAIVGQLVI 364


>gi|299531282|ref|ZP_07044692.1| flagellar basal body P-ring protein [Comamonas testosteroni S44]
 gi|298720689|gb|EFI61636.1| flagellar basal body P-ring protein [Comamonas testosteroni S44]
          Length = 382

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 142/371 (38%), Positives = 216/371 (58%), Gaps = 13/371 (3%)

Query: 4   RIAFLIFSLIGLHEISAQV-VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             A L+ + +G   ++     +RIK+V ++Q  R NQL GYGLVVGL GTGD     P+T
Sbjct: 14  HTALLVVAALGASGLTLPAHATRIKEVAAIQGVRSNQLTGYGLVVGLDGTGDQTTQMPYT 73

Query: 63  EQSMRSLLQNLGISTPG----GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           +Q++ + L+ +GI+ P      +L  KNVAAV++TA LP FA PG  ID++++S+G+A S
Sbjct: 74  KQALANYLEQMGIALPATGNAAQLQLKNVAAVIITAELPAFAQPGQAIDINVSSMGNAKS 133

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           L+GG LV T L GADG IYA+AQG+VVV G       S         G++  GA VER +
Sbjct: 134 LKGGTLVATPLRGADGEIYALAQGNVVVGGAGAAAGGSKVQVNHLNAGRVPQGAQVERAV 193

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P        + L L   DF TA ++   IN     R     A A D RTV+V+ P +   
Sbjct: 194 PTPVNQGNTITLGLNQTDFQTADKMVRAIN----QRMGAGTAMALDGRTVQVNAPIDPGS 249

Query: 238 LTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
             R+++E++ + +ET  P A+V+IN RTG+IV+   V +    +++GNL++ I+    + 
Sbjct: 250 RVRMIAEIQEMPIETSKPAAKVVINARTGSIVLNQAVTLGPCAIAHGNLSITISTTPVIS 309

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP  F S G TV    +D++V    G   ++ ++P L  ++  +NS+G     +++ILQ 
Sbjct: 310 QPAPF-SQGQTVVAQKSDIQVKQEPGKVINMPNSPQLTDVVRALNSLGATPQDLLAILQA 368

Query: 356 IKAAGALQSEI 366
           IKAAGA+ +E+
Sbjct: 369 IKAAGAMDAEL 379


>gi|264676574|ref|YP_003276480.1| flagellar P-ring protein [Comamonas testosteroni CNB-2]
 gi|262207086|gb|ACY31184.1| flagellar P-ring protein [Comamonas testosteroni CNB-2]
          Length = 385

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 142/371 (38%), Positives = 216/371 (58%), Gaps = 13/371 (3%)

Query: 4   RIAFLIFSLIGLHEISAQV-VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             A L+ + +G   ++     +RIK+V ++Q  R NQL GYGLVVGL GTGD     P+T
Sbjct: 17  HTALLVVAALGASGLTLPAHATRIKEVAAIQGVRSNQLTGYGLVVGLDGTGDQTTQMPYT 76

Query: 63  EQSMRSLLQNLGISTPG----GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           +Q++ + L+ +GI+ P      +L  KNVAAV++TA LP FA PG  ID++++S+G+A S
Sbjct: 77  KQALANYLEQMGIALPATGNAAQLQLKNVAAVIITAELPAFAQPGQAIDINVSSMGNAKS 136

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           L+GG LV T L GADG IYA+AQG+VVV G       S         G++  GA VER +
Sbjct: 137 LKGGTLVATPLRGADGEIYALAQGNVVVGGAGAAAGGSKVQVNHLNAGRVPQGAQVERAV 196

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P        + L L   DF TA ++   IN     R     A A D RTV+V+ P +   
Sbjct: 197 PTPVNQGNTITLGLNQTDFQTADKMVRAIN----QRMGAGTAMALDGRTVQVNAPIDPGS 252

Query: 238 LTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
             R+++E++ + +ET  P A+V+IN RTG+IV+   V +    +++GNL++ I+    + 
Sbjct: 253 RVRMIAEIQEMPIETSKPAAKVVINARTGSIVLNQAVTLGPCAIAHGNLSITISTTPVIS 312

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP  F S G TV    +D++V    G   ++ ++P L  ++  +NS+G     +++ILQ 
Sbjct: 313 QPAPF-SQGQTVVAQKSDIQVKQEPGKVINMPNSPQLTDVVRALNSLGATPQDLLAILQA 371

Query: 356 IKAAGALQSEI 366
           IKAAGA+ +E+
Sbjct: 372 IKAAGAMDAEL 382


>gi|108812479|ref|YP_648246.1| flagellar basal body P-ring protein [Yersinia pestis Nepal516]
 gi|229902861|ref|ZP_04517978.1| flagellar P-ring protein precursor [Yersinia pestis Nepal516]
 gi|108776127|gb|ABG18646.1| flagellar P-ring protein precursor [Yersinia pestis Nepal516]
 gi|229680308|gb|EEO76407.1| flagellar P-ring protein precursor [Yersinia pestis Nepal516]
 gi|320015463|gb|ADV99034.1| flagellar P-ring protein precursor [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 369

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 219/365 (60%), Gaps = 9/365 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L+  L+ L  + A    RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+ 
Sbjct: 9   LLMVLLSLVWLPASA-ERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSLS 67

Query: 68  SLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+RGG L+M
Sbjct: 68  NMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSIRGGTLLM 127

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L G D  +YA+AQG+V+V G       SS       GG+I NGA +ERELP  F    
Sbjct: 128 TPLKGVDNQVYALAQGNVLVGGAGAAAGGSSVQVNQLAGGRISNGATIERELPTTFGTDG 187

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEV 245
            + LQL + DF+ A +++D IN      F    A A D+RT++V  P       R ++++
Sbjct: 188 IINLQLNSEDFTLAQQVSDAINRQ--RGFGS--ATALDARTIQVLVPRGGSSQVRFLADI 243

Query: 246 EMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           + + +  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP+     
Sbjct: 244 QNIPINVDPGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNIVSQPDTPFGG 303

Query: 305 GSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G TV   NT + V    G    ++A P+LN+++  +NS+G     ++SILQ +++AG L+
Sbjct: 304 GQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMESAGCLR 363

Query: 364 SEIII 368
           +++ I
Sbjct: 364 AKLEI 368


>gi|238788319|ref|ZP_04632113.1| Flagellar P-ring protein [Yersinia frederiksenii ATCC 33641]
 gi|238723565|gb|EEQ15211.1| Flagellar P-ring protein [Yersinia frederiksenii ATCC 33641]
          Length = 373

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 151/371 (40%), Positives = 222/371 (59%), Gaps = 11/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F +  + F  I L  + A    RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PF
Sbjct: 9   LFVVQLIAF--ISLLSLPASA-ERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPF 65

Query: 62  TEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+R
Sbjct: 66  TTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSIR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L G D  +YA+AQG+V+V G       SS      TGG+I NGA +ERELP 
Sbjct: 126 GGTLLMTPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISNGATIERELPT 185

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLT 239
            F     + LQL   DF+ A +++D IN      F    A A D+RT++V  P  +    
Sbjct: 186 TFGTDGVINLQLNTEDFTMAQQVSDAINRQ--RGFGS--ATAIDARTIQVLVPRGSSSQV 241

Query: 240 RLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           R +++++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP
Sbjct: 242 RFLADIQNIPVNVDAGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVSQP 301

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIK 357
           +     G TV   NT + V    G    ++A P+LN+++  +NS+G     ++SILQ ++
Sbjct: 302 DTPFGGGQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQ 361

Query: 358 AAGALQSEIII 368
           +AG L++++ I
Sbjct: 362 SAGCLRAKLEI 372


>gi|77359726|ref|YP_339301.1| flagellar basal body P-ring protein [Pseudoalteromonas haloplanktis
           TAC125]
 gi|115311530|sp|Q3IDW0|FLGI_PSEHT RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|76874637|emb|CAI85858.1| flagellar P-ring protein precursor (Basal body P-ring protein)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 364

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 147/372 (39%), Positives = 217/372 (58%), Gaps = 16/372 (4%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F++ F +  L+G    +  +  RIKDV  ++  R NQL+GYGLVVGL GTG+  R   F
Sbjct: 3   VFKV-FCLMVLLGWQLPA--MAERIKDVSMVEGVRSNQLVGYGLVVGLPGTGEQSR---F 56

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           TEQS + +L + GI+ P   +   KNVAAV V A LPPF  PG  ID++++S+G A SLR
Sbjct: 57  TEQSFKGMLNSFGITLPASLKPKIKNVAAVAVHAELPPFRKPGQTIDITVSSIGSAGSLR 116

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+ T L G DGN+YA+ QGS++V GL  +G   S  +    T G+I NGA VER + 
Sbjct: 117 GGTLLQTFLKGVDGNVYAIGQGSLIVGGLGAEGLDGSKVVINTPTVGRIPNGATVERAVK 176

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F  +  +   L  PDF+TA R+   IN           A+A D+ +++V  P +    
Sbjct: 177 SPFMQNDYITFNLNRPDFTTAKRLEKTINDL----VGPNSAQALDAASIRVIAPRDASQR 232

Query: 239 TRLMSEVEMLT-VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S +E L     DT A++I+N RTGTIVIG NV++    +++G LTV I E   V Q
Sbjct: 233 VSYLSTLENLEFTPADTAAKIIVNSRTGTIVIGKNVKLQPAAITHGGLTVTIAEQLNVSQ 292

Query: 298 PNAFSSNGSTVTQNN-TDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAFS   + VTQ +  D+K  D++ +F       L+ L+  +N +G     +++IL+ +
Sbjct: 293 PNAFSDGDTVVTQQSIIDIKQDDSR-AFVFNPGVSLDDLVRAINEVGAAPGDLMAILEAL 351

Query: 357 KAAGALQSEIII 368
           K AGA+  ++++
Sbjct: 352 KEAGAINGQLVV 363


>gi|22126386|ref|NP_669809.1| flagellar basal body P-ring protein [Yersinia pestis KIM 10]
 gi|45441405|ref|NP_992944.1| flagellar basal body P-ring protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51596015|ref|YP_070206.1| flagellar basal body P-ring protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108807177|ref|YP_651093.1| flagellar basal body P-ring protein [Yersinia pestis Antiqua]
 gi|145598606|ref|YP_001162682.1| flagellar basal body P-ring protein [Yersinia pestis Pestoides F]
 gi|149366247|ref|ZP_01888282.1| flagellar P-ring protein precursor [Yersinia pestis CA88-4125]
 gi|153950706|ref|YP_001401286.1| flagellar basal body P-ring protein [Yersinia pseudotuberculosis IP
           31758]
 gi|162418995|ref|YP_001606476.1| flagellar basal body P-ring protein [Yersinia pestis Angola]
 gi|165925988|ref|ZP_02221820.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165938777|ref|ZP_02227332.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166010921|ref|ZP_02231819.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166210464|ref|ZP_02236499.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401182|ref|ZP_02306685.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420059|ref|ZP_02311812.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425890|ref|ZP_02317643.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167467494|ref|ZP_02332198.1| flagellar P-ring protein FlgI [Yersinia pestis FV-1]
 gi|170024643|ref|YP_001721148.1| flagellar basal body P-ring protein [Yersinia pseudotuberculosis
           YPIII]
 gi|186895118|ref|YP_001872230.1| flagellar basal body P-ring protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218928926|ref|YP_002346801.1| flagellar basal body P-ring protein [Yersinia pestis CO92]
 gi|229896246|ref|ZP_04511416.1| flagellar P-ring protein precursor [Yersinia pestis Pestoides A]
 gi|229897181|ref|ZP_04512337.1| flagellar P-ring protein precursor [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229897908|ref|ZP_04513059.1| flagellar P-ring protein precursor [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|294504026|ref|YP_003568088.1| flagellar P-ring protein precursor [Yersinia pestis Z176003]
 gi|22095706|sp|Q8ZFB1|FLGI2_YERPE RecName: Full=Flagellar P-ring protein 2; AltName: Full=Basal body
           P-ring protein 2; Flags: Precursor
 gi|81639722|sp|Q66BT8|FLGI1_YERPS RecName: Full=Flagellar P-ring protein 1; AltName: Full=Basal body
           P-ring protein 1; Flags: Precursor
 gi|226701966|sp|B1JP09|FLGI_YERPY RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|21959372|gb|AAM86060.1|AE013853_8 homolog of Salmonella P-ring of flagella basal body [Yersinia
           pestis KIM 10]
 gi|45436265|gb|AAS61821.1| flagellar P-ring protein precursor [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51589297|emb|CAH20918.1| flagellar P-ring protein precursor [Yersinia pseudotuberculosis IP
           32953]
 gi|108779090|gb|ABG13148.1| flagellar P-ring protein precursor [Yersinia pestis Antiqua]
 gi|115347537|emb|CAL20446.1| flagellar P-ring protein precursor [Yersinia pestis CO92]
 gi|145210302|gb|ABP39709.1| flagellar P-ring protein precursor [Yersinia pestis Pestoides F]
 gi|149292660|gb|EDM42734.1| flagellar P-ring protein precursor [Yersinia pestis CA88-4125]
 gi|152962201|gb|ABS49662.1| flagellar P-ring protein FlgI [Yersinia pseudotuberculosis IP
           31758]
 gi|162351810|gb|ABX85758.1| flagellar P-ring protein FlgI [Yersinia pestis Angola]
 gi|165913391|gb|EDR32013.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165922192|gb|EDR39369.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165990265|gb|EDR42566.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207644|gb|EDR52124.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961754|gb|EDR57775.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167049571|gb|EDR60979.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055289|gb|EDR65086.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|169751177|gb|ACA68695.1| flagellar P-ring protein [Yersinia pseudotuberculosis YPIII]
 gi|186698144|gb|ACC88773.1| flagellar P-ring protein [Yersinia pseudotuberculosis PB1/+]
 gi|229688949|gb|EEO81014.1| flagellar P-ring protein precursor [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229693518|gb|EEO83567.1| flagellar P-ring protein precursor [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701169|gb|EEO89198.1| flagellar P-ring protein precursor [Yersinia pestis Pestoides A]
 gi|262361788|gb|ACY58509.1| flagellar P-ring protein precursor [Yersinia pestis D106004]
 gi|262366076|gb|ACY62633.1| flagellar P-ring protein precursor [Yersinia pestis D182038]
 gi|294354485|gb|ADE64826.1| flagellar P-ring protein precursor [Yersinia pestis Z176003]
          Length = 369

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 219/365 (60%), Gaps = 9/365 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L+  L+ L  + A    RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+ 
Sbjct: 9   LLMVLLSLVWLPASA-ERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSLS 67

Query: 68  SLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+RGG L+M
Sbjct: 68  NMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSIRGGTLLM 127

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L G D  +YA+AQG+V+V G       SS       GG+I NGA +ERELP  F    
Sbjct: 128 TPLKGVDNQVYALAQGNVLVGGAGAAAGGSSVQVNQLAGGRISNGATIERELPTTFGTDG 187

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEV 245
            + LQL + DF+ A +++D IN      F    A A D+RT++V  P       R ++++
Sbjct: 188 IINLQLNSEDFTLAQQVSDAINRQ--RGFGS--ATAIDARTIQVLVPRGGSSQVRFLADI 243

Query: 246 EMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           + + +  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP+     
Sbjct: 244 QNIPINVDPGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNIVSQPDTPFGG 303

Query: 305 GSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G TV   NT + V    G    ++A P+LN+++  +NS+G     ++SILQ +++AG L+
Sbjct: 304 GQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMESAGCLR 363

Query: 364 SEIII 368
           +++ I
Sbjct: 364 AKLEI 368


>gi|37681981|gb|AAQ97869.1| FlgI [Photorhabdus luminescens]
          Length = 371

 Score =  239 bits (610), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 152/349 (43%), Positives = 220/349 (63%), Gaps = 10/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLG 83
           RI+D+ ++Q  R+N LIGYGLVVGL GTGD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 27  RIRDLTTVQGVRENALIGYGLVVGLDGTGDQTTQTPFTTQSLSNMLSQLGITVPPGTNMQ 86

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LPPF   G  IDV ++SLG+A SLRGG L+MT L G D  +YA+AQG+
Sbjct: 87  LKNVAAVMVTAKLPPFGRAGQNIDVVVSSLGNAKSLRGGTLLMTPLKGVDNQVYALAQGN 146

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       SS       GG+I NGA++ERELP +F ++  L LQL N DFS A +I
Sbjct: 147 ILVGGAGASAGGSSVKVNQLAGGRISNGAVIERELPTQFGENGVLNLQLNNEDFSLAQQI 206

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLMSEVEMLTVETDT-PARVIIN 261
           +D IN       + P+    D+RTV++  P +     + +S V+ LTV  D   A+VI+N
Sbjct: 207 SDTINRTDGTGTATPL----DARTVQLRMPRDKSAQVKFLSHVQNLTVRVDVGDAKVIVN 262

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV-QPNAFSSNGSTVTQNNTDLKVSDN 320
            RTG++V+  NV +    V+ GNL+V I +N+ VV QPN   + GSTV   N  + V + 
Sbjct: 263 SRTGSVVMNRNVMLDSCAVAQGNLSV-IVDNQVVVSQPNTPLAGGSTVVTRNPAVAVREQ 321

Query: 321 KGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G+   ++A   L+ +I  +N++G   + ++SILQ +++AG L++++ I
Sbjct: 322 NGALQQVNASASLSQVIQALNALGATPNDLMSILQAMESAGCLRAKLEI 370


>gi|311280013|ref|YP_003942244.1| flagellar P-ring protein [Enterobacter cloacae SCF1]
 gi|308749208|gb|ADO48960.1| flagellar P-ring protein [Enterobacter cloacae SCF1]
          Length = 365

 Score =  239 bits (610), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 149/348 (42%), Positives = 216/348 (62%), Gaps = 8/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RI+D+ ++Q  R+N LIGYGLVVGL GTGD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 21  RIRDLTTVQGVRENSLIGYGLVVGLDGTGDQTTQTPFTTQSLNNMLSQLGITVPAGTNMQ 80

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LP F   G  IDV ++S+G+A SLRGG L+MT L G D  +YA+AQG+
Sbjct: 81  LKNVAAVMVTAQLPAFGRQGQAIDVVVSSMGNAKSLRGGTLLMTPLKGVDSQVYALAQGN 140

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       SS       GG+I NGA +ERELP +F  +  + LQL + DF  A +I
Sbjct: 141 ILVGGAGAAAGGSSVQVNQLNGGRITNGATIERELPSQFGAANTINLQLNDDDFGMAQQI 200

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVEMLTVE-TDTPARVIIN 261
           AD IN     R S   A A D+RTV++  P+ N    RL+++++ L V  T   A+VIIN
Sbjct: 201 ADTIN----RRSSYGNATALDARTVQIRTPSGNSGQVRLLADIQNLEVNVTPQDAKVIIN 256

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+   V +    V+ GNL+V +    QV QPN   + GSTV    T + +  + 
Sbjct: 257 SRTGSVVMNREVTLDSCAVAQGNLSVTVNRQAQVSQPNTPFAGGSTVVTPQTQIDLRQSG 316

Query: 322 GSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           GS  S+  + +LN+++  +N++G     ++SILQ +++AG L++++ I
Sbjct: 317 GSLQSIRSSANLNNVVRALNTLGATPMDLMSILQSMQSAGCLRAKLEI 364


>gi|37525845|ref|NP_929189.1| flagellar basal body P-ring protein [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|62286850|sp|Q7N5M6|FLGI_PHOLL RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|36785274|emb|CAE14215.1| Flagellar P-ring protein precursor (Basal body P-ring protein)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 369

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 152/349 (43%), Positives = 220/349 (63%), Gaps = 10/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLG 83
           RI+D+ ++Q  R+N LIGYGLVVGL GTGD    +PFT QS+ ++L  LGI+ P G  + 
Sbjct: 25  RIRDLTTVQGVRENALIGYGLVVGLDGTGDQTTQTPFTTQSLSNMLSQLGITVPPGTNMQ 84

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LPPF   G  IDV ++SLG+A SLRGG L+MT L G D  +YA+AQG+
Sbjct: 85  LKNVAAVMVTAKLPPFGRAGQNIDVVVSSLGNAKSLRGGTLLMTPLKGVDNQVYALAQGN 144

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       SS       GG+I NGA++ERELP +F ++  L LQL N DFS A +I
Sbjct: 145 ILVGGAGASAGGSSVKVNQLAGGRISNGAVIERELPTQFGENGVLNLQLNNEDFSLAQQI 204

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLMSEVEMLTVETDT-PARVIIN 261
           +D IN       + P+    D+RTV++  P +     + +S V+ LTV  D   A+VI+N
Sbjct: 205 SDTINRTDGTGTATPL----DARTVQLRMPRDKSAQVKFLSHVQNLTVRVDVGDAKVIVN 260

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV-QPNAFSSNGSTVTQNNTDLKVSDN 320
            RTG++V+  NV +    V+ GNL+V I +N+ VV QPN   + GSTV   N  + V + 
Sbjct: 261 SRTGSVVMNRNVMLDSCAVAQGNLSV-IVDNQVVVSQPNTPLAGGSTVVTRNPAVAVREQ 319

Query: 321 KGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G+   ++A   L+ +I  +N++G   + ++SILQ +++AG L++++ I
Sbjct: 320 NGALQQVNASASLSQVIQALNALGATPNDLMSILQAMESAGCLRAKLEI 368


>gi|224825168|ref|ZP_03698274.1| flagellar P-ring protein [Lutiella nitroferrum 2002]
 gi|224602839|gb|EEG09016.1| flagellar P-ring protein [Lutiella nitroferrum 2002]
          Length = 366

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 159/370 (42%), Positives = 216/370 (58%), Gaps = 16/370 (4%)

Query: 7   FLIFSLIGLHEIS-AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           FL   LIG+  +S A    R+KD+ S+   R NQLIGYGLVVGL G+GD   SSPFT QS
Sbjct: 4   FLGMLLIGVLAMSPALATQRLKDIASIGGVRTNQLIGYGLVVGLDGSGDKATSSPFTSQS 63

Query: 66  MRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           M S+L  LG+  P G +L  KNVAAV VT  LPPFA  G  IDV+++S+GDA SLRGG L
Sbjct: 64  MSSMLNQLGVQIPVGTKLDPKNVAAVTVTGTLPPFARQGQAIDVTVSSIGDAKSLRGGTL 123

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           +M+ L GADG IYA+AQG+VVV G       SS      + G+I  GA VERE+P     
Sbjct: 124 LMSPLKGADGQIYAMAQGNVVVGGAGASAAGSSAQVNHLSVGRIPAGATVEREVPTALGS 183

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMS 243
              + L+L   DF+TA R+   IN          +A A D R V+V  P + +   + +S
Sbjct: 184 GGVVQLELFESDFTTANRVVQAIN----RELGDGVARALDGRLVEVVAPQDANRRVQFLS 239

Query: 244 EVEMLTVETDTPAR----VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +E + V   TPA     VI+N RTG++V+  +V I    V++GNL+V ++   QV QP 
Sbjct: 240 RMENIAV---TPAEASPLVILNARTGSVVMNQSVTIDPCAVAHGNLSVSVSNTPQVSQPA 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
              S G TV  N   + V    G    L    +L+ +++ +N++G     ++SILQ +KA
Sbjct: 297 PL-SGGQTVVTNQASVNVKSEGGKVIGLPRGANLSQVVNALNALGATPQDLLSILQAMKA 355

Query: 359 AGALQSEIII 368
           AGAL++E+ I
Sbjct: 356 AGALKAELQI 365


>gi|330818581|ref|YP_004362286.1| flagellar P-ring protein FlgI [Burkholderia gladioli BSR3]
 gi|327370974|gb|AEA62330.1| flagellar P-ring protein FlgI [Burkholderia gladioli BSR3]
          Length = 393

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 151/358 (42%), Positives = 212/358 (59%), Gaps = 19/358 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---- 80
           R+KD+  LQ  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G    
Sbjct: 40  RLKDLAQLQGVRDNPLIGYGLVVGLDGTGDQTTQTPFTTQTLANMLANLGISINNGTSTG 99

Query: 81  ------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
                  L  KNVAAVMVT+ LPPFA PG  IDV+++SLG+A SLRGG L++T L GADG
Sbjct: 100 GTASLSNLQLKNVAAVMVTSTLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGADG 159

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD-SADLILQLR 193
            +YA+AQG++ V G       S         G+I  GAIVER +P      +  L LQL 
Sbjct: 160 QVYALAQGNMAVGGAGASANGSRVQVNQLAAGRITGGAIVERSVPNALAQMNGTLQLQLN 219

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET 252
           + D+ TA RI   +NS     F   +A A D RT++++ P +       M+ ++ L V  
Sbjct: 220 DMDYGTAERIVTAVNSS----FGPGVATALDGRTIQLTAPADPAQQVAFMARLQNLEVNP 275

Query: 253 D-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
           D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP AF SNG TV   
Sbjct: 276 DRAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGAF-SNGQTVVAQ 334

Query: 312 NTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + +++  + G+  L+ A  +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 335 QSQIQLKQDNGAMRLVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 392


>gi|315125988|ref|YP_004067991.1| FlgIL [Pseudoalteromonas sp. SM9913]
 gi|315014502|gb|ADT67840.1| FlgIL [Pseudoalteromonas sp. SM9913]
          Length = 369

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 144/374 (38%), Positives = 230/374 (61%), Gaps = 16/374 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++  + F  FSL+    ++A+    + D+V +   R+NQL+GYGLVVGL G+GD  +   
Sbjct: 5   LLMLVCF--FSLLAPATVAAKA-RPLLDIVDVLGVRENQLVGYGLVVGLPGSGDKAQVK- 60

Query: 61  FTEQSMRSLLQNLGISTPGGRL-GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           F  QS+ ++L+  G+S    RL  SKN+AAV V A LPP  SPG  IDV++NSLGDA SL
Sbjct: 61  FAGQSLSNMLKQFGVSVDEERLPKSKNIAAVAVHATLPPMGSPGQAIDVTVNSLGDAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVEREL 178
            GG L++T L G DG +YA+AQG++VV G+   G+S SS    + T G I NGAI+ER +
Sbjct: 121 HGGSLMLTPLKGVDGKVYALAQGNLVVGGINASGKSGSSVTVNVPTSGLIPNGAIIERSV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID- 237
              ++  +D+IL L++P++ TA  +   IN      F   +A A +   + VS P++ + 
Sbjct: 181 TAMYESQSDVILNLKDPNYQTARNVVRAINKV----FGPDVATAENWARLVVSAPSDANS 236

Query: 238 LTRLMSEVEMLTVE--TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
               MS ++ ++VE  ++ P +++ N RTGT+V+ D VR+++  V++GNLT+ I+E EQV
Sbjct: 237 RNTFMSMLQDISVEQGSERP-KIVFNSRTGTVVMNDTVRVNQAAVNHGNLTITISEQEQV 295

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQ 354
            QP  F SNG T    ++D+ V   + +  L  +   L+ ++  +N++G     ++SIL 
Sbjct: 296 SQPGPF-SNGQTTATQSSDITVDQQQRNMLLWPEGTSLDEIVKAVNALGATPAELMSILI 354

Query: 355 GIKAAGALQSEIII 368
            +  AGAL++E+++
Sbjct: 355 ALDNAGALEAELLV 368


>gi|319790431|ref|YP_004152064.1| flagellar P-ring protein [Thermovibrio ammonificans HB-1]
 gi|317114933|gb|ADU97423.1| flagellar P-ring protein [Thermovibrio ammonificans HB-1]
          Length = 363

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 138/346 (39%), Positives = 201/346 (58%), Gaps = 8/346 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           +I  +V+++  R N L GYG+VVGL G+GD   +S FT QS+ ++L+ +GI      + +
Sbjct: 23  KISTLVNVEGVRPNYLTGYGIVVGLNGSGDG-TTSVFTLQSIANMLRKMGIYVDPKAVKT 81

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KN AAV+VTA LPPFA PG   DV + SLGDA S+  G+L+ T LLG DG +YA AQG V
Sbjct: 82  KNAAAVIVTAKLPPFAKPGMTFDVEVASLGDAKSIANGVLIRTPLLGPDGKVYAFAQGPV 141

Query: 145 VVSGLFVK-GQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
              G F +  +     +   T G I NG IVER LP +      L+L L  P+F+ A  I
Sbjct: 142 STGGGFSESNKGGKVQKNFPTAGIIPNGGIVERPLPFELSQMKQLVLTLNQPNFTLASEI 201

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
           A  IN +    F +P+A A DS TVKV  P  ++  + +SEV  L V T     ++I E+
Sbjct: 202 AQVINEH----FGKPLARAVDSATVKVDYPAGVNKVKFISEVLNLEVNTVPEPTIVIYEK 257

Query: 264 TGTIVIGDNVRI-SKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           TGT+++  +++I   V VS+GN+ V +T+   + QP   S   + VTQ      V +  G
Sbjct: 258 TGTVIMSGDIKIDPPVYVSHGNIYVSVTKTPVISQPPPLSGGKTVVTQ-QVKTTVKEENG 316

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
               I++P L  L+  +N +G+    +I+ILQ +KAAG L ++I+I
Sbjct: 317 RIFGINSPSLRDLVKALNQLGVSPRDLIAILQAMKAAGKLHAKIVI 362


>gi|270486641|ref|ZP_06203715.1| flagellar P-ring protein FlgI [Yersinia pestis KIM D27]
 gi|270335145|gb|EFA45922.1| flagellar P-ring protein FlgI [Yersinia pestis KIM D27]
          Length = 359

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 149/366 (40%), Positives = 221/366 (60%), Gaps = 12/366 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            ++ SL+ L   SA+   RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+
Sbjct: 1   MVLLSLVWLPA-SAE---RIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSL 56

Query: 67  RSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+RGG L+
Sbjct: 57  SNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSIRGGTLL 116

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MT L G D  +YA+AQG+V+V G       SS       GG+I NGA +ERELP  F   
Sbjct: 117 MTPLKGVDNQVYALAQGNVLVGGAGAAAGGSSVQVNQLAGGRISNGATIERELPTTFGTD 176

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSE 244
             + LQL + DF+ A +++D IN      F    A A D+RT++V  P       R +++
Sbjct: 177 GIINLQLNSEDFTLAQQVSDAINRQ--RGFGS--ATAIDARTIQVLVPRGGSSQVRFLAD 232

Query: 245 VEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           ++ + +  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP+    
Sbjct: 233 IQNIPINVDPGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNIVSQPDTPFG 292

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G TV   NT + V    G    ++A P+LN+++  +NS+G     ++SILQ +++AG L
Sbjct: 293 GGQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMESAGCL 352

Query: 363 QSEIII 368
           ++++ I
Sbjct: 353 RAKLEI 358


>gi|241765795|ref|ZP_04763736.1| flagellar P-ring protein [Acidovorax delafieldii 2AN]
 gi|241364306|gb|EER59456.1| flagellar P-ring protein [Acidovorax delafieldii 2AN]
          Length = 383

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 146/347 (42%), Positives = 203/347 (58%), Gaps = 10/347 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIK+V ++Q  R NQL GYGLVVGL GTGD     PFT Q+M + LQ +GIS P G    
Sbjct: 39  RIKEVAAVQGVRSNQLSGYGLVVGLDGTGDQSTQMPFTAQAMANYLQQMGISLPPGTAAP 98

Query: 85  --KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVA V+VTA LP FA PG  IDV+++S+G+A SLRGG L+ T L GADG IYA+AQG
Sbjct: 99  QLKNVATVVVTAQLPAFAQPGQMIDVAVSSMGNAKSLRGGTLIATPLRGADGEIYALAQG 158

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VVV G       S         G+I  GA VER +P    D   + L L   DF TA +
Sbjct: 159 NVVVGGAGASAGGSKVQINHLNAGRIPEGAQVERSVPTPLHDGDTITLGLNAMDFQTARK 218

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVETDTP-ARVII 260
           +A  IN+    R  +  A A D RTV+V+ P +       ++E+E L +   TP A+V+I
Sbjct: 219 VAQAINA----RQGQGTATALDGRTVQVAAPQDPGRRVNFIAELEELQLPDSTPAAKVVI 274

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG+IV+   V +    +++GNL++ I+    + QPN   S G TV    +D+ +   
Sbjct: 275 NARTGSIVLNQAVTLGPCAIAHGNLSITISSTPIISQPNPL-SRGVTVVAQKSDIAIQQE 333

Query: 321 KGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            G+   +  +P L  ++  +N++G     +++ILQ IKAAGAL +E+
Sbjct: 334 AGNVIQMPPSPQLADVVRALNTLGATPQDLLAILQAIKAAGALNAEL 380


>gi|218887607|ref|YP_002436928.1| flagellar basal body P-ring protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758561|gb|ACL09460.1| flagellar P-ring protein [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 374

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 142/344 (41%), Positives = 222/344 (64%), Gaps = 8/344 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+ S    RDNQL+GYGLVVGL GTGD  + S FT  SM ++L+ +G++    ++  
Sbjct: 34  RIKDIASFGGVRDNQLVGYGLVVGLGGTGDK-KDSTFTMSSMVNMLERMGVAVDPAKMKP 92

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAVMVT  +P  A PG+R+DV+++S+GDA+SL+GG+L++T L G DG +Y++AQG +
Sbjct: 93  KNVAAVMVTTRMPVSAKPGTRLDVTVSSMGDATSLQGGVLLITPLKGVDGKVYSLAQGPL 152

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
            + G  V+GQ++   + ++T G I  GAIVER +P +F     L L + + DFST +++ 
Sbjct: 153 ALGGFSVEGQAARAQKNVTTVGTIPGGAIVERGIPFQFNSQDTLTLHMSSADFSTTMQVV 212

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIINE 262
           +++N      +    A+A D+ TV +  P     +L  LM+ +E + V  D+PA+V+++E
Sbjct: 213 ERLNRVMGGSY----AKAQDASTVALDVPPAYRGNLVPLMASIENIEVTPDSPAKVVVDE 268

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           +TGT+V+G +VRIS+V V++G+L V + E   V QP  F S G TV    TD+ V +   
Sbjct: 269 KTGTVVLGRDVRISRVAVAHGSLQVTVQEGMDVSQPGPF-SQGQTVATPRTDINVREENR 327

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
              L++   L  L+ G+N+IG     ++SIL+ +K AGAL +++
Sbjct: 328 RLMLMEGATLQELVDGLNAIGATPRDLVSILRAMKTAGALHADL 371


>gi|119469954|ref|ZP_01612759.1| flagellar P-ring protein precursor I [Alteromonadales bacterium
           TW-7]
 gi|119446664|gb|EAW27937.1| flagellar P-ring protein precursor I [Alteromonadales bacterium
           TW-7]
          Length = 364

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 211/365 (57%), Gaps = 13/365 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
            + +LIG  + SA    RIKD+  ++  R NQL+GYGLVVGL GTG+  R   FT+QS +
Sbjct: 8   CLITLIGC-QFSAHA-ERIKDISMVEGVRSNQLVGYGLVVGLPGTGEQSR---FTQQSFK 62

Query: 68  SLLQNLGISTPGGRLGS-KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
            +L N GIS P       KNVAAV V A LP F  PG  ID++++S+G A SLRGG L+ 
Sbjct: 63  GMLSNFGISLPANLSPKIKNVAAVAVHAELPAFRKPGQTIDITVSSIGSAGSLRGGTLLQ 122

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSS-FMEGISTGGKIVNGAIVERELPKKFKDS 185
           T L GADGN+YAVAQGS++V GL  +G   S  +    T G+I NGA VERE+   F   
Sbjct: 123 TFLKGADGNVYAVAQGSLIVGGLGAQGADGSRVVINTPTVGRIPNGATVEREVKSPFMQG 182

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSE 244
             +   L  PDF+TA R+   IN           A+A DS +V+V  P +       +S 
Sbjct: 183 DFITFNLNRPDFTTAKRLEKTINDL----VGPNSAKAIDSVSVRVIAPRDASQRVSYLST 238

Query: 245 VEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           +E L  +  D  A++I+N RTGTIVIG NV++    +++G LTV I+E + V QPNA + 
Sbjct: 239 LENLEFKPADMSAKIIVNSRTGTIVIGKNVKLQPAAITHGGLTVTISEQQNVAQPNALAE 298

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
             + VTQ +      D+  +F       L+ L+  +N +G     +++IL+ +K AGA+ 
Sbjct: 299 GETVVTQQSIIDVNEDDSRAFVFNPGVSLDDLVRAINEVGAAPGDLMAILEALKEAGAIN 358

Query: 364 SEIII 368
            ++++
Sbjct: 359 GQLVV 363


>gi|225871947|ref|YP_002753401.1| flagellar P-ring protein FlgI [Acidobacterium capsulatum ATCC
           51196]
 gi|225793165|gb|ACO33255.1| flagellar P-ring protein FlgI [Acidobacterium capsulatum ATCC
           51196]
          Length = 381

 Score =  238 bits (606), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 141/352 (40%), Positives = 210/352 (59%), Gaps = 11/352 (3%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
           ++R+KDV S++  RDNQLIGYG+VVGL  TGDS ++  F  Q++ S LQ +G++  G  L
Sbjct: 36  LARVKDVSSVEGIRDNQLIGYGIVVGLHNTGDSSQTV-FPVQTLLSTLQRMGVNLQGNSL 94

Query: 83  GS----KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
            S    +N+AAV + A LPPFA PG+++DV+++S GDA SL GG+L+M+ L G DG IYA
Sbjct: 95  ASTMQVRNMAAVFIAATLPPFAEPGTKLDVTVSSAGDARSLEGGLLLMSPLYGPDGRIYA 154

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
            AQG +V+ G  V+   +S      T G + +GA+VER +P    D   L L L N DF 
Sbjct: 155 QAQGPLVLGGYSVQANGNSKSVNDPTTGIVPDGAMVERAVPVDLADLRPLTLLLDNADFR 214

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARV 258
           TA ++AD IN    +   + +A A D R V ++     D+  L++ V+ + V+    A V
Sbjct: 215 TAEQMADAIN----HSLGKKVATAVDGRRVTLTTAPGEDIAALLARVQAVEVQVYPKAIV 270

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++NERTGT+VIG  VR+  V + +G LTV +  + +V QP   SS G+T     T +   
Sbjct: 271 VVNERTGTVVIGGQVRLQPVTILHGGLTVTVQSHLEVSQPGPLSS-GTTQVVRQTTINAQ 329

Query: 319 DNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           D   +   L +   +  L++ +  IG     IISILQ +K A AL++++ +Q
Sbjct: 330 DKPANQIVLKNGATVQDLVASLQQIGATARDIISILQAMKQAQALEADLEVQ 381


>gi|327478813|gb|AEA82123.1| flagellar basal body P-ring protein [Pseudomonas stutzeri DSM 4166]
          Length = 365

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 153/373 (41%), Positives = 222/373 (59%), Gaps = 16/373 (4%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R+   + ++    ++ AQ V  + D+V ++  R NQLIGYGLVVGL GTGD  +   FT
Sbjct: 1   MRVKLFLAAVALCWQLPAQAVP-LMDLVDIEGIRGNQLIGYGLVVGLDGTGDKNQVK-FT 58

Query: 63  EQSMRSLLQNLGISTPGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
             S+ ++++  GI+ P     +L  KNVAAV VTA +PP  SPG  +DV+++SLGDA SL
Sbjct: 59  SHSVANMIKQFGINLPPNVDPKL--KNVAAVTVTATVPPSYSPGQSVDVTVSSLGDAKSL 116

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVEREL 178
           RGG L+MT L G DG +YAVAQG++VV G+  +G S S +    S  G I NGA VER +
Sbjct: 117 RGGQLLMTPLQGVDGEVYAVAQGALVVGGVNAEGASGSKVAINTSNSGLIPNGATVERMI 176

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNID 237
           P  F +  +++L +R P F T  R+ D I+ Y    F +  A A ++  V +  P T+  
Sbjct: 177 PTDFTERPEVMLNVRQPSFQTVTRVVDAIDGY----FGKGTATALNATKVSIRAPVTSTQ 232

Query: 238 LTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               M+ +E L VE      +V+ N RTGT+V+G+ VR+    V++G+LTV I+E  QV 
Sbjct: 233 RMSFMAMLERLDVEEGRVRPKVVFNSRTGTVVVGEGVRVKAAAVAHGSLTVTISERPQVS 292

Query: 297 QPNAFSSNGSTVTQNNTDLKVS-DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP  F S G T     +D+ V  D K  F   +   L S+I+ +NS+G   D ++SILQ 
Sbjct: 293 QPGPF-SQGQTAVVPQSDVSVEQDRKAMFKWPEGASLESIINTINSLGATPDDVMSILQS 351

Query: 356 IKAAGALQSEIII 368
           ++ AGAL +E+I+
Sbjct: 352 LERAGALNAELIV 364


>gi|37360910|dbj|BAC98364.1| flagellar P-ring protein [Burkholderia glumae]
          Length = 395

 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 155/376 (41%), Positives = 221/376 (58%), Gaps = 21/376 (5%)

Query: 8   LIFSL-IGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           L F+L   L   SA+   R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++
Sbjct: 25  LAFALGCALPAASARA-ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTTQTPFTTQTL 83

Query: 67  RSLLQNLGISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDA 116
            ++L NLGIS   G           L  KNVAAVMVTA LPPFA PG  IDV+++SLG+A
Sbjct: 84  ANMLANLGISINNGTSTGGTASLSNLQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNA 143

Query: 117 SSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVER 176
            SLRGG L++T L GADG +YA+AQG++ V G       S         G+I  GAIVER
Sbjct: 144 KSLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRITGGAIVER 203

Query: 177 ELPKKFKD-SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN 235
            +P      +  L+LQL + D+ TA RI   +NS         IA A D RT++++ P++
Sbjct: 204 SVPNALAQMNGVLLLQLNDMDYGTAERIVTAVNS----NLGPGIATALDGRTIQLTAPSD 259

Query: 236 -IDLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENE 293
                  M+ ++ L V  +   A+VI+N RTG+IV+   V +    V++GNL+V +    
Sbjct: 260 PAQQVAFMARLQNLDVNPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQP 319

Query: 294 QVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISI 352
            V QP AF SNG TV    + +++  + G+   ++A  +L  ++  +NS+G     ++SI
Sbjct: 320 VVSQPGAF-SNGQTVVAQQSQIQLKQDNGALRYVNAGANLADVVKALNSLGATPADLMSI 378

Query: 353 LQGIKAAGALQSEIII 368
           LQ +KAAGAL++++ I
Sbjct: 379 LQAMKAAGALRADLEI 394


>gi|327398481|ref|YP_004339350.1| Flagellar P-ring protein [Hippea maritima DSM 10411]
 gi|327181110|gb|AEA33291.1| Flagellar P-ring protein [Hippea maritima DSM 10411]
          Length = 368

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 142/349 (40%), Positives = 209/349 (59%), Gaps = 13/349 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           +I+D+ S+   R NQL+GYG+VVGL GTGD   SS FT QS+ + L+  G++     +GS
Sbjct: 23  KIRDLTSVVGVRYNQLVGYGIVVGLAGTGDG-TSSKFTIQSIVNALKRFGVTLSQSEIGS 81

Query: 85  ---KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
              KN+AAVMVTA LPPFA  G RIDV+++S+GDA SL+GG L+MT L G DGN+YAVAQ
Sbjct: 82  LQTKNIAAVMVTAQLPPFAKQGERIDVTVSSIGDAKSLQGGTLIMTPLKGPDGNVYAVAQ 141

Query: 142 GSV-VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           G + +       G  +   +   T G+I NGAIVE ++          IL L  P F  A
Sbjct: 142 GPISIGGYNAGMGGGTKVRKNHPTVGRIPNGAIVENQVNVDINSKQSFILALNQPSFEMA 201

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTPARV 258
            RIA+ IN +    + R +A   D  ++KV  P      +  L+S++  L+V+  T  RV
Sbjct: 202 TRIANTINKF----YRRQMAFPSDGGSIKVIVPPLYRGAVVELISQINQLSVDQITEPRV 257

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           +++E+TGT+V+G +V I  + +S+GNLT+ +T  ++V QPN   + G T T  N  + V+
Sbjct: 258 VLDEKTGTVVVGGDVTIEPISISHGNLTITVTSTKEVSQPNPL-AKGKTTTVTNKQVSVN 316

Query: 319 DNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           + KG F +      ++ LI  +N  G     +++I Q IKAAGAL +++
Sbjct: 317 EGKGKFLTFSKGATVSELIQALNKAGATPRDMMAIFQAIKAAGALNAKL 365


>gi|54307273|ref|YP_128293.1| flagellar basal body P-ring protein [Photobacterium profundum SS9]
 gi|81615817|sp|Q6LW60|FLGI1_PHOPR RecName: Full=Flagellar P-ring protein 1; AltName: Full=Basal body
           P-ring protein 1; Flags: Precursor
 gi|46911693|emb|CAG18491.1| Hypothetical flagellar P-ring protein [Photobacterium profundum
           SS9]
          Length = 374

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 143/350 (40%), Positives = 209/350 (59%), Gaps = 18/350 (5%)

Query: 29  VVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---RLGSK 85
           VV +Q  R+NQL+GYGLVVGL GTGD  ++  FT QS++++L   G+  P     +L  K
Sbjct: 32  VVDIQGIRENQLVGYGLVVGLSGTGDKSQTK-FTSQSVKNMLSQFGVQLPANVNPKL--K 88

Query: 86  NVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVV 145
           NVAAV V A LP  AS G  +D++++S+GDA SLRGG L++T L GADG IYA+AQG++V
Sbjct: 89  NVAAVAVNATLPALASKGQSLDITVSSIGDAKSLRGGTLLLTPLKGADGQIYAIAQGNLV 148

Query: 146 VSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           V G+  +G S S +   I T G I NG I+ERE+   F  ++ ++L L+ P F+TA  I 
Sbjct: 149 VGGVVAQGNSGSGITINIPTAGLIPNGGIIEREVTSSFLTASTVVLNLKKPGFNTARNIE 208

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDT-PARVIINE 262
            +IN      F   +A A     + V  P +       ++ +E L +ET   PARV+ N 
Sbjct: 209 KEINEL----FGPDVALAQSHARIHVRAPHDPSQRVTFLAMLENLDIETGPRPARVVFNA 264

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGTIV+G NV++    VS+GNLTV + E+  V QPNAF   G+T     TD+ +   +G
Sbjct: 265 RTGTIVVGKNVKVHTAAVSHGNLTVSVMESFNVSQPNAF-GRGNTAVTPETDVSIDQERG 323

Query: 323 SFSLIDAPD----LNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              +    D    L +++  +NS+G   + +++IL  +  AGAL  E+++
Sbjct: 324 KVFIWPDSDEGTSLQTIVDAVNSLGATPNDLMAILIALDEAGALDGELVV 373


>gi|153843711|ref|ZP_01993584.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ3810]
 gi|149745299|gb|EDM56550.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ3810]
          Length = 297

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 139/303 (45%), Positives = 192/303 (63%), Gaps = 13/303 (4%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           RI  L+ S + L   +AQ  +RIKDV  +   R NQL+GYGLV GL GTG++   +PFTE
Sbjct: 3   RIVLLLMS-VALFSTAAQA-ARIKDVAQVAGVRSNQLVGYGLVSGLPGTGEA---NPFTE 57

Query: 64  QSMRSLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS  ++LQN GI   PG +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRGG
Sbjct: 58  QSFAAMLQNFGIQLPPGTKPKIKNVAAVMVTAELPPFSKPGQQVDVTVSSIGSAKSLRGG 117

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS-TGGKIVNGAIVERELPKK 181
            L+ T L G DG +YAVAQG++VVSG   +G   S + G + T G I +GA VERE+P  
Sbjct: 118 TLLQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPNP 177

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F     +   L   DF+TA R+AD +N++        +A A D+ +V+V  P ++     
Sbjct: 178 FGRGDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDVSQRVA 233

Query: 241 LMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +S +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN
Sbjct: 234 FLSAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPN 293

Query: 300 AFS 302
           +FS
Sbjct: 294 SFS 296


>gi|269792754|ref|YP_003317658.1| flagellar P-ring protein [Thermanaerovibrio acidaminovorans DSM
           6589]
 gi|269100389|gb|ACZ19376.1| flagellar P-ring protein [Thermanaerovibrio acidaminovorans DSM
           6589]
          Length = 365

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 142/349 (40%), Positives = 203/349 (58%), Gaps = 16/349 (4%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ---NLGISTPGGR 81
           RIKD+V ++  R NQL+G GLVVGL GTGD        + +MR L     N G++     
Sbjct: 29  RIKDLVDVEGARANQLVGMGLVVGLAGTGDK------GDMAMRMLSNMALNFGVNVDPKA 82

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
           + SKNVA V VT  LPPF SPG  +DV +++LGDA SL+GG+L+ T L  A+G +YAVAQ
Sbjct: 83  VKSKNVAVVSVTCELPPFVSPGQTLDVQVSALGDAKSLQGGMLLQTPLRAANGRVYAVAQ 142

Query: 142 GSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           G + + G    GQ +  +    T  +I  GAIVE+ +         L L LR PDF+TA 
Sbjct: 143 GPLSIGGFSAGGQGAQTVRNFQTVARIPGGAIVEQGVDSTLGGGGALALLLRRPDFTTAT 202

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIIN 261
           RIA+ I     NR    +A A D+  V+VS P  + +T  ++ +E L V  D  ARV++N
Sbjct: 203 RIAEAI-----NRKYGGVARAVDAGRVEVSAPGGVGVTSFLASIEGLRVTPDALARVVVN 257

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           ERTGT+V+G  V++S   VS+GNLTV+++E  +  QPN   + G T     TD+   +  
Sbjct: 258 ERTGTVVMGGEVKLSTAAVSHGNLTVKVSERPEASQPNPL-AGGRTQVLPRTDVSAQEGG 316

Query: 322 GSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           G   L+ ++  +  L+  +N +G     +I ILQ +  AGALQ +++IQ
Sbjct: 317 GQVVLLPESSSVADLVKALNGVGASPRDLIPILQALDQAGALQGQLVIQ 365


>gi|146277704|ref|YP_001167863.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555945|gb|ABP70558.1| flagellar P-ring protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 371

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 140/356 (39%), Positives = 223/356 (62%), Gaps = 18/356 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KD+ S+   R N L+GYG+VVGL GTGD   +S  T+QSM+SL+  LG+S   G L +
Sbjct: 21  RLKDLTSVAGVRANPLVGYGVVVGLSGTGDG--NSQLTQQSMQSLISRLGLSVETGDLKA 78

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KN AAVMVTA+LPPF   G  +DV+++++G A SL+GG L+MT L+GADG +YA+AQG++
Sbjct: 79  KNAAAVMVTADLPPFLKIGQTLDVTVSTVGQAKSLKGGTLLMTPLMGADGEVYAIAQGNL 138

Query: 145 VVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           VV GL V+G+  SS    I T G++  G +VER +   F ++  LIL L   DFSTA  +
Sbjct: 139 VVGGLGVEGRDGSSLTVNIPTVGRVPRGGMVERMVETPFLETDHLILNLNRGDFSTAAAV 198

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVETDTP-ARVIIN 261
           A+ +N      F   +A A D  +++V  P +       MS +E + ++   P A+V++N
Sbjct: 199 AEGVN----RTFGPDVAVALDGTSIRVRAPADPAQRVTFMSLLENVEIDPAPPVAKVVVN 254

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP-------NA-FSSNGSTVTQNNT 313
            RTGT+VIG  V+++   V++G+LTV++TE+++V Q        NA   + G  V   ++
Sbjct: 255 ARTGTVVIGGTVKVTPAAVTHGSLTVRVTEDQRVSQGASVVVGNNATVVAPGEPVITPDS 314

Query: 314 DLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + V++    +F       L+SL+  +N++G     +++IL+ ++ AGAL++E+++
Sbjct: 315 GIDVTEEPARAFVFDPGVSLSSLVDAINAVGASPSDLVAILEALREAGALRAELVV 370


>gi|73539454|ref|YP_299821.1| flagellar basal body P-ring protein [Ralstonia eutropha JMP134]
 gi|72122791|gb|AAZ64977.1| Flagellar P-ring protein [Ralstonia eutropha JMP134]
          Length = 392

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 140/348 (40%), Positives = 206/348 (59%), Gaps = 9/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR-LG 83
           R+K++ + Q  RDN L+GYGLVVGL  TGD    +PFT QS+ ++L  LGI+ P G+ + 
Sbjct: 49  RLKNLATFQGVRDNPLVGYGLVVGLDNTGDQTMQTPFTTQSLTNMLSQLGITLPAGKNMQ 108

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LP FA PGS++D+ ++S+G+A SLRGG L+MT L GADG +YA+AQG+
Sbjct: 109 LKNVAAVMVTATLPAFAQPGSQLDIVVSSMGNAKSLRGGTLLMTPLKGADGQVYAIAQGN 168

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       S         G+I NGAIVER +     D   L L+L++ DF TA R+
Sbjct: 169 MLVGGAGASANGSKVQVNQLAVGRIANGAIVERAVAAFQPDGGVLNLELKDTDFGTAERV 228

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLMSEVEMLTV-ETDTPARVIIN 261
            + IN          +A A D R V+V  P +       ++ +E L V      A+VI+N
Sbjct: 229 VEAIN----RSMGGGVAAALDGRVVQVRAPQSPSARVGFLARIENLDVTPAKAAAKVILN 284

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG+IV+   V +    V++GNL+V I     + QP  F S G TV    + + +    
Sbjct: 285 ARTGSIVMNQAVTVEDCAVAHGNLSVVINTQPVISQPAPF-SGGQTVVAPVSQIDMKQQG 343

Query: 322 GSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           GS  ++ A   L +++ G+N++G     + +IL+ ++AAGAL++E+ I
Sbjct: 344 GSLQIVKAGASLAAVVKGLNALGATPADLQTILEAMRAAGALRAELEI 391


>gi|124021068|sp|Q46PF7|FLGI_RALEJ RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 377

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 140/348 (40%), Positives = 206/348 (59%), Gaps = 9/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR-LG 83
           R+K++ + Q  RDN L+GYGLVVGL  TGD    +PFT QS+ ++L  LGI+ P G+ + 
Sbjct: 34  RLKNLATFQGVRDNPLVGYGLVVGLDNTGDQTMQTPFTTQSLTNMLSQLGITLPAGKNMQ 93

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LP FA PGS++D+ ++S+G+A SLRGG L+MT L GADG +YA+AQG+
Sbjct: 94  LKNVAAVMVTATLPAFAQPGSQLDIVVSSMGNAKSLRGGTLLMTPLKGADGQVYAIAQGN 153

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       S         G+I NGAIVER +     D   L L+L++ DF TA R+
Sbjct: 154 MLVGGAGASANGSKVQVNQLAVGRIANGAIVERAVAAFQPDGGVLNLELKDTDFGTAERV 213

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLMSEVEMLTV-ETDTPARVIIN 261
            + IN          +A A D R V+V  P +       ++ +E L V      A+VI+N
Sbjct: 214 VEAIN----RSMGGGVAAALDGRVVQVRAPQSPSARVGFLARIENLDVTPAKAAAKVILN 269

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG+IV+   V +    V++GNL+V I     + QP  F S G TV    + + +    
Sbjct: 270 ARTGSIVMNQAVTVEDCAVAHGNLSVVINTQPVISQPAPF-SGGQTVVAPVSQIDMKQQG 328

Query: 322 GSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           GS  ++ A   L +++ G+N++G     + +IL+ ++AAGAL++E+ I
Sbjct: 329 GSLQIVKAGASLAAVVKGLNALGATPADLQTILEAMRAAGALRAELEI 376


>gi|126462480|ref|YP_001043594.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221639491|ref|YP_002525753.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides KD131]
 gi|332558504|ref|ZP_08412826.1| FlgI [Rhodobacter sphaeroides WS8N]
 gi|14548029|sp|P58204|FLGI_RHOSH RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|11095162|gb|AAG29751.1|AF205139_3 flagellar P-ring protein [Rhodobacter sphaeroides]
 gi|126104144|gb|ABN76822.1| flagellar P-ring protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221160272|gb|ACM01252.1| Flagellar P-ring protein precursor [Rhodobacter sphaeroides KD131]
 gi|332276216|gb|EGJ21531.1| FlgI [Rhodobacter sphaeroides WS8N]
          Length = 371

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 138/356 (38%), Positives = 221/356 (62%), Gaps = 18/356 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KD+ ++   R N L+GYG+VVGL GTGD   +S  T+QSM+SL+  LG+S   G L +
Sbjct: 21  RLKDLTTVAGVRSNPLVGYGVVVGLSGTGDG--NSQLTQQSMQSLISRLGLSVETGDLKA 78

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KN AAVMVTA+LPPF   G  +DV+++++G A SL+GG L+MT L+GADG +YA+AQG++
Sbjct: 79  KNAAAVMVTADLPPFLKIGQTLDVTVSTVGQAKSLKGGTLLMTPLMGADGEVYAIAQGNL 138

Query: 145 VVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           VV GL V+G+  SS    I T G++  G +VE+ +   F ++  L+L L   DFSTA  +
Sbjct: 139 VVGGLGVEGKDGSSLTVNIPTVGRVPRGGMVEKMVETPFLETDHLVLNLNRGDFSTAAAV 198

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVETDTP-ARVIIN 261
           A+ +N      F   +A A D  +++V  P +       MS +E + V+   P ARV++N
Sbjct: 199 AEGVN----RTFGPDVAVALDGTSIRVRAPADPAQRVSFMSLLENVEVDPAPPVARVVVN 254

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ-PNAFSSNGSTVTQNNTDLKVSDN 320
            RTGT+VIG  V+++   V++G+LTV++TE+++V Q  +    N +TV      +   D+
Sbjct: 255 ARTGTVVIGGTVKVTPAAVTHGSLTVRVTEDQRVSQGASVVVGNNATVVAPGEPVVTPDS 314

Query: 321 K--------GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +         +F       L+SL+  +N++G     +++IL+ ++ AGAL++E+++
Sbjct: 315 QVQVVEEPAKAFVFDPGVSLSSLVDAINAVGASPSDLVAILEALREAGALRAELVV 370


>gi|268317784|ref|YP_003291503.1| flagellar P-ring protein [Rhodothermus marinus DSM 4252]
 gi|262335318|gb|ACY49115.1| flagellar P-ring protein [Rhodothermus marinus DSM 4252]
          Length = 369

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 146/352 (41%), Positives = 209/352 (59%), Gaps = 15/352 (4%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS---SPFTEQSMRSLLQNLGISTPGG 80
           +R+KD+++++     QLIGYGLVVGL  TGD  R    SP+T QS+ ++L+  GI+    
Sbjct: 25  ARLKDLITVEGAAPIQLIGYGLVVGLDRTGDRARGQRGSPYTVQSIANMLRRFGITVDPN 84

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA-DGNIYAV 139
            L ++N AAVMVTA L PFA+PG+R+DV++++LGDA SL GG+L+ T L     G +YA+
Sbjct: 85  LLQARNAAAVMVTATLDPFAAPGTRLDVTVSALGDARSLSGGVLLQTPLQDPTTGQVYAI 144

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQG V    +      SS     +  G++  GA+V    P        L L L+ PDF  
Sbjct: 145 AQGPVSTGAVLASSFGSSVQINHTNTGRVPGGAVVTAAPPVTLG-GPQLGLVLKRPDFVN 203

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVETDTPARV 258
           A RIA+ IN    N      AE   +  V+V+ P  +D   +L++E+E LT++ D PARV
Sbjct: 204 ATRIAEAINGRYPN-----AAEVVHAGLVRVNLPNGVDNPAQLLAELEPLTIDVDIPARV 258

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           +INERTGTIV G NVRIS+V+++YG+L +       V QP  F S G TVT     + V 
Sbjct: 259 VINERTGTIVAGGNVRISEVMITYGSLVISTQAEPFVAQPAPF-SQGETVTGARATIDVQ 317

Query: 319 DNKGSFSLIDAP--DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +   + S++  P  D+  L + +N +GL    II+I Q I+ AGALQ E++I
Sbjct: 318 EEV-ARSVVLGPNADVAQLAAALNELGLTARDIIAIFQAIERAGALQGELVI 368


>gi|260222472|emb|CBA32070.1| Flagellar P-ring protein [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 381

 Score =  236 bits (601), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 137/353 (38%), Positives = 214/353 (60%), Gaps = 11/353 (3%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS-TP 78
           A   +RIK+V +++  R NQL G+GLV+GL GTGD     P+T Q +++ ++ LG++ TP
Sbjct: 31  AHSATRIKEVAAIEGVRSNQLTGFGLVIGLDGTGDQTTQMPYTTQGLKNYMEQLGLTLTP 90

Query: 79  GG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
               +L  KNVAAV+VTA LP FA PG  +D++++SLG+A SL+GG L+ T L GADG +
Sbjct: 91  ASLTQLQMKNVAAVLVTAQLPAFARPGQMLDINVSSLGNAKSLKGGTLIATPLKGADGEV 150

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YA+AQG+++V+G       S       + G+I +GA VER +P   +D   + L L   D
Sbjct: 151 YAMAQGNLIVAGAGASAGGSKVQVNHLSAGRIPDGAQVERSVPTSLQDGPTINLSLNASD 210

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETD-T 254
           F TA ++A  +N    NRF   +A+A D RTV+V  PTN  +    ++++E L V++   
Sbjct: 211 FQTARKVAQAVN----NRFGSGVAQALDGRTVQVKAPTNPNERVSFIADMEELPVDSSVA 266

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A++IIN RTG+IV+   V +    +++GNL+V ++ +  + QPN  S  G TV     +
Sbjct: 267 AAKIIINSRTGSIVMNQAVTLGACAIAHGNLSVSVSSSPVISQPNPLSG-GQTVVGEKAN 325

Query: 315 LKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +++    G    L  A  L  ++  +NS+G     +++ILQ IK+AGAL +E+
Sbjct: 326 IEIKQEAGKLIQLPQAAQLTDVVRALNSLGATPQDLLAILQAIKSAGALNAEL 378


>gi|296157452|ref|ZP_06840287.1| flagellar P-ring protein [Burkholderia sp. Ch1-1]
 gi|295892224|gb|EFG72007.1| flagellar P-ring protein [Burkholderia sp. Ch1-1]
          Length = 398

 Score =  236 bits (601), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 146/359 (40%), Positives = 211/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KD+V +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS      GS
Sbjct: 44  RLKDLVQIQGVRDNPLIGYGLVVGLDGTGDQTTQTPFTTQTLANMLANLGISINNQAAGS 103

Query: 85  ------------KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                       KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 104 TNQQSSLSNIQLKNVAAVMVTAVLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 163

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQL 192
           DG +YA+ QG++ V G       S         G+I  GAIVER +P     +  + L L
Sbjct: 164 DGQVYALGQGNLAVGGAGASANGSKVQVNTLAAGRIAGGAIVERAVPTSVSQAGTMQLDL 223

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVE 251
            + D+ T  R+   +N    N F    A A D RT+++  P++ +     M++++ L V+
Sbjct: 224 NDMDYDTTQRVVAAVN----NAFGSGTATALDGRTIQLHAPSDPEQQVAFMAQLQNLDVK 279

Query: 252 -TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
                A+VI+N RTG+IV+   V +    V++GNL+V I     V QP AF SNG TV  
Sbjct: 280 PAQAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVINTQPVVSQPGAF-SNGQTVVA 338

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + G+  L+ A  +L  ++  +N++G     ++SILQ +KAAGAL++++ I
Sbjct: 339 KQSQIQMKQDNGALKLVTAGANLAEVVKALNALGATPADLMSILQAMKAAGALRADLEI 397


>gi|188592121|ref|YP_001796719.1| flagellar basal body p-ring protein [Cupriavidus taiwanensis LMG
           19424]
 gi|170938495|emb|CAP63482.1| FlgI: Flagellar P-ring protein ; signal peptide [Cupriavidus
           taiwanensis LMG 19424]
          Length = 381

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 206/346 (59%), Gaps = 9/346 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR-LG 83
           R+K++ + Q  RDN L+GYGLVVGL  TGD    +PFT QS+ ++L  LGI+ P G+ + 
Sbjct: 38  RLKNLATFQGVRDNPLVGYGLVVGLDNTGDQTMQTPFTTQSLTNMLSQLGITLPAGKNMQ 97

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LP FA PGS++DV ++S+G+A SLRGG L+MT L GADG +YA+AQG+
Sbjct: 98  LKNVAAVMVTATLPAFAQPGSQLDVVVSSMGNAKSLRGGTLLMTPLKGADGQVYAIAQGN 157

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       S         G+I NGAIVER +     D   L L+L++ DF TA R+
Sbjct: 158 MLVGGAGASANGSKVQINQLAVGRIANGAIVERAVAPFQPDGGVLNLELKDTDFGTAERV 217

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV-ETDTPARVIIN 261
            + IN          +A A D R V+V  P +       ++ +E + V      A+VI+N
Sbjct: 218 VEAIN----RNMGGGVAAALDGRVVQVRAPASPAARVGFLARIENIDVTPAKAAAKVILN 273

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG+IV+   V +    V++GNL+V I     + QP  F S+G TV    + + +    
Sbjct: 274 ARTGSIVMNQAVTVEDCAVAHGNLSVVINTQPVISQPAPF-SDGQTVVAPVSQIDMRQQG 332

Query: 322 GSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           GS  ++ A   L +++ G+N++G     + +IL+ ++AAGAL++E+
Sbjct: 333 GSLQIVKAGASLAAVVKGLNALGATPADLQTILEAMRAAGALRAEL 378


>gi|186477701|ref|YP_001859171.1| flagellar basal body P-ring protein [Burkholderia phymatum STM815]
 gi|184194160|gb|ACC72125.1| flagellar P-ring protein [Burkholderia phymatum STM815]
          Length = 395

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 151/388 (38%), Positives = 224/388 (57%), Gaps = 26/388 (6%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVS------RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDS 55
           +  IA   F+++ L   +  V +      R+KD+V +Q  RDN LIGYGLVVGL GTGD 
Sbjct: 12  VIGIAARAFAMVALACAALPVTTHVAHAERLKDLVQIQGVRDNPLIGYGLVVGLDGTGDQ 71

Query: 56  LRSSPFTEQSMRSLLQNLGISTPGGRLGS------------KNVAAVMVTANLPPFASPG 103
              +PFT Q++ ++L NLGIS    + GS            KNVAAVMVTA+LP FA PG
Sbjct: 72  TTQTPFTTQTLANMLANLGISINNQQAGSNSSNSSLSSMQLKNVAAVMVTASLPAFARPG 131

Query: 104 SRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS 163
             +DV+++SLG+A SLRGG L++T L GADG +YA+AQG++ V G       S       
Sbjct: 132 EALDVTVSSLGNAKSLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSKVQVNQL 191

Query: 164 TGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAY 223
             G+I  GAIVER +P     +  + L+L + D+ T  R+   IN    N F    A A 
Sbjct: 192 AAGRITGGAIVERSVPTTISQAGTMQLELNDMDYDTTQRVTSAIN----NAFGFGTAVAL 247

Query: 224 DSRTVKVSKPTN-IDLTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVS 281
           D RT+++  P++     + M++++ L V+     A+VI+N RTG+IV+   V +    V+
Sbjct: 248 DGRTIQLRAPSDPAQQVQFMAQLQNLDVKPGQAAAKVILNARTGSIVMNQMVTLQNCAVA 307

Query: 282 YGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMN 340
           +GNL+V +     V QP AF SNG TV    + + +  + G+  L+ A  +L  ++  +N
Sbjct: 308 HGNLSVIVNTQPVVSQPGAF-SNGQTVVAQQSQIALKQDNGALKLVSAGANLAEVVKALN 366

Query: 341 SIGLKTDGIISILQGIKAAGALQSEIII 368
           ++G     ++SILQ +KAAGAL++E+ I
Sbjct: 367 ALGATPADLMSILQAMKAAGALRAELEI 394


>gi|238028845|ref|YP_002913076.1| flagellar basal body P-ring protein [Burkholderia glumae BGR1]
 gi|237878039|gb|ACR30372.1| Flagellar P-ring protein [Burkholderia glumae BGR1]
          Length = 395

 Score =  235 bits (600), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 155/376 (41%), Positives = 221/376 (58%), Gaps = 21/376 (5%)

Query: 8   LIFSL-IGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           L F+L   L   SA+   R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++
Sbjct: 25  LAFALGCALPAASARA-ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTTQTPFTTQTL 83

Query: 67  RSLLQNLGISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDA 116
            ++L NLGIS   G           L  KNVAAVMVTA LPPFA PG  IDV+++SLG+A
Sbjct: 84  ANMLANLGISINNGTSTGGTASLSNLQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNA 143

Query: 117 SSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVER 176
            SLRGG L++T L GADG +YA+AQG++ V G       S         G+I  GAIVER
Sbjct: 144 KSLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAVGRITGGAIVER 203

Query: 177 ELPKKFKD-SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN 235
            +P      +  L+LQL + D+ TA RI   +NS         IA A D RT++++ P++
Sbjct: 204 SVPNALAQMNGVLLLQLNDMDYGTAERIVTAVNS----NLGPGIATALDGRTIQLTAPSD 259

Query: 236 -IDLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENE 293
                  M+ ++ L V  +   A+VI+N RTG+IV+   V +    V++GNL+V +    
Sbjct: 260 PAQQVAFMARLQNLDVNPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQP 319

Query: 294 QVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISI 352
            V QP AF SNG TV    + +++  + G+   ++A  +L  ++  +NS+G     ++SI
Sbjct: 320 VVSQPGAF-SNGQTVVAQQSQIQLKQDNGALRYVNAGANLADVVKALNSLGATPADLMSI 378

Query: 353 LQGIKAAGALQSEIII 368
           LQ +KAAGAL++++ I
Sbjct: 379 LQAMKAAGALRADLEI 394


>gi|119947173|ref|YP_944853.1| flagellar basal body P-ring protein [Psychromonas ingrahamii 37]
 gi|119865777|gb|ABM05254.1| flagellar P-ring protein [Psychromonas ingrahamii 37]
          Length = 368

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 150/365 (41%), Positives = 220/365 (60%), Gaps = 11/365 (3%)

Query: 10  FSLIGL-HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           F  +GL   I++ V   + ++V ++  R N+L GYGLVVGL GTGD  +   FT QS+ +
Sbjct: 8   FCYLGLVFLINSSVADDLMNLVDIKGIRTNELAGYGLVVGLDGTGDKSQVK-FTSQSVTN 66

Query: 69  LLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +++  G+   PG     KNVAAV VTA +      G +I+V ++SLGDA SLRGG L++T
Sbjct: 67  MIKKFGVQLNPGVNPKLKNVAAVSVTATVTAMLGEGQKINVVVSSLGDAKSLRGGTLILT 126

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
            L G DG IYA+AQGSV+V GL V+G   SS    + T G+I NGAI+ERE+   F +S+
Sbjct: 127 PLHGMDGEIYAIAQGSVIVGGLGVQGADGSSVTINLPTTGRIPNGAILEREILNTFNESS 186

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEV 245
            + L L+ P+F+TA  IA  IN      F   +AEA    +V+V+ P +       MS +
Sbjct: 187 HITLNLQKPNFTTAKNIARSINMI----FGPGVAEAMSFASVQVAAPMDKGQRVTFMSML 242

Query: 246 EMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           E + V+     ARVI N RTGT+VI ++V+IS+V VS+G LT+ I E+  V QP A S  
Sbjct: 243 EEIDVDQGKGKARVIFNSRTGTVVISESVKISRVAVSHGGLTISIQEDAFVSQPAALSEG 302

Query: 305 GSTVTQNNTDLKVS-DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G+T    N+ + +  DN       +  DL ++++ +NS+G   D ++ ILQ +  AGAL 
Sbjct: 303 GNTEVIKNSKIVIEQDNPQMMVWREGVDLQTIVNAINSVGGSPDDVMQILQALDEAGALN 362

Query: 364 SEIII 368
           +E+++
Sbjct: 363 AELLV 367


>gi|332162897|ref|YP_004299474.1| flagellar P-ring protein 1 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325667127|gb|ADZ43771.1| Flagellar P-ring protein 1 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863347|emb|CBX73470.1| flagellar P-ring protein 1 [Yersinia enterocolitica W22703]
          Length = 364

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 146/367 (39%), Positives = 218/367 (59%), Gaps = 17/367 (4%)

Query: 10  FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSL 69
           F L+GL  + A +   +  +V +Q  R NQL+GY LVVGL G+GD      FT QSM ++
Sbjct: 6   FVLMGLFFLPAAIAQPLGSLVDIQGVRGNQLVGYSLVVGLDGSGDK-NQVKFTGQSMANM 64

Query: 70  LQNLGISTPGGRLGS-KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTS 128
           L+  G+  P       KNVAAV ++A LPP  + G  ID++++S+GDA SLRGG L++T 
Sbjct: 65  LRQFGVQLPEKMDPKVKNVAAVAISATLPPGYARGQSIDITVSSIGDAKSLRGGTLLLTQ 124

Query: 129 LLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSAD 187
           L GADG IYA+AQG+V+V G+  +G S SS      T G+I NG  +ERE+P  F+ ++ 
Sbjct: 125 LRGADGEIYALAQGNVIVGGIKAEGDSGSSVTVNTPTVGRIPNGGSIEREIPSDFQSNSQ 184

Query: 188 LILQLRNPDFSTAIRIADQINSYSLNR-FSRPIAEAYDSRTVKVSKP----TNIDLTRLM 242
           ++L L+ P F +A  +A      +LNR F    A A  S  V V+ P      +    L+
Sbjct: 185 VVLNLKRPSFKSANNVA-----LALNRAFGANTAVAQSSTNVLVNAPLTPGARVAFMSLL 239

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +V+ +     +P RV+ N RTGT+VIG+ VR+    VS+GNLTV I E + V QPN   
Sbjct: 240 EDVQ-INAGKQSP-RVVFNARTGTVVIGEGVRVRAAAVSHGNLTVSIREKKNVSQPNVLG 297

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
             G TVT   +D++++  K    ++ +   L S+++ +NS+G   D I++ILQ +  AGA
Sbjct: 298 G-GKTVTTPESDIEITKGKNQMVIVPNGTRLRSIVNTINSLGASPDDIMAILQALHEAGA 356

Query: 362 LQSEIII 368
           L +E+++
Sbjct: 357 LDAELVV 363


>gi|319944131|ref|ZP_08018409.1| flagellar P-ring protein FlgI [Lautropia mirabilis ATCC 51599]
 gi|319742625|gb|EFV95034.1| flagellar P-ring protein FlgI [Lautropia mirabilis ATCC 51599]
          Length = 374

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 148/353 (41%), Positives = 211/353 (59%), Gaps = 13/353 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+K+V S+Q  R NQL+GYGL+VGL GTGD    +PFT QSM+SLLQ LGI  P G    
Sbjct: 25  RLKEVASIQGVRTNQLLGYGLMVGLDGTGDQTTQAPFTAQSMKSLLQQLGIQLPAGVTPQ 84

Query: 85  -KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KN AAV+VTA LP F+ PG  IDV+++S+G+A SLRGG L++T L G DG IYAVAQG+
Sbjct: 85  LKNSAAVIVTAQLPAFSQPGQLIDVTVSSVGNAKSLRGGTLLLTPLRGVDGEIYAVAQGN 144

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           VVV G       S       + G+I  GA VER +P +  +   + ++L   DFS    +
Sbjct: 145 VVVGGAGTSAGGSKVQINHLSAGRIPGGATVERVVPNQTLEGDSIRVELNRTDFSDVRLV 204

Query: 204 ADQINSYSLNRFSRP-----IAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVE-TDTPA 256
            D IN     R  RP      A A D+R V+V  P +       ++E+E + V  T  PA
Sbjct: 205 TDAINQKI--RL-RPGSDGRQAVAMDARVVQVPLPRDPAQRVGFLAELESMEVALTAAPA 261

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +VI+N RTG++V+  +V ++   V++GNL+V ++    V QP AF S G TV    +D+ 
Sbjct: 262 KVIVNARTGSVVMNQSVALAPSAVAHGNLSVTVSSTPVVSQPGAF-SGGQTVAGQVSDIT 320

Query: 317 VSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           V    G+  ++  +  L  L+  +NS+G     +I+ILQ ++AAG+L++E+ I
Sbjct: 321 VRQEGGAVMMLPKSAQLKDLVRALNSLGATPQDLIAILQALQAAGSLKAELEI 373


>gi|331005449|ref|ZP_08328828.1| Flagellar P-ring protein flgI [gamma proteobacterium IMCC1989]
 gi|330420725|gb|EGG95012.1| Flagellar P-ring protein flgI [gamma proteobacterium IMCC1989]
          Length = 378

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 146/377 (38%), Positives = 225/377 (59%), Gaps = 16/377 (4%)

Query: 4   RIAFLIFSLIGLHEISAQVV----SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           R+  +I +++ L  I AQ V     ++K++  L   +DN L+GYG++ GL GTGDS RS 
Sbjct: 7   RLHIIIANMLLLLFIFAQPVIASTVKVKELTRLSGTKDNALVGYGIITGLAGTGDSSRSK 66

Query: 60  PFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
             T QS++++L+  GI  P   + S+N AAVMVT  L PF+  G ++D+++ S+GDA +L
Sbjct: 67  A-TFQSIKNILKRFGIDVPVANVHSRNAAAVMVTTTLSPFSQVGDKLDINVTSMGDARNL 125

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
            GG L+MT L GAD NIYA+AQG + V G       +   +   T G I  GAIVER++ 
Sbjct: 126 VGGTLLMTHLTGADQNIYALAQGPLSVGGFSYDFNGNLVQKNHPTAGYISGGAIVERQVD 185

Query: 180 -KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID- 237
                 +  +   L++P+FSTA RIA+ IN     RF+  IA+A  +  V +  P   + 
Sbjct: 186 LSSIGSNGYIAFSLQDPNFSTAFRIAESINI----RFNETIAKAQTASQVVIRIPQTYEN 241

Query: 238 -LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
            L  L+  V+ ++V  D PARV++NERTGT+V G +VR+S + +++G+L V I  +    
Sbjct: 242 NLVSLIMSVQEISVSPDIPARVVVNERTGTVVSGGDVRVSSITITHGDLNVSIKSDFSTS 301

Query: 297 QP---NAFSSNGSTVTQNNTDLKVS-DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISI 352
           QP      S+N  T T   ++++VS D   + SL D   +++L+S +N +   +  +I+I
Sbjct: 302 QPLIIGQASNNVKTETLQQSEIEVSEDAPFNVSLPDNITVSTLVSALNKVKASSRDVITI 361

Query: 353 LQGIKAAGALQSEIIIQ 369
           LQ IK AGAL +E++IQ
Sbjct: 362 LQSIKRAGALHAELVIQ 378


>gi|225849138|ref|YP_002729302.1| flagellar P-ring protein FlgI [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643750|gb|ACN98800.1| flagellar P-ring protein FlgI [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 372

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 144/371 (38%), Positives = 211/371 (56%), Gaps = 12/371 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F+   ++   I L    A    +I+D+V ++  R N L GYG+VVGL GTGD   +S +
Sbjct: 9   MFKKIIVLLLFISLTTFGATNEIKIRDLVEVEGFRTNYLTGYGIVVGLNGTGDG-TTSRY 67

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T  S+ ++L+ LGI     ++ +KN AAV+VTANLPPFA PG  +DV + SLGDA  +R 
Sbjct: 68  TLISIANMLRKLGIYIDPAQVRTKNAAAVIVTANLPPFAKPGMSVDVQVASLGDAKDIRN 127

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVK-GQSSSFMEGISTGGKIVNGAIVERELPK 180
           G+L+ T L G DG IYA AQG V   G F +  ++    +G +T G I NGA++E ELP 
Sbjct: 128 GLLIRTPLYGPDGKIYAFAQGPVSTGGGFSESNKTGKVQKGFTTAGIIPNGAVIEEELPF 187

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
            F    ++ L L+NPDF  +  IA+ IN    N     IA   D+ +VKV  P       
Sbjct: 188 DFNSLTEITLNLKNPDFKRSTLIAETINKKYPN-----IANVLDATSVKVKLPDGSSKAE 242

Query: 241 LMSEVEMLTV--ETDTPARVIINERTGTIVIGDNVRI-SKVVVSYGNLTVQITENEQVVQ 297
            ++ +  L V  +TD P  ++I E+TGT+++  +++I   V VS+GN+ V +     V Q
Sbjct: 243 FLASILDLKVSLDTDYPT-IVIYEKTGTVIMSGDIKIDPPVYVSHGNIYVSVETIPLVSQ 301

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           P   S  G TVT   T  KV + KG    I+ P L  L+  +N +G+    +I+I+Q IK
Sbjct: 302 PPPLSG-GQTVTAQKTITKVVEEKGRIIEIEKPSLKDLVKALNDLGVSPYDLIAIIQAIK 360

Query: 358 AAGALQSEIII 368
           +AG + + III
Sbjct: 361 SAGKINANIII 371


>gi|87119672|ref|ZP_01075569.1| flagellar P-ring protein precursor [Marinomonas sp. MED121]
 gi|86165148|gb|EAQ66416.1| flagellar P-ring protein precursor [Marinomonas sp. MED121]
          Length = 370

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 140/352 (39%), Positives = 216/352 (61%), Gaps = 17/352 (4%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           R+KD+ S++  RDNQL GYGLV+GL GTGD+   S FT+QS   +L   GI  P G    
Sbjct: 27  RLKDISSVEGVRDNQLFGYGLVIGLNGTGDN---SNFTDQSFTGMLAQFGIVLPEGVNAN 83

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           S+NVAAV +TA LPPF+ PG +ID++ +S+G ASSL+GG L++++L GADG +YA+AQG+
Sbjct: 84  SQNVAAVSLTATLPPFSKPGQKIDITASSIGSASSLQGGTLLLSTLKGADGQVYAIAQGN 143

Query: 144 VVVSGLFVKGQSSSFME-GISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV GL  +G   S     I T G+I NGA VER +P  F     L   L  PDF+TA +
Sbjct: 144 LVVGGLGTQGNDGSKTSLSIPTVGRIPNGASVERTVPNSFNRGDTLTFNLNRPDFTTAKQ 203

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-ARVII 260
           ++D IN+         +A+  D+ +++VS P +       +S +E L VE     A+++I
Sbjct: 204 VSDSINAL----LGPGVAKTMDATSIRVSAPRDPSQRVTFLSILENLEVELGQERAKIVI 259

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITE---NEQVVQPNAFSSNGSTVTQNNTDLKV 317
           N RTGTI+IG +V++S   V++G+LTV I     N+  V+  A  + G T+     ++ V
Sbjct: 260 NSRTGTIIIGQHVKVSPAAVTHGSLTVTIKNPPLNQAAVE--AALTGGETIYAPREEIVV 317

Query: 318 SDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +++ G   L      LN ++  +N +G     +++IL+G+K AGA+ +++++
Sbjct: 318 NEDSGHMFLFGPGASLNDIVRAVNQVGAAPGDVMAILEGLKQAGAINADLVV 369


>gi|315127349|ref|YP_004069352.1| flagellar basal body P-ring protein [Pseudoalteromonas sp. SM9913]
 gi|315015863|gb|ADT69201.1| flagellar basal body P-ring protein [Pseudoalteromonas sp. SM9913]
          Length = 355

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 138/348 (39%), Positives = 203/348 (58%), Gaps = 11/348 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKDV  ++  R NQL+GYGLVVGL GTG+  R   FTEQS + +L + GI+ P   +  
Sbjct: 14  RIKDVSMVEGVRSNQLVGYGLVVGLPGTGEQSR---FTEQSFKGMLNSFGITLPSSLKPK 70

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV V A LPPF  PG  ID++++S+G A SLRGG L+ T L G DGN+YA+AQGS
Sbjct: 71  IKNVAAVAVHAELPPFRKPGQTIDITVSSIGSAGSLRGGTLLQTFLKGVDGNVYAIAQGS 130

Query: 144 VVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++V GL  +G   S  +    T G++ NGA VER +   F  +  +   L  PDF+TA R
Sbjct: 131 LIVGGLGAEGLDGSRVVINTPTVGRVPNGATVERAVKSPFMQNDYITFNLNRPDFTTAKR 190

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDTPARVII 260
           +   IN           A+A D+ +++V  P +       +S +E L  +  DT A++I+
Sbjct: 191 LEKTINDL----IGPNSAQALDAASIRVVAPRDASQRVSYLSTLENLEFKPADTSAKIIV 246

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTGTIVIG NV++    +++G LTV I E + V QPN  +   + VTQ +      D+
Sbjct: 247 NSRTGTIVIGKNVKLQPAAITHGGLTVTIAEQQNVAQPNPLAEGETVVTQQSIIDVNQDD 306

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             +F       L+ L+  +N +G     +++IL+ +K AGA+  ++++
Sbjct: 307 SRAFVFDPGVSLDDLVRAINEVGAAPGDLMAILEALKEAGAINGQLVV 354


>gi|77463648|ref|YP_353152.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides 2.4.1]
 gi|124021066|sp|Q3J1T3|FLGI1_RHOS4 RecName: Full=Flagellar P-ring protein 1; AltName: Full=Basal body
           P-ring protein 1; Flags: Precursor
 gi|77388066|gb|ABA79251.1| flagellar P-ring protein [Rhodobacter sphaeroides 2.4.1]
          Length = 371

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 139/358 (38%), Positives = 221/358 (61%), Gaps = 22/358 (6%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KD+ ++   R N L+GYG+VVGL GTGD   +S  T+QSM+SL+  LG+S   G L +
Sbjct: 21  RLKDLTTVAGVRSNPLVGYGVVVGLSGTGDG--NSQLTQQSMQSLISRLGLSVETGDLKA 78

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KN AAVMVTA+LPPF   G  +DV+++++G   SL+GG L+MT L+GADG +YA+AQG++
Sbjct: 79  KNAAAVMVTADLPPFLKIGQTLDVTVSTVGQPKSLKGGTLLMTPLMGADGEVYAIAQGNL 138

Query: 145 VVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           VV GL V+G+  SS    I T G++  G +VE+ +   F ++  L+L L   DFSTA  +
Sbjct: 139 VVGGLGVEGKDGSSLTVNIPTVGRVPRGGMVEKMVETPFLETDHLVLNLNRGDFSTAAAV 198

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR---LMSEVEMLTVETDTP-ARVI 259
           A+ +N      F   +A A D  +++V  P   D  R    MS +E + V+   P ARV+
Sbjct: 199 AEGVN----RTFGPDVAVALDGTSIRVRAPA--DPARRVSFMSLLENVEVDPAPPVARVV 252

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ-PNAFSSNGSTVTQNNTDLKVS 318
           +N RTGT+VIG  V+++   V++G+LTV++TE+++V Q  +    N +TV      +   
Sbjct: 253 VNARTGTVVIGGTVKVTPAAVTHGSLTVRVTEDQRVSQGASVVVGNNATVVAPGEPVVTP 312

Query: 319 DNK--------GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           D++         +F       L+SL+  +N++G     +++IL+ ++ AGAL++E+++
Sbjct: 313 DSQVQVVEEPAKAFVFDPGVSLSSLVDAINAVGASPSDLVAILEALREAGALRAELVV 370


>gi|78485808|ref|YP_391733.1| flagellar basal body P-ring protein [Thiomicrospira crunogena
           XCL-2]
 gi|124021074|sp|Q31FL4|FLGI_THICR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|78364094|gb|ABB42059.1| Flagellar P-ring protein FlgI [Thiomicrospira crunogena XCL-2]
          Length = 366

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 148/378 (39%), Positives = 227/378 (60%), Gaps = 29/378 (7%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +I     LI+S +   E       R+KD+ ++   R NQLIGYGLVVGL GTGD    + 
Sbjct: 7   VILMAVLLIWSAVSYAE-------RVKDLANVAGVRPNQLIGYGLVVGLSGTGDK---TS 56

Query: 61  FTEQSMRSLLQNLGIS-TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           + +QS+ S+L   GI+  PG +  SKNVAAV V A+LP F+  G RIDV+++SLG+A SL
Sbjct: 57  YADQSLMSMLNKFGINLPPGTKTNSKNVAAVAVHADLPAFSKSGQRIDVTVSSLGNAKSL 116

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFME-GISTGGKIVNGAIVEREL 178
           RGG L++T L G DGN+YA+AQG+++V GL   G   S +   + + G++  G IVE+ +
Sbjct: 117 RGGTLLLTPLKGVDGNVYALAQGNLIVGGLDASGADGSRITVNVPSVGRVPGGGIVEKTV 176

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL 238
              F     + L L+N DF+TA  + + IN+    +  +  A A D+ +V+V  P  I  
Sbjct: 177 NTGFDLGNTITLNLKNSDFTTATNLVNAINA----KLGKGTAYATDAESVEVMAP-RIPN 231

Query: 239 TR--LMSEVEMLTVETDTP----ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
            R   +S +E + V   TP    A+VIIN RTGT+VIG NV++S   V++GNL V+++E+
Sbjct: 232 QRVAFLSVIENIEV---TPGVDSAKVIINSRTGTVVIGSNVKVSAAAVTHGNLVVKVSES 288

Query: 293 EQVVQPNAFSSNGSTVTQNNTDLKV-SDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGII 350
           + V QPN F+   + VT   T+L V S+ KG  F       L+ ++  +N +G     ++
Sbjct: 289 KDVSQPNPFAGGNTQVTP-KTELSVESEGKGRMFKFPKGVTLDDIVQAVNKVGAAPGDLV 347

Query: 351 SILQGIKAAGALQSEIII 368
           +IL+ +K +GAL +++++
Sbjct: 348 AILEALKQSGALSADLMV 365


>gi|91785630|ref|YP_560836.1| flagellar basal body P-ring protein [Burkholderia xenovorans LB400]
 gi|91689584|gb|ABE32784.1| Flagellar P-ring protein [Burkholderia xenovorans LB400]
          Length = 398

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 145/359 (40%), Positives = 210/359 (58%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KD+V +Q  RDN LIGYGLVVGL GTGD    + FT Q++ ++L NLGIS      GS
Sbjct: 44  RLKDLVQIQGVRDNPLIGYGLVVGLDGTGDQTTQTLFTTQTLANMLANLGISINNQAAGS 103

Query: 85  ------------KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                       KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 104 TNQQSSLSNIQLKNVAAVMVTAVLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 163

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQL 192
           DG +YA+ QG++ V G       S         G+I  GAIVER +P     +  + L L
Sbjct: 164 DGQVYALGQGNLAVGGAGASANGSKVQVNTLAAGRIAGGAIVERAVPTSVSQAGTMQLDL 223

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVE 251
            + D+ T  R+   +N    N F    A A D RT+++  P++ +     M++++ L V+
Sbjct: 224 NDMDYDTTQRVVAAVN----NAFGSGTATALDGRTIQLRAPSDPEQQVAFMAQLQNLDVK 279

Query: 252 -TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
                A+VI+N RTG+IV+   V +    V++GNL+V I     V QP AF SNG TV  
Sbjct: 280 PAQAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVINTQPVVSQPGAF-SNGQTVVA 338

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + G+  L+ A  +L  ++  +N++G     ++SILQ +KAAGAL++++ I
Sbjct: 339 KQSQIQMKQDNGALKLVTAGANLAEVVKALNALGATPADLMSILQAMKAAGALRADLEI 397


>gi|327393475|dbj|BAK10897.1| flagellar P-ring protein precursor [Pantoea ananatis AJ13355]
          Length = 369

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 144/347 (41%), Positives = 215/347 (61%), Gaps = 8/347 (2%)

Query: 26  IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRLGS 84
           I+D+ ++Q  RDNQL+GYGLVVGL GTGD    +PFT Q++ ++L  LGI+ P G  +  
Sbjct: 26  IRDLTTVQGVRDNQLLGYGLVVGLDGTGDQTTQTPFTTQTVSNMLSQLGITVPPGTNMQL 85

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAVMVTA LP FA  G  +DV ++S+G+A SLRGG L+MT + G D  +YA+AQG++
Sbjct: 86  KNVAAVMVTAKLPSFARQGQTLDVVVSSMGNAKSLRGGTLLMTPMKGVDNQVYALAQGNI 145

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +V G       SS       GG+I +GA VEREL   F     + LQL   DFS A RIA
Sbjct: 146 LVGGAGAAAGGSSVQVNQLNGGRITDGATVERELQSNFGSQNTINLQLNTEDFSMAQRIA 205

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVS-KPTNIDLTRLMSEVEMLTVETDTP-ARVIINE 262
           D IN+    R     A+  D+RTV+V   P N    RL++E++ + V      A+VIIN 
Sbjct: 206 DAINA----RGGYGSAQPLDARTVQVRVSPNNGAQVRLLAEIQNIDVSVPVEDAKVIINS 261

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTG++V+   V+++   V+ GNL+V + + + V QPN   + G TV   NT + +  + G
Sbjct: 262 RTGSVVMNREVKLNTCAVAQGNLSVTVNQQQNVSQPNTPLAGGQTVATTNTQIDLRQSGG 321

Query: 323 SFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +   ++ + +LNS++  +N++G     ++SILQ +++AG L++++ I
Sbjct: 322 ALQRVNSSANLNSVVRALNALGASPIELMSILQSMQSAGCLRAKLEI 368


>gi|294339839|emb|CAZ88202.1| Flagellar P-ring protein precursor (Basal body P-ring protein)
           [Thiomonas sp. 3As]
          Length = 409

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 153/348 (43%), Positives = 217/348 (62%), Gaps = 13/348 (3%)

Query: 26  IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---RL 82
           I+D+ S+Q  R NQL+GYGLVVGL GTGD     P+T QS+ S+ Q LGI+ P G    L
Sbjct: 65  IRDLTSVQGVRVNQLVGYGLVVGLGGTGDQATQVPYTTQSLLSMFQRLGINLPPGVASNL 124

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             K+VAAVM+TANLPPF+ PG +I+V+++++G+ASSL GG L+MT L GADG  YAVAQG
Sbjct: 125 QPKDVAAVMITANLPPFSQPGQQINVTVSAVGNASSLAGGTLLMTPLKGADGQTYAVAQG 184

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           SVVVSG       +S      T G I NGA VER +   F  +  + L L +P F TA R
Sbjct: 185 SVVVSGFGAASGGNSTQVNFLTAGMIANGATVERAVANNFDKAGPITLALNSPSFGTASR 244

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVEMLTVETDT-PARVII 260
           +AD IN     RF    A A ++  ++V+ P T  D T  + +VE L V  ++ PA+V+I
Sbjct: 245 VADSIN----QRFGAGTATALNAGVIQVNAPLTAGDRTAFLGQVEALDVSPESPPAKVVI 300

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           + R+GT+V+G NV +    V++GNL+V I    +V QPN   + G T     TD+K   +
Sbjct: 301 DARSGTVVLGQNVTLGACAVAHGNLSVTINTQYEVSQPNPLGA-GQTAVVPKTDVKAKAD 359

Query: 321 KGSFSLIDAP--DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           K +  L+  P   L +++  +N++G   + +I+ILQ +KAAGAL +++
Sbjct: 360 KANL-LMFKPGVTLEAVVRALNAVGAAPNDLIAILQAMKAAGALHAQL 406


>gi|288550124|ref|ZP_05969348.2| flagellar P-ring protein FlgI [Enterobacter cancerogenus ATCC
           35316]
 gi|288316286|gb|EFC55224.1| flagellar P-ring protein FlgI [Enterobacter cancerogenus ATCC
           35316]
          Length = 367

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 152/371 (40%), Positives = 214/371 (57%), Gaps = 14/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R A L   L+     +A+   R+ +VV +Q  R NQL+GY LVVGL GTGD      FT
Sbjct: 5   MRKAMLFLMLLWSTGAAAE---RLGNVVDIQGVRGNQLVGYSLVVGLDGTGDK-NQVKFT 60

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+ ++L+  G+  P       KNVAAV ++A LPP  + G  IDV+++S+GDA SLRG
Sbjct: 61  SQSVTNMLRQFGVQLPTKIDPKVKNVAAVAISATLPPGYARGQAIDVTVSSIGDAKSLRG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPK 180
           G L++T L GADG +YA+AQG+VVV G+  +G S SS      T G++ NG  VERE+  
Sbjct: 121 GTLLLTQLRGADGEVYALAQGNVVVGGVKAEGNSGSSVTINTPTVGRVPNGGSVEREIAS 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F+ +  +IL L+ P F TA  +A  +N    N F    A A  +  V V+ P    +  
Sbjct: 181 DFQQNQQVILNLKRPSFKTANSVAVALN----NAFGSGTATAQSATNVAVNAPLAAGERV 236

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             MS +E + +     P RV+ N RTGT+VIGD V +    VS+GNLTV I E+  V QP
Sbjct: 237 AFMSMLEDVQINAGKQPPRVVFNARTGTVVIGDGVVVRAAAVSHGNLTVTIRESSNVSQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIK 357
            AF S G TV   ++D+ V   +G    I A   L S+++ +NS+G   D  ++ILQ + 
Sbjct: 297 GAF-SQGRTVVTPDSDVNVDRGRGQMVEISAGTSLRSIVNTLNSLGAAPDDTMAILQALH 355

Query: 358 AAGALQSEIII 368
            AGAL +E+++
Sbjct: 356 EAGALDAELVV 366


>gi|116694223|ref|YP_728434.1| flagellar basal body P-ring protein [Ralstonia eutropha H16]
 gi|113528722|emb|CAJ95069.1| flagellar basal body P-ring protein [Ralstonia eutropha H16]
          Length = 389

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 141/366 (38%), Positives = 213/366 (58%), Gaps = 16/366 (4%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +AF  F+ +   E       R+K++ + Q  R+N L+GYGLVVGL  TGD    +PFT Q
Sbjct: 33  VAFGAFASVAKAE-------RLKNLATFQGVRENPLVGYGLVVGLDNTGDQTMQTPFTTQ 85

Query: 65  SMRSLLQNLGISTPGGR-LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           S+ ++L  LGI+ P G+ +  KNVAAVMVTA+LP FA PGS++D+ ++S+G+A SLRGG 
Sbjct: 86  SLTNMLSQLGITLPAGKNMQLKNVAAVMVTASLPAFAQPGSQLDIVVSSMGNAKSLRGGT 145

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L+MT L GADG +YA+AQG+++V G       S         G+I NGAIVER +     
Sbjct: 146 LLMTPLKGADGQVYAIAQGNMLVGGAGASANGSKVQVNQLAVGRIANGAIVERAVAPFQP 205

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLM 242
           D   L L+L++ DF TA R+ + IN          +A A D R V+V  P +       +
Sbjct: 206 DGGVLNLELKDTDFGTAERVVEAIN----RSMGGGVAAALDGRVVQVRAPASAAARVGFL 261

Query: 243 SEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           + +E + V      A+VI+N RTG+IV+   V +    V++GNL+V I     + QP  F
Sbjct: 262 ARIENIDVTPAKAAAKVILNARTGSIVMNQAVTVEDCAVAHGNLSVVINTQPVISQPAPF 321

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            S G TV    + + +    GS  ++ A   L +++ G+N++G     + +IL+ ++AAG
Sbjct: 322 -SEGRTVVAPVSQIDMRQQGGSLQIVKAGASLAAVVKGLNALGATPADLQTILEAMRAAG 380

Query: 361 ALQSEI 366
           AL++E+
Sbjct: 381 ALRAEL 386


>gi|326319101|ref|YP_004236773.1| flagellar P-ring protein [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323375937|gb|ADX48206.1| flagellar P-ring protein [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 388

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 141/347 (40%), Positives = 203/347 (58%), Gaps = 8/347 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIK+V ++Q  R NQL GYGLVVGL GTGD     P T Q++ + LQ +GIS P G    
Sbjct: 42  RIKEVAAVQGVRSNQLTGYGLVVGLDGTGDQTTQMPITTQALTNYLQQMGISLPPGTAAP 101

Query: 85  --KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVA V+VTA LP FA PG  IDV+++S+G+A SL+GG L+ T L GADG IYA+AQG
Sbjct: 102 QLKNVATVIVTAQLPAFAQPGQFIDVNVSSMGNAKSLKGGTLIATPLRGADGEIYALAQG 161

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++VV G       S       + G+I  GA VER +P    D   + L L   DF TA +
Sbjct: 162 NLVVGGAGAAAGGSKVQINHLSAGRIPEGAQVERSVPTPLNDGDTINLGLNASDFQTARK 221

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-ARVII 260
           +A  IN   L + +  IA A D RTV+V  P +       ++++E + +   TP A+V+I
Sbjct: 222 VARAIND-KLGKGAS-IATALDGRTVQVRAPQDPGGRVNFIADLEEIPLADATPAAKVVI 279

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG+IV+   V +    +++GNL++ I+    + QPN   S G TV    +D+ +   
Sbjct: 280 NARTGSIVLNQAVTLGPCAIAHGNLSITISSTPVISQPNPL-SQGQTVVAQKSDIAIKQE 338

Query: 321 KGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            G+   +  +P L  ++  +N++G     +++ILQ IKAAGAL +E+
Sbjct: 339 PGNIIQMPPSPQLADVVRALNTLGATPQDLLAILQAIKAAGALNAEL 385


>gi|187925757|ref|YP_001897399.1| flagellar basal body P-ring protein [Burkholderia phytofirmans
           PsJN]
 gi|187716951|gb|ACD18175.1| flagellar P-ring protein [Burkholderia phytofirmans PsJN]
          Length = 395

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 146/359 (40%), Positives = 212/359 (59%), Gaps = 20/359 (5%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           R+KD+V +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS      GS
Sbjct: 41  RLKDLVQIQGVRDNPLIGYGLVVGLDGTGDQTTQTPFTTQTLANMLANLGISINNQAAGS 100

Query: 85  ------------KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                       KNVAAVMVTA LPPFA PG +IDV+++SLG+A SLRGG L++T L GA
Sbjct: 101 SNSQSSLSNIQLKNVAAVMVTAVLPPFARPGEQIDVTVSSLGNAKSLRGGTLLLTPLKGA 160

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQL 192
           DG +YA+ QG++ V G       S         G+I  GAIVER +P     +  + L L
Sbjct: 161 DGQVYALGQGNLAVGGAGASANGSKVQVNTLAAGRIAGGAIVERAVPTSVSQAGTMQLDL 220

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVE 251
            + D+ T  R+   +N    N F    A A D RT+++  P++ +     M++++ L V+
Sbjct: 221 NDMDYDTTQRVVAAVN----NAFGGGTATALDGRTIQLRAPSDPEQQVAFMAQLQNLDVK 276

Query: 252 -TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
                A+VI+N RTG+IV+   V +    V++GNL+V I     V QP AF SNG TV  
Sbjct: 277 PAQAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVINTQPVVSQPGAF-SNGQTVVA 335

Query: 311 NNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + +++  + G+  L+ A  +L  ++  +N++G     ++SILQ +KAAGAL++++ I
Sbjct: 336 KQSQIQMKQDNGALKLVTAGANLAEVVKALNALGATPADLMSILQAMKAAGALRADLEI 394


>gi|120613064|ref|YP_972742.1| flagellar basal body P-ring protein [Acidovorax citrulli AAC00-1]
 gi|120591528|gb|ABM34968.1| flagellar P-ring protein [Acidovorax citrulli AAC00-1]
          Length = 388

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 202/347 (58%), Gaps = 8/347 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIK+V ++Q  R NQL GYGLVVGL GTGD     P T Q++ + LQ +GIS P G    
Sbjct: 42  RIKEVAAVQGVRSNQLTGYGLVVGLDGTGDQTTQMPITTQALTNYLQQMGISLPPGTAAP 101

Query: 85  --KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVA V+VTA LP FA PG  IDVS++S+G+A SL+GG L+ T L GADG IYA+AQG
Sbjct: 102 QLKNVATVIVTAQLPAFAQPGQFIDVSVSSMGNAKSLKGGTLIATPLRGADGEIYALAQG 161

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++VV G       S       + G+I  GA VER +P    D   + L L   DF TA +
Sbjct: 162 NLVVGGAGASAGGSKVQINHLSAGRIPEGAQVERAVPTPLNDGDTINLGLNASDFQTARK 221

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-ARVII 260
           +A  IN   L + +  IA A D RTV+V  P +       ++++E + +   TP A+V+I
Sbjct: 222 VARAIND-KLGKGAS-IATALDGRTVQVRAPQDPGGRVNFIADLEEIPLADATPAAKVVI 279

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG+IV    V +    +++GNL++ I+    + QPN   S G TV    +D+ V   
Sbjct: 280 NARTGSIVFNQAVTLGPCAIAHGNLSITISSTPVISQPNPL-SQGQTVVAQKSDISVKQE 338

Query: 321 KGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
            G+   +  +P L  ++  +N++G     +++ILQ IKAAGAL +E+
Sbjct: 339 PGNIIQMPPSPQLADVVRALNTLGATPQDLLAILQAIKAAGALNAEL 385


>gi|94312673|ref|YP_585882.1| flagellar basal body P-ring protein [Cupriavidus metallidurans
           CH34]
 gi|93356525|gb|ABF10613.1| flagellar basal body P-ring protein [Cupriavidus metallidurans
           CH34]
          Length = 394

 Score =  233 bits (595), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 139/348 (39%), Positives = 204/348 (58%), Gaps = 9/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR-LG 83
           R+K++ + Q  RDN L+GYGLVVGL  TGD    +PFT QS++++L  LGI+ P G+ + 
Sbjct: 51  RLKNLATFQGVRDNPLVGYGLVVGLDNTGDQTMQTPFTTQSLQNMLSQLGITLPAGKNMQ 110

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVTA LP +A PGS+IDV ++S+G+A SLRGG L+MT L G DG +YAVAQG+
Sbjct: 111 LKNVAAVMVTAALPAYAQPGSQIDVVVSSMGNAKSLRGGTLLMTPLKGIDGQVYAVAQGN 170

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           ++V G       S         G+I NGAIVER +P    +   + L+L++ DF T  R+
Sbjct: 171 MLVGGAGASANGSKVQINQLAVGRIANGAIVERAVPSFQPEGGFMNLELKDTDFGTVERV 230

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLMSEVEMLTV-ETDTPARVIIN 261
            + IN           A A D R V+V  P         M+ +E L V      A+VI+N
Sbjct: 231 VEAIN----RNLGAGTAAAMDGRVVQVRTPQAPSARVGFMARIENLDVTPAKAAAKVILN 286

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG+IV+   V +    +++GNL+V I     + QP  F S G TV    + + +    
Sbjct: 287 ARTGSIVMNQAVTVEDCAIAHGNLSVVINTQPVISQPGPF-SQGQTVVAPVSQIDMKQGG 345

Query: 322 GSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           GS  ++ A   L +++ G+N++G     + +IL+ ++AAGAL++E+ I
Sbjct: 346 GSLQIVKAGASLAAVVKGLNALGATPADLQTILEAMRAAGALRAELEI 393


>gi|296135669|ref|YP_003642911.1| flagellar P-ring protein [Thiomonas intermedia K12]
 gi|295795791|gb|ADG30581.1| flagellar P-ring protein [Thiomonas intermedia K12]
          Length = 409

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 152/348 (43%), Positives = 217/348 (62%), Gaps = 13/348 (3%)

Query: 26  IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG---RL 82
           I+D+ S+Q  R NQL+GYGLVVGL GTGD     P+T QS+ S+ Q LGI+ P G    L
Sbjct: 65  IRDLTSVQGVRVNQLVGYGLVVGLGGTGDQATQVPYTTQSLLSMFQRLGINLPPGVASNL 124

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             K+VAAVM+TANLPPF+ PG +I+V+++++G+ASSL GG L+MT L GADG  YAVAQG
Sbjct: 125 QPKDVAAVMITANLPPFSQPGQQINVTVSAVGNASSLAGGTLLMTPLKGADGQTYAVAQG 184

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           SVVVSG       +S      T G I NGA VER +   F  +  + L L +P F TA R
Sbjct: 185 SVVVSGFGAASGGNSTQVNFLTAGMIANGATVERAVANNFDKAGPITLALNSPSFGTASR 244

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVEMLTVETDT-PARVII 260
           +AD IN     RF    A A ++  ++V+ P T  D T  + ++E L V  ++ PA+V+I
Sbjct: 245 VADSIN----QRFGAGTATALNAGVIQVNAPLTAGDRTAFLGQIEALDVSPESPPAKVVI 300

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           + R+GT+V+G NV +    V++GNL+V I    +V QPN   + G T     TD+K   +
Sbjct: 301 DARSGTVVLGQNVTLGACAVAHGNLSVTINTQYEVSQPNPLGA-GQTAVVPKTDVKAKAD 359

Query: 321 KGSFSLIDAP--DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           K +  L+  P   L +++  +N++G   + +I+ILQ +KAAGAL +++
Sbjct: 360 KANL-LMFKPGVTLEAVVRALNAVGAAPNDLIAILQAMKAAGALHAQL 406


>gi|224437362|ref|ZP_03658334.1| flagellar basal body P-ring protein [Helicobacter cinaedi CCUG
           18818]
          Length = 364

 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 224/364 (61%), Gaps = 32/364 (8%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           IAF +  + G+  +  Q +S+I  VV +   RDN L+GYGLV+GL GTGD    S FT Q
Sbjct: 28  IAFWL--MFGISALYGQKISQIAQVVGI---RDNSLVGYGLVIGLNGTGDK-SGSKFTMQ 81

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           S+ ++L+++ +      + SKNVAAVMVTA+LPPFA  G ++D+ ++S+GDA S+ GG L
Sbjct: 82  SIANMLESVNVKLSANDIKSKNVAAVMVTASLPPFARQGDKLDILVSSIGDAKSISGGTL 141

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           VMT L G DGNIYA+AQG++ +      G+S S +      G+I+ GA VERE+     +
Sbjct: 142 VMTPLTGVDGNIYALAQGNITM------GESGSVLS-----GRIIGGASVEREINYNLYN 190

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSE 244
             +  L L++     AI+I   +NS     FS  IA A D+RT+K+ KP N+ +   ++ 
Sbjct: 191 QENATLSLKSSHLQNAIKIQQTLNSV----FSDAIAVAVDARTIKLKKPENLSMVEFLAL 246

Query: 245 VEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           VE + ++     ++II+E+TGTIV G  + I  VVV++G++T++I++ E +  P A    
Sbjct: 247 VEEVEIDYSRKEKIIIDEKTGTIVAGVGISIDPVVVTHGDITIKISD-EILEDPEA---- 301

Query: 305 GSTVTQNNTDLKVSDNKGSFSLIDA--PDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
               T+ + D+ +S ++G+ + ++   P ++S++  +  +G     IISIL+ IK +GAL
Sbjct: 302 ----TKLDNDILMSKSQGTIASVNGTKPTVSSVVKALQKMGATPKNIISILENIKKSGAL 357

Query: 363 QSEI 366
           +++I
Sbjct: 358 RADI 361


>gi|152980624|ref|YP_001353115.1| flagellar basal body P-ring protein [Janthinobacterium sp.
           Marseille]
 gi|151280701|gb|ABR89111.1| FlgI flagellar basal-body P-ring protein [Janthinobacterium sp.
           Marseille]
          Length = 375

 Score =  233 bits (593), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 141/348 (40%), Positives = 211/348 (60%), Gaps = 9/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           R+KD+ S+Q  R NQLIGYGLVVGL G+GD    +PFT QS+ S++Q +G++ P G  + 
Sbjct: 32  RLKDLASVQGVRQNQLIGYGLVVGLDGSGDQTTQTPFTIQSIVSMMQQMGVNLPQGVNMQ 91

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAVMVT +LP FA PG  +D++++S+G+A SLRGG L+MT L GADG IY +AQG+
Sbjct: 92  LKNVAAVMVTTSLPAFAQPGQTLDITVSSMGNAKSLRGGTLLMTPLKGADGQIYGMAQGN 151

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           VVV G+      S         G+I  GA VER +P        ++L+L++ DFSTA R+
Sbjct: 152 VVVGGVGAAANGSKAQINHLGVGRISAGATVERAVPSSLGQGDQIVLELKDSDFSTASRV 211

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVEMLTV-ETDTPARVIIN 261
            D +N     RF    A A D R ++V  P +N +    +  +E + V      A+VI+N
Sbjct: 212 VDAVN----KRFGPDTAAAQDGRVIRVRAPISNDERVSFLGALESINVTPAQVSAKVILN 267

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG++V+   V +    VS+GNL+V I     + QP  F S G TV    + ++++ + 
Sbjct: 268 ARTGSVVMNQAVTLDTCAVSHGNLSVVINTQPVISQPAPF-SGGQTVVAQQSQIEINKDP 326

Query: 322 GSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           G   L+ ++  L  ++  +NSIG     +++ILQ +KA+G+L++E+ I
Sbjct: 327 GKVILLKNSASLADVVKALNSIGATPQDLLAILQAMKASGSLRAELEI 374


>gi|317051356|ref|YP_004112472.1| flagellar P-ring protein [Desulfurispirillum indicum S5]
 gi|316946440|gb|ADU65916.1| flagellar P-ring protein [Desulfurispirillum indicum S5]
          Length = 350

 Score =  233 bits (593), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 141/368 (38%), Positives = 223/368 (60%), Gaps = 32/368 (8%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++  +A   F ++    ++A  V+ +K++ +++  R NQLIGYGLVVGL GTGD  R+  
Sbjct: 10  LLIPLALAAFLMVA--PLNAAPVASLKEIATVEGVRYNQLIGYGLVVGLDGTGDGSRTG- 66

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FT QS+ ++L  +GIS     +   NVAAVMVTA LPPFASPG+RID++++S+G+A SL+
Sbjct: 67  FTNQSLTNMLSRMGISAHPDDINVDNVAAVMVTAMLPPFASPGARIDITVSSMGNADSLQ 126

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIV