BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780376|ref|YP_003064789.1| flagellar basal body P-ring
protein [Candidatus Liberibacter asiaticus str. psy62]
         (369 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|327193037|gb|EGE59949.1| flagellar basal body P-ring protein [Rhizobium etli CNPAF512]
          Length = 522

 Score =  425 bits (1092), Expect = e-117,   Method: Composition-based stats.
 Identities = 236/372 (63%), Positives = 292/372 (78%), Gaps = 4/372 (1%)

Query: 1   MIFRIAFLIFSLIGLHEISAQV---VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLR 57
           ++FR   L   L       A      SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  R
Sbjct: 152 LLFRFLTLAAVLAMSLADVAPAWALTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGFR 211

Query: 58  SSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           SSPFTEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSRIDV+++SLGDA+
Sbjct: 212 SSPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPFASPGSRIDVTVSSLGDAT 271

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SLRGG LVMTSL GADG IYAVAQG+V+VSG   +GQ+++  EG++T G++  GAI+ERE
Sbjct: 272 SLRGGTLVMTSLSGADGQIYAVAQGAVIVSGFQAQGQAATVTEGVTTAGRVPGGAIIERE 331

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           LP +FKDS +L+LQLRNPDFSTAIRIAD +N Y+  RF  P+AEA DS+ V + KP   D
Sbjct: 332 LPSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRTAD 391

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           LTRLM++VE L VETDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++Q
Sbjct: 392 LTRLMADVENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQIIQ 451

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           P  F S G T  Q  TD+      G  ++ID PDL +L++G+N+IG+K DGII+ILQGIK
Sbjct: 452 PEPF-SRGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGIK 510

Query: 358 AAGALQSEIIIQ 369
           +AGALQ+E+++Q
Sbjct: 511 SAGALQAELVLQ 522


>gi|254473496|ref|ZP_05086893.1| flagellar P-ring protein FlgI [Pseudovibrio sp. JE062]
 gi|211957612|gb|EEA92815.1| flagellar P-ring protein FlgI [Pseudovibrio sp. JE062]
          Length = 374

 Score =  419 bits (1077), Expect = e-115,   Method: Composition-based stats.
 Identities = 184/363 (50%), Positives = 258/363 (71%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           +L F  + L   SA  + RIKD+  L+  R NQL+GYG+V+GL G+GD++R+SPFTEQS+
Sbjct: 12  YLAFLALFLSFDSASALVRIKDIADLRGMRSNQLVGYGIVIGLNGSGDTMRNSPFTEQSL 71

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           +S+L+ +G++     L S+NVAAV+VTA LPPF   G+RIDVS+ SLGDA SL+GG L++
Sbjct: 72  QSMLERMGVNVREANLSSRNVAAVVVTAELPPFIGNGARIDVSVGSLGDAKSLQGGTLLV 131

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L+GADGN+YAVAQGSV VSG   +G + S  +G+ T G + NGA++E+ LP  F    
Sbjct: 132 TPLMGADGNVYAVAQGSVSVSGFSAEGDAGSLTQGVPTAGNVPNGALIEKTLPDYFSSMP 191

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVE 246
            L+L+L+NPDF TA+R+ D IN++SLNR+   +A   D R+V+V +P  I   R +S++E
Sbjct: 192 QLVLELKNPDFKTAVRVTDAINAFSLNRYGLKLASELDYRSVQVQRPAGISSVRFISQIE 251

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            L V+ DTPARV+++ERTGT+VIG NVRIS V V++GNLTV+++E  +V QPN F+  G 
Sbjct: 252 GLMVQPDTPARVVVDERTGTVVIGQNVRISTVAVTHGNLTVRVSERPEVSQPNPFAQQGE 311

Query: 307 TVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           T     TD+ +    G   LI   DL +L+ G+N IGLK  GII+ILQ IK AGALQ+ +
Sbjct: 312 TTVVPRTDIDIQQEDGQLQLIGGTDLQTLVRGLNRIGLKPSGIIAILQAIKQAGALQATL 371

Query: 367 IIQ 369
           +++
Sbjct: 372 VVK 374


>gi|146307865|ref|YP_001188330.1| flagellar basal body P-ring protein [Pseudomonas mendocina ymp]
 gi|145576066|gb|ABP85598.1| flagellar P-ring protein [Pseudomonas mendocina ymp]
          Length = 386

 Score =  418 bits (1076), Expect = e-115,   Method: Composition-based stats.
 Identities = 154/368 (41%), Positives = 210/368 (57%), Gaps = 10/368 (2%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
             L   L  L         R+KD+ S+Q  R NQLIGYGLVVGL G+GD    +PFT Q+
Sbjct: 23  LLLATMLACLLLSLPTQAERLKDLASIQGVRSNQLIGYGLVVGLNGSGDQTTQTPFTVQT 82

Query: 66  MRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
             ++L   GI  P G  +  KNVAAV V A LP FA PG  ID++I+S+G+A SLRGG L
Sbjct: 83  FNNMLAQFGIKVPPGGNVQLKNVAAVSVHAELPAFAKPGQTIDITISSIGNAKSLRGGSL 142

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           +MT L G DGN+YA+AQG++VV G    G   S     + + G+I  GA VER +P  F 
Sbjct: 143 LMTPLKGIDGNVYAIAQGNLVVGGFDASGADGSRITVNVPSAGRIPGGATVERPVPSGFD 202

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               L L L  PDF+TA  I DQIN          +A+A D  +++VS P +       +
Sbjct: 203 QGNYLTLNLNRPDFTTAKNIVDQINDL----LGPGVAQAIDGGSIRVSAPLDPNQRVDYL 258

Query: 243 SEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E L V+     A+VIIN RTGTIVIG NVR+    V++G+LTV ITE+  V QP AF
Sbjct: 259 SILENLEVQAGQAVAKVIINSRTGTIVIGQNVRVQPAAVTHGSLTVTITEDPIVSQPEAF 318

Query: 302 SSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            S G T     + +   +  K  F       L+ ++  +N +G     +++IL+ +K AG
Sbjct: 319 -SGGQTAVVPRSRVGAEEETKPMFKFGPGTSLDEIVRAVNQVGAAPSDLMAILEALKQAG 377

Query: 361 ALQSEIII 368
           ALQ+++I+
Sbjct: 378 ALQADLIV 385


>gi|170722887|ref|YP_001750575.1| flagellar basal body P-ring protein [Pseudomonas putida W619]
 gi|169760890|gb|ACA74206.1| flagellar P-ring protein [Pseudomonas putida W619]
          Length = 369

 Score =  414 bits (1065), Expect = e-113,   Method: Composition-based stats.
 Identities = 151/372 (40%), Positives = 218/372 (58%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F +  LI + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MFNVRQLIAATLLLSCAFGAHAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LPPFA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPAGSGNVQLKNVAAVSVHADLPPFAKPGQVVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT L G DGN+YAVAQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGSLLMTPLKGIDGNVYAVAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L  PDF+TA RI D++N          +A+A D  +V+VS P +   
Sbjct: 181 PSGFNQGNTLTLNLNRPDFTTAKRIVDKVNEL----LGPGVAQAVDGGSVRVSAPMDPTQ 236

Query: 238 LTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L ++     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSILENLEIDPGQAVAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QP  FS+  + V   +      + K  F       L+ ++  +N +G     +++IL+ +
Sbjct: 297 QPGPFSNGETAVVPRSRVNAQQEAKPMFKFGPGTTLDEIVRAVNQVGAAPSDLMAILEAL 356

Query: 357 KAAGALQSEIII 368
           K AGALQ+++I+
Sbjct: 357 KQAGALQADLIV 368


>gi|292492367|ref|YP_003527806.1| flagellar P-ring protein [Nitrosococcus halophilus Nc4]
 gi|291580962|gb|ADE15419.1| flagellar P-ring protein [Nitrosococcus halophilus Nc4]
          Length = 367

 Score =  413 bits (1062), Expect = e-113,   Method: Composition-based stats.
 Identities = 148/371 (39%), Positives = 217/371 (58%), Gaps = 10/371 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +I   +F ++ L    A    R+KD+ ++   R NQL+GYGLVVGL GTGD +   P+T
Sbjct: 1   MKITQTLFLVVLLCLSQAAQAERVKDLAAIAGVRSNQLVGYGLVVGLDGTGDQVTQVPYT 60

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+R++L+  GI+ P G     KNVAAV V A LPPFA PG +ID++++SLG+A SLRG
Sbjct: 61  TQSLRNMLREFGINLPPGVNPQPKNVAAVSVHAQLPPFAKPGQQIDITVSSLGNAKSLRG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L++T L GADG +YA+AQG++VV G  ++G   S     + + G+I NGA VER +  
Sbjct: 121 GSLLLTPLKGADGRVYAMAQGNLVVGGFGIEGNDGSRVTVNVPSTGRIPNGATVERHVVN 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F D   ++L L   DF+TA R+A  IN           A   D  +++V+ P       
Sbjct: 181 PFNDGDHIVLNLHTSDFTTANRVAVTINQAI----GAGTARPLDGTSIQVNAPPAPAQRV 236

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L VE  +  A+V+IN RTGT+VIG +VR+  V VS+G+LTV IT N  + QP
Sbjct: 237 SFVSLLENLEVEPGEAAAKVVINSRTGTVVIGQHVRVQPVAVSHGSLTVTITANPAISQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
               S G T     TD++V +     F       L  ++  +N +G     +++IL+ +K
Sbjct: 297 PPL-SGGQTAVVPRTDIEVKEEGSRMFLFAPGVSLGDIVRAVNQVGAAPGDLVAILEALK 355

Query: 358 AAGALQSEIII 368
            A AL++E++I
Sbjct: 356 QADALRAELVI 366


>gi|330502738|ref|YP_004379607.1| flagellar basal body P-ring protein [Pseudomonas mendocina NK-01]
 gi|328917024|gb|AEB57855.1| flagellar basal body P-ring protein [Pseudomonas mendocina NK-01]
          Length = 404

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 151/368 (41%), Positives = 209/368 (56%), Gaps = 10/368 (2%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
             L   L  +         R+KD+ S+Q  R NQLIGYGLVVGL G+GD    +PFT Q+
Sbjct: 41  LLLATMLACMLLSLPTQAERLKDLASIQGVRSNQLIGYGLVVGLNGSGDQTTQTPFTVQT 100

Query: 66  MRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
             ++L   GI  P G  +  KNVAAV V A+LP FA PG  ID++I+S+G+A SLRGG L
Sbjct: 101 FNNMLAQFGIKVPPGGNVQLKNVAAVSVHADLPAFAKPGQTIDITISSIGNAKSLRGGSL 160

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           +MT L G DGN+YA+AQG++VV G    G   S     + + G+I  GA VER +P  F 
Sbjct: 161 LMTPLKGIDGNVYAIAQGNLVVGGFDASGADGSRITVNVPSAGRIPGGATVERPVPSGFD 220

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               L L L  PDF+TA  I DQIN          +A+A D  +++VS P +       +
Sbjct: 221 QGNYLTLNLNRPDFTTAKNIVDQINDL----LGPGVAQAIDGGSIRVSAPLDPNQRVDYL 276

Query: 243 SEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E L VE     A+VIIN RTGTIVIG +V++    V++G+LTV ITE+  V QP A 
Sbjct: 277 SILENLQVEAGKAVAKVIINSRTGTIVIGQDVKVQPAAVTHGSLTVTITEDPIVSQPEAL 336

Query: 302 SSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            S G T     + +      K  F       L+ ++  +N +G     +++IL+ +K AG
Sbjct: 337 -SGGQTAVVPRSRVGAEQEAKPMFKFGPGTSLDEIVRAVNQVGAAPSDLMAILEALKQAG 395

Query: 361 ALQSEIII 368
           ALQ+++I+
Sbjct: 396 ALQADLIV 403


>gi|104782838|ref|YP_609336.1| flagellar basal body P-ring protein [Pseudomonas entomophila L48]
 gi|122402467|sp|Q1I733|FLGI_PSEE4 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|95111825|emb|CAK16549.1| flagellar basal P-ring protein [Pseudomonas entomophila L48]
          Length = 369

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 148/372 (39%), Positives = 217/372 (58%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F    LI + + +         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MFNARRLIAATLLMSCAFGAHAERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LPPFA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPPGSGNVQLKNVAAVSVHADLPPFAKPGQVVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT L G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGSLLMTPLKGIDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L  PDF+TA RI D++N          +A+A D  +V+V+ P +   
Sbjct: 181 PSGFNQGNSLTLNLNRPDFTTAKRIVDKVNEL----LGPGVAQAVDGGSVRVTAPMDPSQ 236

Query: 238 LTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L ++     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSILENLEIDPGQAVAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QP  FS+  + V   +      + K  F       L+ ++  +N +G     +++IL+ +
Sbjct: 297 QPGPFSNGQTAVVPRSRVNAQQEAKPMFKFGPGTTLDEIVRAVNQVGAAPSDLMAILEAL 356

Query: 357 KAAGALQSEIII 368
           K AGALQ+++I+
Sbjct: 357 KQAGALQADLIV 368


>gi|325274794|ref|ZP_08140823.1| flagellar basal body P-ring protein [Pseudomonas sp. TJI-51]
 gi|324100075|gb|EGB97892.1| flagellar basal body P-ring protein [Pseudomonas sp. TJI-51]
          Length = 369

 Score =  411 bits (1058), Expect = e-113,   Method: Composition-based stats.
 Identities = 149/372 (40%), Positives = 217/372 (58%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F +  LI + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MFNVRQLIAATLLLSCACVAQAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LPPFA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPPGSGNVQLKNVAAVSVHADLPPFAKPGQVVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT L G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGSLLMTPLKGIDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L  PDF+TA RI D++N          +A+A D  +V+VS P +   
Sbjct: 181 PSGFNQGNTLTLNLNRPDFTTAKRIVDKVNDL----LGPGVAQAVDGGSVRVSAPMDPSQ 236

Query: 238 LTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L ++     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSVLENLEIDPGQAVAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QP   S+  + V   +      + K  F       L+ ++  +N +G     +++IL+ +
Sbjct: 297 QPGPLSNGQTAVVPRSRVNAEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEAL 356

Query: 357 KAAGALQSEIII 368
           K AGALQ+++I+
Sbjct: 357 KQAGALQADLIV 368


>gi|254780376|ref|YP_003064789.1| flagellar basal body P-ring protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040053|gb|ACT56849.1| flagellar basal body P-ring protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 369

 Score =  411 bits (1058), Expect = e-113,   Method: Composition-based stats.
 Identities = 369/369 (100%), Positives = 369/369 (100%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP
Sbjct: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR
Sbjct: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK
Sbjct: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR
Sbjct: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA
Sbjct: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG
Sbjct: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360

Query: 361 ALQSEIIIQ 369
           ALQSEIIIQ
Sbjct: 361 ALQSEIIIQ 369


>gi|225628627|ref|ZP_03786661.1| Flagellar P-ring protein 1 precursor [Brucella ceti str. Cudo]
 gi|225616473|gb|EEH13521.1| Flagellar P-ring protein 1 precursor [Brucella ceti str. Cudo]
          Length = 457

 Score =  411 bits (1058), Expect = e-113,   Method: Composition-based stats.
 Identities = 184/349 (52%), Positives = 264/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 110 SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 169

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 170 STRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 229

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA
Sbjct: 230 QGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTA 289

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 290 VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 349

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 350 DERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQ 408

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 409 NAKIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 457


>gi|26991072|ref|NP_746497.1| flagellar basal body P-ring protein [Pseudomonas putida KT2440]
 gi|148546711|ref|YP_001266813.1| flagellar basal body P-ring protein [Pseudomonas putida F1]
 gi|38372199|sp|Q88ES0|FLGI_PSEPK RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|24986106|gb|AAN69961.1|AE016634_10 flagellar P-ring protein precursor FlgI [Pseudomonas putida KT2440]
 gi|148510769|gb|ABQ77629.1| flagellar P-ring protein [Pseudomonas putida F1]
 gi|313497766|gb|ADR59132.1| FlgI [Pseudomonas putida BIRD-1]
          Length = 369

 Score =  411 bits (1056), Expect = e-112,   Method: Composition-based stats.
 Identities = 152/372 (40%), Positives = 220/372 (59%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F +  LI + + L    A    R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MFNVRQLIATTLLLSCAFAAQAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LPPFA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPAGSGNVQLKNVAAVSVHADLPPFAKPGQVVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT L G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGSLLMTPLKGIDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L  PDF+TA RI D++N          +A+A D  +V+VS P +   
Sbjct: 181 PSGFNQGNTLTLNLNRPDFTTAKRIVDKVNDL----LGPGVAQAVDGGSVRVSAPMDPSQ 236

Query: 238 LTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L ++     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSILENLEIDPGQAVAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QP AFS+  + V   +      + K  F       L+ ++  +N +G     +++IL+ +
Sbjct: 297 QPGAFSNGQTAVVPRSRVNAEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEAL 356

Query: 357 KAAGALQSEIII 368
           K AGALQ+++I+
Sbjct: 357 KQAGALQADLIV 368


>gi|254785376|ref|YP_003072805.1| flagellar basal body P-ring protein [Teredinibacter turnerae T7901]
 gi|237684687|gb|ACR11951.1| flagellar P-ring protein FlgI [Teredinibacter turnerae T7901]
          Length = 372

 Score =  410 bits (1054), Expect = e-112,   Method: Composition-based stats.
 Identities = 142/368 (38%), Positives = 216/368 (58%), Gaps = 10/368 (2%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
            F +  +      S  V  RIKD+ +++  R NQL+GYGLVVGL G+GD    +PFT QS
Sbjct: 9   LFFLGCICVSFFCSLAVAERIKDITTVEGVRTNQLVGYGLVVGLDGSGDQTNQTPFTTQS 68

Query: 66  MRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
             ++L+  GI+ P G     KNVAAV V A LPPF+ PG  IDV+++S+ +A SLRGG+L
Sbjct: 69  FNTMLKQFGITVPEGAGFQLKNVAAVAVHAELPPFSKPGQAIDVTVSSIANAKSLRGGVL 128

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           ++T L G DG IYAVAQG+++V G   +G   S     + + G++  GA+VER +P  F 
Sbjct: 129 LLTPLKGIDGRIYAVAQGNLIVGGFGAEGQDGSRITVNVPSVGRVPGGAMVERSVPTAFG 188

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
            +  ++  L  PDF+TA R+AD IN          +A   D+ ++ V  P N       +
Sbjct: 189 GNDRIVFNLHTPDFTTAKRVADSINELV----GPGVATPMDAASIAVQAPQNPAHRVDYL 244

Query: 243 SEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E + V     A ++IIN RTGTIV+G +VR++ V V++G+LTV + E  ++ QPN  
Sbjct: 245 SLLENIDVTPGESAAKIIINSRTGTIVVGQHVRVAPVAVTHGSLTVTVREGVEISQPNPL 304

Query: 302 SSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
              G TV   ++ + + +  G  F     P LN ++  +N +G     +++IL+ +K AG
Sbjct: 305 -GEGETVVVPDSAVSIEEKSGPMFEFSPGPTLNDIVRAVNEVGAAPGDLMAILEALKQAG 363

Query: 361 ALQSEIII 368
           AL++EI++
Sbjct: 364 ALKAEIVV 371


>gi|289208118|ref|YP_003460184.1| flagellar P-ring protein [Thioalkalivibrio sp. K90mix]
 gi|288943749|gb|ADC71448.1| flagellar P-ring protein [Thioalkalivibrio sp. K90mix]
          Length = 401

 Score =  410 bits (1053), Expect = e-112,   Method: Composition-based stats.
 Identities = 150/351 (42%), Positives = 219/351 (62%), Gaps = 9/351 (2%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR 81
              R+KDV S+   R+NQL+GYGLVVGL GTGD    +PFT QS+ ++L  LG++   G 
Sbjct: 55  YTERVKDVASVFGVRENQLVGYGLVVGLDGTGDQTTQTPFTIQSLNNMLGQLGLTPDAGN 114

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
              +NVAAVMVTA LPPF+ PG RIDV+++S+G+A+SLRGG L+MT L GADG  Y++AQ
Sbjct: 115 PQLRNVAAVMVTAELPPFSKPGQRIDVTVSSMGNATSLRGGTLLMTPLKGADGQTYSIAQ 174

Query: 142 GSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           G++VV G   +G   S     + + G+I NGA VERE+P  F     + L L  PDF+TA
Sbjct: 175 GNLVVGGFGAEGQDGSRITVNVPSVGRIPNGATVEREVPTAFAQGDHVTLNLNRPDFTTA 234

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETD-TPARV 258
            R+ + +N      F   +A A D  +V+V  P N       ++E+E L +E    PARV
Sbjct: 235 NRLVETVND----TFGPGVAHALDGSSVRVRAPQNPDQRVGFVAELENLPIERGAPPARV 290

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           I+N RTGT+VIG  V+++   VS+G+LTV I+E  QVVQP  F + G T  Q  TD+ + 
Sbjct: 291 IVNSRTGTVVIGSRVQVTPAAVSHGSLTVTISEAPQVVQPMPF-AEGETAVQPQTDIAIQ 349

Query: 319 DNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            +    F       L+ ++  +N++G     +++IL+ ++ AGAL++E+++
Sbjct: 350 QDDSTMFLFDPGTSLDEIVRAVNNVGAAPGDLVAILEALREAGALRAELVV 400


>gi|167034939|ref|YP_001670170.1| flagellar basal body P-ring protein [Pseudomonas putida GB-1]
 gi|166861427|gb|ABY99834.1| flagellar P-ring protein [Pseudomonas putida GB-1]
          Length = 371

 Score =  409 bits (1051), Expect = e-112,   Method: Composition-based stats.
 Identities = 151/372 (40%), Positives = 218/372 (58%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F    LI + + L    A    R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 3   MFNARQLIAATLLLSCAFAAQAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPF 62

Query: 62  TEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SL
Sbjct: 63  TLQTFNNMLSQFGIKVPAGSGNVQLKNVAAVSVHADLPAFAKPGQVVDITVSSIGNSKSL 122

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT L G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 123 RGGSLLMTPLKGIDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAV 182

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L  PDF+TA RI D++N          +A+A D  +V+VS P +   
Sbjct: 183 PSGFNQGNTLTLNLNRPDFTTAKRIVDKVNDL----LGPGVAQAVDGGSVRVSAPMDPSQ 238

Query: 238 LTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L ++     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 239 RVDYLSILENLEIDPGQAVAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 298

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QP AFS+  + V   +      + K  F       L+ ++  +N +G     +++IL+ +
Sbjct: 299 QPGAFSNGQTAVVPRSRVNAEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEAL 358

Query: 357 KAAGALQSEIII 368
           K AGALQ+++I+
Sbjct: 359 KQAGALQADLIV 370


>gi|163844348|ref|YP_001622003.1| flagellar basal body P-ring protein [Brucella suis ATCC 23445]
 gi|163675071|gb|ABY39181.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 444

 Score =  409 bits (1051), Expect = e-112,   Method: Composition-based stats.
 Identities = 184/349 (52%), Positives = 264/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 97  SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 156

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 157 STRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 216

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA
Sbjct: 217 QGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTA 276

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 277 VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 336

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 337 DERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQ 395

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 396 NAKIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 444


>gi|254691410|ref|ZP_05154664.1| flagellar basal body P-ring protein [Brucella abortus bv. 6 str.
           870]
 gi|254695292|ref|ZP_05157120.1| flagellar basal body P-ring protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|256256596|ref|ZP_05462132.1| flagellar basal body P-ring protein [Brucella abortus bv. 9 str.
           C68]
 gi|260757024|ref|ZP_05869372.1| flagellar basal body P-ring protein [Brucella abortus bv. 6 str.
           870]
 gi|260882834|ref|ZP_05894448.1| flagellar basal body P-ring protein [Brucella abortus bv. 9 str.
           C68]
 gi|261215661|ref|ZP_05929942.1| flagellar basal body P-ring protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|297249952|ref|ZP_06933653.1| flagellar P-ring protein precursor FlgI [Brucella abortus bv. 5
           str. B3196]
 gi|260677132|gb|EEX63953.1| flagellar basal body P-ring protein [Brucella abortus bv. 6 str.
           870]
 gi|260872362|gb|EEX79431.1| flagellar basal body P-ring protein [Brucella abortus bv. 9 str.
           C68]
 gi|260917268|gb|EEX84129.1| flagellar basal body P-ring protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|297173821|gb|EFH33185.1| flagellar P-ring protein precursor FlgI [Brucella abortus bv. 5
           str. B3196]
          Length = 444

 Score =  408 bits (1050), Expect = e-112,   Method: Composition-based stats.
 Identities = 184/349 (52%), Positives = 264/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 97  SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 156

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 157 STRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 216

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA
Sbjct: 217 QGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTA 276

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 277 VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 336

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 337 DERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQ 395

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 396 NAKIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 444


>gi|118589979|ref|ZP_01547383.1| flagellar P-ring protein precursor I [Stappia aggregata IAM 12614]
 gi|118437476|gb|EAV44113.1| flagellar P-ring protein precursor I [Stappia aggregata IAM 12614]
          Length = 368

 Score =  408 bits (1050), Expect = e-112,   Method: Composition-based stats.
 Identities = 185/368 (50%), Positives = 264/368 (71%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R+   + + +    +SA  + RIKD+ SLQ  RDNQL+GYGLV+GL+G+GD+LR+SPF
Sbjct: 1   MIRVLVFVLAALLALPVSAMSMVRIKDIASLQGVRDNQLVGYGLVIGLKGSGDTLRNSPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TEQS++S+L +LG++    RL ++NVAAV+VTA +P F   GS IDVS++SLGDA+SL G
Sbjct: 61  TEQSLQSMLDSLGVNVRDARLRTRNVAAVVVTAEMPSFIGQGSTIDVSVSSLGDATSLAG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+ T LLGADG IYAVAQG V VSG    GQ+ S  +GI T G++ NG ++ER+LP K
Sbjct: 121 GTLIATPLLGADGQIYAVAQGPVAVSGFAELGQAESLTQGIPTVGRVPNGGLIERDLPAK 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL 241
           F    +L+L+L NPDF TA+RIAD IN ++  R+   +A+  D RTV ++ P NI +TR 
Sbjct: 181 FSQIPNLVLELSNPDFRTAVRIADAINQFTRERYGIKVAKERDYRTVVLTPPQNISVTRF 240

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           ++E+E + V  D  A+V+I+ERTGT+VIG +V+IS V +++GNLTV+I+E  +V QP+ F
Sbjct: 241 IAEIEAIRVTPDQTAKVVIDERTGTVVIGKDVQISTVAITHGNLTVRISEAPEVSQPSPF 300

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S NG TV    T +   ++ G  +++   DL +L+ G+N IGL+  GII+ILQ IK AGA
Sbjct: 301 SQNGQTVVVPRTYVDAQESGGQLAVVGGTDLPTLVRGLNRIGLRPTGIIAILQAIKTAGA 360

Query: 362 LQSEIIIQ 369
           LQ+E+++Q
Sbjct: 361 LQAELVVQ 368


>gi|23463495|gb|AAN33363.1| flagellar P-ring protein FlgI [Brucella suis 1330]
          Length = 444

 Score =  408 bits (1050), Expect = e-112,   Method: Composition-based stats.
 Identities = 184/349 (52%), Positives = 264/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 97  SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 156

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 157 STRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 216

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA
Sbjct: 217 QGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTA 276

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 277 VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 336

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 337 DERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQ 395

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 396 NAKIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 444


>gi|161620238|ref|YP_001594124.1| flagellar basal body P-ring protein [Brucella canis ATCC 23365]
 gi|225686014|ref|YP_002733986.1| flagellar basal body P-ring protein [Brucella melitensis ATCC
           23457]
 gi|254702578|ref|ZP_05164406.1| flagellar basal body P-ring protein [Brucella suis bv. 3 str. 686]
 gi|254706290|ref|ZP_05168118.1| flagellar basal body P-ring protein [Brucella pinnipedialis
           M163/99/10]
 gi|254711416|ref|ZP_05173227.1| flagellar basal body P-ring protein [Brucella pinnipedialis B2/94]
 gi|254712015|ref|ZP_05173826.1| flagellar basal body P-ring protein [Brucella ceti M644/93/1]
 gi|254715084|ref|ZP_05176895.1| flagellar basal body P-ring protein [Brucella ceti M13/05/1]
 gi|256014944|ref|YP_003104953.1| flagellar P-ring protein precursor [Brucella microti CCM 4915]
 gi|256029954|ref|ZP_05443568.1| flagellar basal body P-ring protein [Brucella pinnipedialis
           M292/94/1]
 gi|256111941|ref|ZP_05452892.1| flagellar basal body P-ring protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158116|ref|ZP_05456034.1| flagellar basal body P-ring protein [Brucella ceti M490/95/1]
 gi|256252930|ref|ZP_05458466.1| flagellar basal body P-ring protein [Brucella ceti B1/94]
 gi|256262863|ref|ZP_05465395.1| flagellar basal body P-ring protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260568514|ref|ZP_05838983.1| flagellar basal body P-ring protein [Brucella suis bv. 4 str. 40]
 gi|261216794|ref|ZP_05931075.1| flagellar basal body P-ring protein [Brucella ceti M13/05/1]
 gi|261220021|ref|ZP_05934302.1| flagellar basal body P-ring protein [Brucella ceti B1/94]
 gi|261313734|ref|ZP_05952931.1| flagellar basal body P-ring protein [Brucella pinnipedialis
           M163/99/10]
 gi|261319024|ref|ZP_05958221.1| flagellar basal body P-ring protein [Brucella pinnipedialis B2/94]
 gi|261319661|ref|ZP_05958858.1| flagellar basal body P-ring protein [Brucella ceti M644/93/1]
 gi|261753158|ref|ZP_05996867.1| flagellar basal body P-ring protein [Brucella suis bv. 3 str. 686]
 gi|265986973|ref|ZP_06099530.1| flagellar basal body P-ring protein [Brucella pinnipedialis
           M292/94/1]
 gi|265993388|ref|ZP_06105945.1| flagellar basal body P-ring protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996633|ref|ZP_06109190.1| flagellar basal body P-ring protein [Brucella ceti M490/95/1]
 gi|161337049|gb|ABX63353.1| Flagellar P-ring protein 1 precursor [Brucella canis ATCC 23365]
 gi|225642119|gb|ACO02032.1| Flagellar P-ring protein 1 precursor [Brucella melitensis ATCC
           23457]
 gi|255997604|gb|ACU49291.1| flagellar P-ring protein precursor [Brucella microti CCM 4915]
 gi|260155179|gb|EEW90260.1| flagellar basal body P-ring protein [Brucella suis bv. 4 str. 40]
 gi|260918605|gb|EEX85258.1| flagellar basal body P-ring protein [Brucella ceti B1/94]
 gi|260921883|gb|EEX88451.1| flagellar basal body P-ring protein [Brucella ceti M13/05/1]
 gi|261292351|gb|EEX95847.1| flagellar basal body P-ring protein [Brucella ceti M644/93/1]
 gi|261298247|gb|EEY01744.1| flagellar basal body P-ring protein [Brucella pinnipedialis B2/94]
 gi|261302760|gb|EEY06257.1| flagellar basal body P-ring protein [Brucella pinnipedialis
           M163/99/10]
 gi|261742911|gb|EEY30837.1| flagellar basal body P-ring protein [Brucella suis bv. 3 str. 686]
 gi|262550930|gb|EEZ07091.1| flagellar basal body P-ring protein [Brucella ceti M490/95/1]
 gi|262764258|gb|EEZ10290.1| flagellar basal body P-ring protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263092698|gb|EEZ16907.1| flagellar basal body P-ring protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264659170|gb|EEZ29431.1| flagellar basal body P-ring protein [Brucella pinnipedialis
           M292/94/1]
 gi|326410337|gb|ADZ67401.1| flagellar basal body P-ring protein [Brucella melitensis M28]
 gi|326553629|gb|ADZ88268.1| flagellar basal body P-ring protein [Brucella melitensis M5-90]
          Length = 444

 Score =  408 bits (1049), Expect = e-112,   Method: Composition-based stats.
 Identities = 184/349 (52%), Positives = 264/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 97  SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 156

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 157 STRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 216

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA
Sbjct: 217 QGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTA 276

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 277 VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 336

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 337 DERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQ 395

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 396 NAKIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 444


>gi|327480024|gb|AEA83334.1| flagellar basal body P-ring protein [Pseudomonas stutzeri DSM 4166]
          Length = 375

 Score =  408 bits (1049), Expect = e-112,   Method: Composition-based stats.
 Identities = 155/355 (43%), Positives = 211/355 (59%), Gaps = 10/355 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           SA    R+KDV ++   R NQLIGYGLVVGL G+GD    +PFT Q+  ++L   GI  P
Sbjct: 25  SAAQAERLKDVATIHGVRSNQLIGYGLVVGLNGSGDQTTQTPFTVQTFNNMLAQFGIKVP 84

Query: 79  -GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
            GG +  KNVAAV + A LPPFA PG  ID++++S+G+A SLRGG L+M  L G DGN+Y
Sbjct: 85  AGGNIQLKNVAAVSIHAELPPFAKPGQTIDITVSSIGNAKSLRGGSLLMAPLKGIDGNVY 144

Query: 138 AVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           AVAQG++VV G    G   S       + G+I  GA VER +P  F     L L L  PD
Sbjct: 145 AVAQGNLVVGGFDASGADGSRITVNSPSAGRIPGGATVERPVPSGFNQGNTLTLNLNRPD 204

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVET-DT 254
           F+TA  I DQIN          +A+A D  ++ V+ P +       +S +E L VE    
Sbjct: 205 FTTAKNIVDQINDL----LGPGVAQALDGGSISVTAPLDPSQRVDYLSILENLEVEVGQA 260

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A+VIIN RTGTIVIG NVR+    V++G+LTV ITE+ QV QP  F S+G TV   N+ 
Sbjct: 261 VAKVIINSRTGTIVIGQNVRVQPAAVTHGSLTVTITEDPQVSQPEPF-SDGQTVVVPNSK 319

Query: 315 LKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +K  +  K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 320 VKAEEEAKPMFKFGPGTTLDEIVRAVNQVGAAPSDLMAILEALKQAGALQADLIV 374


>gi|94500245|ref|ZP_01306778.1| Flagellar basal-body P-ring protein [Oceanobacter sp. RED65]
 gi|94427544|gb|EAT12521.1| Flagellar basal-body P-ring protein [Oceanobacter sp. RED65]
          Length = 361

 Score =  408 bits (1048), Expect = e-112,   Method: Composition-based stats.
 Identities = 158/366 (43%), Positives = 220/366 (60%), Gaps = 13/366 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           +I  L+        +  RIKD+ S+   R NQLIGYGLVVGL G+GD    +PFT QS  
Sbjct: 3   VIILLLTCFMSLTTLADRIKDLTSVAGVRSNQLIGYGLVVGLDGSGDK---APFTNQSFN 59

Query: 68  SLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++++  GIS P G     KNVAAV +TA+LPPFA PG  IDV+++S+G+A SLRGG L+ 
Sbjct: 60  NMMKEFGISVPPGTDPKLKNVAAVSLTASLPPFAKPGQSIDVTVSSIGNAKSLRGGTLLF 119

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           + L GADG +YAVAQG++VV G   +G   SS    + + G+I NGA VER +P  F   
Sbjct: 120 SPLKGADGQVYAVAQGNLVVGGFGAEGNDGSSITVNVPSVGRIPNGATVERPVPNAFARG 179

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSE 244
             LIL L  PDF+TA R+AD IN           A A D+ +V+VS P +       +S 
Sbjct: 180 DSLILNLDRPDFTTAKRMADTINDL----LGPETAYAQDATSVRVSAPRDPNQRVSFLSL 235

Query: 245 VEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           +E LTV   +  A+VIIN RTGTIVIG +V+I  V V++G+LTV + EN +V QPNA  +
Sbjct: 236 IENLTVTPGEATAKVIINSRTGTIVIGKHVKIDPVAVTHGSLTVTVKENIEVNQPNAL-A 294

Query: 304 NGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G T    N D+ + +     F       L+ ++  +N +G     +++IL+ +K AGAL
Sbjct: 295 GGETAVVPNADVNIDEEGNPMFVFDPGVSLDEIVKAVNEVGAAPGDLMAILEALKQAGAL 354

Query: 363 QSEIII 368
            +E+I+
Sbjct: 355 NAELIV 360


>gi|220934398|ref|YP_002513297.1| flagellar P-ring protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995708|gb|ACL72310.1| flagellar P-ring protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 380

 Score =  406 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 150/368 (40%), Positives = 222/368 (60%), Gaps = 10/368 (2%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
             L   +       A+   R+KD+ S+   R NQL+GYGLVVGL G+GD    +PFT QS
Sbjct: 17  LCLALVIAPQFTAPAKAYERVKDLASVAGVRSNQLVGYGLVVGLDGSGDQTTQAPFTVQS 76

Query: 66  MRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           ++++L  LG++ P       +NVAAVM+ A+LPPFA PG  IDV+++S+G+ASSLRGG L
Sbjct: 77  LKNMLGQLGVTVPPNVNPQLRNVAAVMIHADLPPFAKPGQMIDVTVSSIGNASSLRGGSL 136

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           +MT L GADG  YA+AQG++VV G   +G   S     + + G+I NGA VERE+P  F 
Sbjct: 137 LMTPLKGADGQTYAIAQGNLVVGGFGAEGRDGSRISVNVPSVGRIPNGASVEREVPTAFA 196

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               ++L L  PDF+TA R++D IN           A A D  +V+VS P +       +
Sbjct: 197 QGDSVMLNLHQPDFTTANRLSDVIND----TMGPGTARAVDGSSVRVSAPIDPGQRVAFV 252

Query: 243 SEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E LTV    PA +VI+N RTGT+VIG NV++    V++G+LTV ITE+  V QP   
Sbjct: 253 SMLENLTVRPGAPAAKVIVNSRTGTVVIGSNVQVMPAAVTHGSLTVTITESFDVSQPAPL 312

Query: 302 SSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           ++ G TV    TD++V++     F       L+ ++  +N +G     +++IL+ ++ AG
Sbjct: 313 AA-GETVVTPRTDIEVTEQVNPMFLFGPGVTLDEIVRAVNQVGAAPGDLVAILEALRQAG 371

Query: 361 ALQSEIII 368
           AL++++I+
Sbjct: 372 ALRAQLIV 379


>gi|49086284|gb|AAT51341.1| PA1084 [synthetic construct]
          Length = 370

 Score =  406 bits (1044), Expect = e-111,   Method: Composition-based stats.
 Identities = 151/350 (43%), Positives = 210/350 (60%), Gaps = 9/350 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--R 81
            R+KD+ S+Q  R NQLIGYGLVVGL G+GD    +PFT Q+  ++L   GI  P     
Sbjct: 23  ERLKDIASIQGVRTNQLIGYGLVVGLSGSGDQTTQTPFTLQTFNNMLAQFGIKVPANVGN 82

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
           +  KNVAAV V A+LPPFA PG  IDV+++S+G+A SLRGG L+MT L G DG +YAVAQ
Sbjct: 83  VQLKNVAAVSVHADLPPFAKPGQPIDVTVSSIGNAKSLRGGSLLMTPLKGIDGQVYAVAQ 142

Query: 142 GSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           G++VV G   +G   S     + + G+I  GA VER +P  F     L L L  PDF+TA
Sbjct: 143 GNLVVGGFDAEGRDGSKITVNVPSAGRIPAGATVERAVPSGFDQGNSLTLNLNRPDFTTA 202

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVET-DTPARV 258
            RI D+IN          +A A D  +V+VS P +       +S +E L V+  +  A+V
Sbjct: 203 KRIVDRINEL----LGPGVAHAVDGGSVRVSAPLDPNQRVDYLSILENLDVQPGEAVAKV 258

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           IIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP AFS+  + V   +      
Sbjct: 259 IINSRTGTIVIGQNVKVSPAAVTHGSLTVSITEDPTVSQPGAFSNGQTAVVPRSRVNAEE 318

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 319 ETKPMFKFGPGTTLDDIVRAVNQVGAAPSDLMAILEALKQAGALQADLIV 368


>gi|15596281|ref|NP_249775.1| flagellar basal body P-ring protein [Pseudomonas aeruginosa PAO1]
 gi|107100529|ref|ZP_01364447.1| hypothetical protein PaerPA_01001554 [Pseudomonas aeruginosa PACS2]
 gi|116049013|ref|YP_792185.1| flagellar basal body P-ring protein [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152988391|ref|YP_001349646.1| flagellar basal body P-ring protein [Pseudomonas aeruginosa PA7]
 gi|218892952|ref|YP_002441821.1| flagellar basal body P-ring protein [Pseudomonas aeruginosa LESB58]
 gi|254234220|ref|ZP_04927543.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           C3719]
 gi|254239442|ref|ZP_04932764.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           2192]
 gi|296390552|ref|ZP_06880027.1| flagellar basal body P-ring protein [Pseudomonas aeruginosa PAb1]
 gi|313106039|ref|ZP_07792298.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           39016]
 gi|14548040|sp|Q9I4P5|FLGI_PSEAE RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|122258121|sp|Q02IQ1|FLGI_PSEAB RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|166988332|sp|A6V9B1|FLGI_PSEA7 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|226701952|sp|B7UXA5|FLGI_PSEA8 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|9947000|gb|AAG04473.1|AE004539_15 flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           PAO1]
 gi|115584234|gb|ABJ10249.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166151|gb|EAZ51662.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           C3719]
 gi|126192820|gb|EAZ56883.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           2192]
 gi|150963549|gb|ABR85574.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           PA7]
 gi|218773180|emb|CAW28992.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           LESB58]
 gi|310878800|gb|EFQ37394.1| flagellar P-ring protein precursor FlgI [Pseudomonas aeruginosa
           39016]
          Length = 369

 Score =  406 bits (1044), Expect = e-111,   Method: Composition-based stats.
 Identities = 151/350 (43%), Positives = 210/350 (60%), Gaps = 9/350 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--R 81
            R+KD+ S+Q  R NQLIGYGLVVGL G+GD    +PFT Q+  ++L   GI  P     
Sbjct: 23  ERLKDIASIQGVRTNQLIGYGLVVGLSGSGDQTTQTPFTLQTFNNMLAQFGIKVPANVGN 82

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
           +  KNVAAV V A+LPPFA PG  IDV+++S+G+A SLRGG L+MT L G DG +YAVAQ
Sbjct: 83  VQLKNVAAVSVHADLPPFAKPGQPIDVTVSSIGNAKSLRGGSLLMTPLKGIDGQVYAVAQ 142

Query: 142 GSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           G++VV G   +G   S     + + G+I  GA VER +P  F     L L L  PDF+TA
Sbjct: 143 GNLVVGGFDAEGRDGSKITVNVPSAGRIPAGATVERAVPSGFDQGNSLTLNLNRPDFTTA 202

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVET-DTPARV 258
            RI D+IN          +A A D  +V+VS P +       +S +E L V+  +  A+V
Sbjct: 203 KRIVDRINEL----LGPGVAHAVDGGSVRVSAPLDPNQRVDYLSILENLDVQPGEAVAKV 258

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           IIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP AFS+  + V   +      
Sbjct: 259 IINSRTGTIVIGQNVKVSPAAVTHGSLTVSITEDPIVSQPGAFSNGQTAVVPRSRVNAEE 318

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 319 ETKPMFKFGPGTTLDDIVRAVNQVGAAPSDLMAILEALKQAGALQADLIV 368


>gi|260564305|ref|ZP_05834790.1| flagellar basal body P-ring protein [Brucella melitensis bv. 1 str.
           16M]
 gi|260151948|gb|EEW87041.1| flagellar basal body P-ring protein [Brucella melitensis bv. 1 str.
           16M]
          Length = 413

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 184/349 (52%), Positives = 264/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 66  SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 125

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 126 STRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 185

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA
Sbjct: 186 QGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTA 245

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 246 VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 305

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 306 DERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQ 364

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 365 NAKIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 413


>gi|90418390|ref|ZP_01226302.1| flagellar P-ring protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90338062|gb|EAS51713.1| flagellar P-ring protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 363

 Score =  405 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 181/353 (51%), Positives = 252/353 (71%), Gaps = 1/353 (0%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
             SA+   RIKD+V ++  R NQL+GYGLV+GLQGTGDS+R+SPFTEQSM+S+L  +G++
Sbjct: 12  AASARGSVRIKDIVDIRGVRANQLVGYGLVIGLQGTGDSMRNSPFTEQSMQSMLDRMGVN 71

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
                  SKNVAAV VT+ LP F   GSRIDV+++SLGDA+SL GG L+MT L GADG I
Sbjct: 72  IRSQNSRSKNVAAVTVTSELPAFIGTGSRIDVTVSSLGDATSLMGGTLMMTPLYGADGEI 131

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAVAQGS+ VSG   +G S    +G+ T G++ NGA+VERE+P  F D   L ++LRNPD
Sbjct: 132 YAVAQGSLAVSGFASEGDSEKLTQGVPTTGRVPNGALVEREVPGGFNDDGKLAIELRNPD 191

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPA 256
           F T+IR+ D IN Y+ +R+ +P+A   D RTV + +P+ +  TR ++E+  L +  D PA
Sbjct: 192 FRTSIRVVDVINDYARSRWGQPVAREEDFRTVHLKRPSEVSSTRFIAEIGELRIAPDQPA 251

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV+I+ERTGT++IG +V+IS V V++GNLTV+I+E   V QP    S+G TV  + T + 
Sbjct: 252 RVVIDERTGTVIIGKDVQISLVAVTHGNLTVRISEMPSVSQPAPL-SDGQTVVTSETIID 310

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
             ++ G+F+ +   DL +++ G+N IGLK  GII+ILQ IK AGALQ+E+++Q
Sbjct: 311 AREDGGNFAFVGGADLETVVRGLNRIGLKPTGIIAILQAIKTAGALQAELVVQ 363


>gi|256043075|ref|ZP_05446019.1| flagellar basal body P-ring protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265989513|ref|ZP_06102070.1| flagellar basal body P-ring protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263000182|gb|EEZ12872.1| flagellar basal body P-ring protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 405

 Score =  405 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 184/349 (52%), Positives = 264/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 58  SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 117

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 118 STRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 177

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA
Sbjct: 178 QGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTA 237

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 238 VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 297

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 298 DERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQ 356

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 357 NAKIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 405


>gi|319405403|emb|CBI79022.1| Flagellar P-ring protein 2 [Bartonella sp. AR 15-3]
          Length = 406

 Score =  405 bits (1040), Expect = e-111,   Method: Composition-based stats.
 Identities = 178/353 (50%), Positives = 259/353 (73%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
              +  V+R+KD+  +Q  R NQL+GYGLV+GL GTGDSLR++PFTEQSMR++L NLGIS
Sbjct: 54  LARSSAVARLKDIAVVQGVRSNQLVGYGLVIGLNGTGDSLRNAPFTEQSMRAMLDNLGIS 113

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
            P G     N+AAV+VTA + PFA+PGSRIDV+++SLGDA+SL+GG LVMT LLGADG  
Sbjct: 114 PPAGASRVNNIAAVIVTAEMMPFATPGSRIDVTVSSLGDATSLQGGTLVMTPLLGADGKT 173

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAVAQG++V+SG   KG + S  +G+ T G+I NGA+VER++   F  S ++I++LRN D
Sbjct: 174 YAVAQGNMVISGFAAKGAAESVTQGVPTSGRIPNGALVERKVDGNFNHSNEIIIELRNSD 233

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPA 256
           FSTA+R++D IN ++  R+ + +A   D++T+ ++KP NI + R ++E+E L + TD  A
Sbjct: 234 FSTAVRMSDLINIFANKRYKQSVARERDAKTIVLNKPRNISVARFIAEIEGLPIPTDEIA 293

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV+++ERTGT+VIG+ VR+S+V +S+G+LTV++TE   V QPN FS  G T+    T + 
Sbjct: 294 RVVVDERTGTVVIGEKVRVSRVAISHGSLTVRVTEEPSVSQPNPFSETGDTIVVPRTSID 353

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           V  +  +  ++   DL+SL+ G+N IG+K   II++LQ IK +GAL +E+++Q
Sbjct: 354 VDQSLSNIGILSGVDLDSLVKGLNQIGVKPTAIIAVLQAIKTSGALHAELVVQ 406


>gi|319403963|emb|CBI77551.1| Flagellar P-ring protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 408

 Score =  404 bits (1038), Expect = e-110,   Method: Composition-based stats.
 Identities = 177/353 (50%), Positives = 259/353 (73%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
              +  V+R+KD+  +Q  R NQL+GYGLV+GL GTGDSLR++PFTEQSMR++L NLGIS
Sbjct: 56  LARSSAVARLKDIAIIQGVRSNQLVGYGLVIGLNGTGDSLRNAPFTEQSMRAMLDNLGIS 115

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
            P G     N+AAV+VTA + PFA+PGSRIDV+++SLGDA+SL+GG LVMT LLGADG  
Sbjct: 116 PPAGASRVNNIAAVIVTAEMMPFATPGSRIDVTVSSLGDATSLQGGTLVMTPLLGADGKT 175

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAVAQG++V+SG   KG + S  +G+ T G+I NGA+VER++   F  S ++I++LRN D
Sbjct: 176 YAVAQGNMVISGFGAKGAAESVTQGVPTSGRIPNGALVERKIDGNFNHSNEIIIELRNSD 235

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPA 256
           FSTA+R++D IN ++  R+ + +A   D++T+ ++KP NI + R ++++E L + TD  A
Sbjct: 236 FSTAVRMSDLINIFANKRYKQSVARERDAKTIVLNKPRNISIARFIADIEGLPIPTDEVA 295

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV+++ERTGT+VIG+ VR+S+V +S+G+LTV++TE   V QPN FS  G T+    T + 
Sbjct: 296 RVVVDERTGTVVIGEKVRVSRVAISHGSLTVRVTEEPSVSQPNPFSETGDTIVVPRTSID 355

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           V     +  +++  DL+SL+ G+N IG+K   II++LQ IK +GAL +E+++Q
Sbjct: 356 VDQPLSNIGILNGVDLDSLVKGLNQIGVKPTAIIAVLQAIKTSGALHAELVVQ 408


>gi|300114795|ref|YP_003761370.1| flagellar P-ring protein [Nitrosococcus watsonii C-113]
 gi|299540732|gb|ADJ29049.1| flagellar P-ring protein [Nitrosococcus watsonii C-113]
          Length = 367

 Score =  404 bits (1038), Expect = e-110,   Method: Composition-based stats.
 Identities = 144/371 (38%), Positives = 209/371 (56%), Gaps = 10/371 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +I    F +  L         R+KD+ ++   R NQL+GYGLVVGL GTGD +    +T
Sbjct: 1   MKIIQTFFIMTLLWLSQGAQAERVKDLAAIAGVRSNQLVGYGLVVGLSGTGDQVTQISYT 60

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+R++L+  GI  P G  L  KNVAAV + A LPPFA PG  ID++++SLG+A SLRG
Sbjct: 61  RQSLRNMLREFGIIMPPGVNLQPKNVAAVSIHAQLPPFAKPGQSIDITVSSLGNAKSLRG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L++T L GADG +YA+AQG+++V G   +G   S     I + G+I NGA VER +P 
Sbjct: 121 GSLLLTPLKGADGQVYAMAQGNLIVGGFGAEGNDGSRVTVNIPSTGRIPNGATVERGVPN 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F +   +IL L   DF+TA R+A  INS          A   D  +++V+ P       
Sbjct: 181 PFHNGGPIILNLHASDFTTANRVAAAINSAI----GAGTARPLDGTSIQVNAPALPTQRV 236

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L V   + PA+++IN RTGT+VIG +VR+    VS+G LTV IT N  + QP
Sbjct: 237 SFVSLLENLEVAPGEAPAKIVINSRTGTVVIGQHVRVQPAAVSHGRLTVTITSNPAISQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
               S G T     TD+ + +     F       L  ++  +N +G     +++IL+ +K
Sbjct: 297 PPL-SGGQTAVVPRTDIDIQEEGSRMFLFAPGVSLGEIVRAVNQVGAAPGDLVAILEALK 355

Query: 358 AAGALQSEIII 368
             GAL +E+++
Sbjct: 356 QVGALSAELVV 366


>gi|170741838|ref|YP_001770493.1| flagellar basal body P-ring protein [Methylobacterium sp. 4-46]
 gi|168196112|gb|ACA18059.1| flagellar P-ring protein [Methylobacterium sp. 4-46]
          Length = 370

 Score =  403 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 180/346 (52%), Positives = 256/346 (73%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           +RIKD+ +LQ  RDNQL+GYGLV GLQGTGD+LR++ FTEQS++S+L  +G++    RL 
Sbjct: 25  TRIKDIAALQGVRDNQLVGYGLVTGLQGTGDTLRNAQFTEQSLQSMLDRMGVNVRDSRLR 84

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           ++NVAAVMVTA+LPP+A+ GSRIDV++ SLGDA+SL+GG L+MT L G DG +YA AQG 
Sbjct: 85  TRNVAAVMVTADLPPYATVGSRIDVTVTSLGDATSLKGGTLLMTPLSGGDGQVYAAAQGP 144

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + VSG  V GQ+ +  +G+ T G+I NGA++ER++P   +D   L+L+L+NPDF TA  I
Sbjct: 145 MAVSGFSVGGQAETVTQGVPTAGRIPNGALIERQVPGSLQDLPQLVLELKNPDFKTATLI 204

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
            D +N+Y+L RF R +A   D R+V + KP  I  TR ++EV  LT++ DTPARV++++R
Sbjct: 205 VDAVNAYALQRFGRRVAIPRDQRSVVLHKPPAIAQTRFIAEVGDLTIQPDTPARVVVDQR 264

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
           TGT+VIG NV+IS V V++GNLTV++TE  +V QPN  S NG TV    T++   + +G 
Sbjct: 265 TGTVVIGRNVQISTVAVTHGNLTVRVTETPEVSQPNPSSRNGQTVVVPRTEVSAQEQQGR 324

Query: 324 FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            +++   DL +L+ G+N +GLK   II+ILQ +K AGALQ+E+++Q
Sbjct: 325 LAVLGGSDLQTLVKGLNQVGLKPSDIIAILQAVKTAGALQAELVVQ 370


>gi|114706773|ref|ZP_01439673.1| flagellar P-ring protein precursor I [Fulvimarina pelagi HTCC2506]
 gi|114537721|gb|EAU40845.1| flagellar P-ring protein precursor I [Fulvimarina pelagi HTCC2506]
          Length = 399

 Score =  403 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 180/351 (51%), Positives = 246/351 (70%), Gaps = 1/351 (0%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
            A    RIKD+ +++  R NQL+GYGLV+GLQGTGDS+R+SP+TEQS++S+L  +G++  
Sbjct: 50  GAAGTVRIKDITNVRGVRGNQLVGYGLVIGLQGTGDSMRNSPYTEQSLQSMLDRMGVNIR 109

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
             R G KNVAAV VTA LP F   GSRIDV++ SLGDA+SL GG LVMT L GADG IYA
Sbjct: 110 SDRAGGKNVAAVTVTAELPAFIGTGSRIDVNVASLGDATSLMGGTLVMTPLYGADGEIYA 169

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           VAQG V VSG   +G S    +G+ T G++ NGA VERE+P  F D   L ++L NPDF 
Sbjct: 170 VAQGPVAVSGFTSEGASERLTQGVPTAGRVPNGAFVEREVPGHFYDDGQLSMELSNPDFK 229

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARV 258
           T +R  D IN+Y+ NR+ RP+A   D RT+ + +P N+   R ++E+  L V+ D  A+V
Sbjct: 230 TMVRTVDLINAYARNRWGRPVAREEDFRTLHLDRPANVSAVRFLAEIGDLRVDPDQVAKV 289

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           +I+ERTGTIVIG NV+IS V +++GNLTV+++E   V QP  F S+G TV  + T +  +
Sbjct: 290 VIDERTGTIVIGQNVQISTVALTHGNLTVRVSELPAVSQPAPF-SDGETVVTSETIVDTN 348

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           +  G+F+ +   DL +++ G+N IGLK  GII+ILQ IK AGALQ+E+++Q
Sbjct: 349 ETGGNFAFVGGTDLETVVRGLNRIGLKPSGIIAILQAIKTAGALQAELVVQ 399


>gi|254501956|ref|ZP_05114107.1| flagellar P-ring protein FlgI [Labrenzia alexandrii DFL-11]
 gi|222438027|gb|EEE44706.1| flagellar P-ring protein FlgI [Labrenzia alexandrii DFL-11]
          Length = 362

 Score =  403 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 183/363 (50%), Positives = 253/363 (69%), Gaps = 1/363 (0%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
             I  L  L  + A  + RIKD+ +LQ  RDNQL+GYGLV+GL+G+GD+LR+SPFTEQS+
Sbjct: 1   MFICLLAVLTAVPATAMVRIKDIATLQGVRDNQLVGYGLVIGLKGSGDTLRNSPFTEQSL 60

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           +S+L +LG++    RL ++NVAAV+VTA +P F   GS ID+S++SLGDA+SL GG LV 
Sbjct: 61  QSMLDSLGVNVRDTRLRTRNVAAVVVTAEMPSFIGKGSSIDISVSSLGDATSLAGGTLVA 120

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T LLGADG IYAVAQG V VSG    G + S  +GI T G+I NG ++ER LP KF    
Sbjct: 121 TPLLGADGQIYAVAQGPVAVSGFAELGAAESLTQGIPTVGRIPNGGLIERNLPAKFSQIP 180

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVE 246
           DL+L+L NPDF TA+RI D IN Y+  R+   +A+  D R+V ++ P  + LTR ++E+E
Sbjct: 181 DLVLELSNPDFKTAVRITDAINRYTRERYGVRVAKERDYRSVDLTPPPKVSLTRFIAEIE 240

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            + V  D  A+V+I+ERTGT+VIG +V+IS V +++GNLTV+I+E  +V QP  F S G 
Sbjct: 241 SIRVRPDQSAKVVIDERTGTVVIGKDVQISTVAITHGNLTVRISEAPEVSQPAPF-SQGE 299

Query: 307 TVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           TV    T +   +  G  +++   DL +L+ G+N IGL+  GII+ILQ IK AGALQ+E+
Sbjct: 300 TVVVPRTYVDAQETGGRLAVVGGTDLPTLVRGLNRIGLRPTGIIAILQAIKTAGALQAEL 359

Query: 367 IIQ 369
           ++Q
Sbjct: 360 VVQ 362


>gi|319406978|emb|CBI80615.1| Flagellar P-ring protein 2 [Bartonella sp. 1-1C]
          Length = 408

 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 176/353 (49%), Positives = 260/353 (73%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
              +  V+R+KD+  +Q  R NQL+GYGLV+GL GTGDSLR++PFTEQSMR++L NLGI+
Sbjct: 56  LARSSAVARLKDIAIVQGVRSNQLVGYGLVIGLNGTGDSLRNAPFTEQSMRAMLDNLGIN 115

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
            P G     N+AAV+VTA + PFA+PGSRIDV+++SLGDA+SL+GG LVMT LLGADG  
Sbjct: 116 PPAGASRVNNIAAVIVTAEMMPFATPGSRIDVTVSSLGDATSLQGGTLVMTPLLGADGKT 175

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAVAQG++V+SG   KG + S  +G+ T G+I NGA+VER++   F  S ++I++LRN D
Sbjct: 176 YAVAQGNMVISGFGAKGTAESVTQGVPTSGRIPNGALVERKVDGNFNHSNEIIIELRNSD 235

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPA 256
           FSTA+R++D IN ++  R+ + +A   D++T+ ++KP NI ++R ++++E L + TD  A
Sbjct: 236 FSTAVRMSDLINIFANKRYKQSVARERDAKTIVLNKPRNISVSRFIADIEGLPIPTDEVA 295

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV+++ERTGT+VIG+ VR+S+V +S+G+LTV++TE   V QPN FS  G T+    T + 
Sbjct: 296 RVVVDERTGTVVIGEKVRVSRVAISHGSLTVRVTEEPSVSQPNPFSETGDTIVVPRTSID 355

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           V  +  +  ++   DL+SL+ G+N IG+K   II++LQ IK +GAL +E+++Q
Sbjct: 356 VDQSLSNIGILSGVDLDSLVKGLNQIGVKPTAIIAVLQAIKTSGALHAELVVQ 408


>gi|71735315|ref|YP_275557.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257484942|ref|ZP_05638983.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289627768|ref|ZP_06460722.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651641|ref|ZP_06482984.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|115311528|sp|Q48GC6|FLGI_PSE14 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|49205096|dbj|BAC75960.2| flagellar P-ring protein FlgI [Pseudomonas syringae pv. tabaci]
 gi|71555868|gb|AAZ35079.1| flagellar P-ring protein FlgI [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320325098|gb|EFW81167.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329357|gb|EFW85350.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330866427|gb|EGH01136.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330880531|gb|EGH14680.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330889078|gb|EGH21739.1| flagellar basal body P-ring protein [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330972418|gb|EGH72484.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           aceris str. M302273PT]
 gi|330986473|gb|EGH84576.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011047|gb|EGH91103.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 369

 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 147/373 (39%), Positives = 214/373 (57%), Gaps = 11/373 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++  LI + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MIKLKQLIAATLLLSTAFGVHAERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPSGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT + G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGALLMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L   DF+TA RI D+IN          +A+A D  +V+V+ P +   
Sbjct: 181 PSGFNQGNTLTLNLNRSDFTTAKRIVDKINEL----LGPGVAQALDGGSVRVTAPLDPGQ 236

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L V+     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP A  S G T     + +         F       L+ ++  +N +G     +++IL+ 
Sbjct: 297 QPGAL-SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEA 355

Query: 356 IKAAGALQSEIII 368
           +K AGALQ+++I+
Sbjct: 356 LKQAGALQADLIV 368


>gi|330808199|ref|YP_004352661.1| flagellar P-ring protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376307|gb|AEA67657.1| flagellar P-ring protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 371

 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 142/371 (38%), Positives = 214/371 (57%), Gaps = 9/371 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             +  L+   + +         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT
Sbjct: 4   LNLKQLLIGALVMSAAFTAQAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPFT 63

Query: 63  EQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
            Q+  ++L   GI  P G   +  KNVAAV ++A+LP FA PG ++D++++S+G++ SLR
Sbjct: 64  LQTFNNMLSQFGIKVPAGSGNVQLKNVAAVSISADLPAFAKPGQQVDITVSSIGNSKSLR 123

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +P
Sbjct: 124 GGTLLLTPLKGIDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAVP 183

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     L L L   DF+TA RI D+IN          +A+A D  +++V+ P +    
Sbjct: 184 SGFNQGNSLTLNLNRSDFTTAKRIVDKINDM----LGPGVAQALDGGSIRVTAPLDPSQR 239

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S +E L V+     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V Q
Sbjct: 240 VDYLSILENLEVDPGQAVAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQ 299

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           P   S+  + V   +      + K  F       L+ ++  +N +G     +++IL+ +K
Sbjct: 300 PGPLSNGQTAVVPRSRVNAEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALK 359

Query: 358 AAGALQSEIII 368
            AGALQ+++I+
Sbjct: 360 QAGALQADLIV 370


>gi|28869146|ref|NP_791765.1| flagellar P-ring protein FlgI [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213967577|ref|ZP_03395725.1| flagellar P-ring protein FlgI [Pseudomonas syringae pv. tomato T1]
 gi|301385718|ref|ZP_07234136.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           tomato Max13]
 gi|302060069|ref|ZP_07251610.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           tomato K40]
 gi|302134828|ref|ZP_07260818.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|38372194|sp|Q884Z4|FLGI_PSESM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|28852386|gb|AAO55460.1| flagellar P-ring protein FlgI [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213927878|gb|EEB61425.1| flagellar P-ring protein FlgI [Pseudomonas syringae pv. tomato T1]
 gi|331017020|gb|EGH97076.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 369

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 146/373 (39%), Positives = 214/373 (57%), Gaps = 11/373 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++  LI + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MIKLKQLIAATLLLSAAFGAHAERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT + G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGALLMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L   DF+TA R+ D+IN          +A+A D  +V+V+ P +   
Sbjct: 181 PSGFNQGNTLTLNLNRSDFTTAKRVVDKINEL----LGPGVAQALDGGSVRVTAPLDPGQ 236

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L V+     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP A  S G T     + +         F       L+ ++  +N +G     +++IL+ 
Sbjct: 297 QPGAL-SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEA 355

Query: 356 IKAAGALQSEIII 368
           +K AGALQ+++I+
Sbjct: 356 LKQAGALQADLIV 368


>gi|66046702|ref|YP_236543.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           syringae B728a]
 gi|75501291|sp|Q4ZQR7|FLGI_PSEU2 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|63257409|gb|AAY38505.1| Flagellar P-ring protein [Pseudomonas syringae pv. syringae B728a]
          Length = 369

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 147/373 (39%), Positives = 214/373 (57%), Gaps = 11/373 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++  LI + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MIKLKQLIAATLLLSTAFGVHAERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT + G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGALLMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L   DF+TA RI D+IN          +A+A D  +V+V+ P +   
Sbjct: 181 PSGFNQGNTLTLNLNRSDFTTAKRIVDKINEL----LGPGVAQALDGGSVRVTAPLDPGQ 236

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L V+     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP A  S G T     + +         F       L+ ++  +N +G     +++IL+ 
Sbjct: 297 QPGAL-SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEA 355

Query: 356 IKAAGALQSEIII 368
           +K AGALQ+++I+
Sbjct: 356 LKQAGALQADLIV 368


>gi|77457731|ref|YP_347236.1| flagellar basal body P-ring protein [Pseudomonas fluorescens Pf0-1]
 gi|115311639|sp|Q3KG59|FLGI_PSEPF RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|77381734|gb|ABA73247.1| flagellar P-ring protein precuror [Pseudomonas fluorescens Pf0-1]
          Length = 362

 Score =  402 bits (1034), Expect = e-110,   Method: Composition-based stats.
 Identities = 142/353 (40%), Positives = 209/353 (59%), Gaps = 9/353 (2%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
               R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+  ++L   GI  P G
Sbjct: 13  AHAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPFTLQTFNNMLSQFGIKVPPG 72

Query: 81  --RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
              +  KNVAAV V+A+LP FA PG ++D++++S+G++ SLRGG L++T L G DGN+YA
Sbjct: 73  SGNVQLKNVAAVSVSADLPAFAKPGQQVDITVSSIGNSKSLRGGTLLLTPLKGIDGNVYA 132

Query: 139 VAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           +AQG++VV G   +G   S     + + G+I  GA VER +P  F     L L L   DF
Sbjct: 133 IAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERSVPSGFNQGNSLTLNLNRSDF 192

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETD-TP 255
           +TA RI D+IN          +A+A D  +++V+ P +       +S +E L V+     
Sbjct: 193 TTAKRIVDKINDM----LGPGVAQAIDGGSIRVTAPLDPSQRVDYLSILENLEVDPGQAV 248

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP   S+  + V   +   
Sbjct: 249 AKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGPLSNGQTAVVPRSRVN 308

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 309 AEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGALQADLIV 361


>gi|330875988|gb|EGH10137.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 369

 Score =  402 bits (1034), Expect = e-110,   Method: Composition-based stats.
 Identities = 146/373 (39%), Positives = 214/373 (57%), Gaps = 11/373 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++  LI + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MIKLKQLIAATLLLSAAFGAHAERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT + G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGALLMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L   DF+TA R+ D+IN          +A+A D  +V+V+ P +   
Sbjct: 181 PSGFNQGNTLTLNLNRSDFTTAKRVVDKINDL----LGPGVAQALDGGSVRVTAPLDPGQ 236

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L V+     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP A  S G T     + +         F       L+ ++  +N +G     +++IL+ 
Sbjct: 297 QPGAL-SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEA 355

Query: 356 IKAAGALQSEIII 368
           +K AGALQ+++I+
Sbjct: 356 LKQAGALQADLIV 368


>gi|77165834|ref|YP_344359.1| flagellar basal body P-ring protein [Nitrosococcus oceani ATCC
           19707]
 gi|254433462|ref|ZP_05046970.1| flagellar P-ring protein FlgI [Nitrosococcus oceani AFC27]
 gi|115311525|sp|Q3J8L7|FLGI_NITOC RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|76884148|gb|ABA58829.1| Flagellar P-ring protein [Nitrosococcus oceani ATCC 19707]
 gi|207089795|gb|EDZ67066.1| flagellar P-ring protein FlgI [Nitrosococcus oceani AFC27]
          Length = 367

 Score =  402 bits (1033), Expect = e-110,   Method: Composition-based stats.
 Identities = 144/371 (38%), Positives = 209/371 (56%), Gaps = 10/371 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +I    F +  L         R+KD+ ++   R NQL+GYGLVVGL GTGD +    +T
Sbjct: 1   MKIIQTFFIITLLWLSQGVQAERVKDLAAIAGVRSNQLVGYGLVVGLSGTGDQVTQISYT 60

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+R++L+  GI  P G  L  KNVAAV + A LPPFA PG  ID++++SLG+A SLRG
Sbjct: 61  RQSLRNMLREFGIIMPPGVNLQPKNVAAVSIHAQLPPFAKPGQSIDITVSSLGNAKSLRG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L++T L GADG +YA+AQG+++V G   +G   S     I + G+I NGA VER +P 
Sbjct: 121 GSLLLTPLKGADGRVYAMAQGNLIVGGFGAEGNDGSRVTVNIPSTGRIPNGATVERGVPN 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F +   +IL L   DF+TA R+A  INS          A   D  +++V+ P       
Sbjct: 181 PFNNGGPIILNLHAADFTTANRVAAAINSAI----GAGTARPLDGASIQVNAPAVPAQRV 236

Query: 240 RLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L V+    PA+++IN RTGT+VIG +VR+    VS+G LTV IT N  + QP
Sbjct: 237 SFVSLLENLEVDPGEAPAKIVINSRTGTVVIGQHVRVQPAAVSHGRLTVTITANPAISQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
               S G T     TD+ + +     F       L  ++  +N +G     +++IL+ +K
Sbjct: 297 PPL-SGGQTAVVPRTDIDIQEEGSRMFLFAPGVSLGEIVRAVNQVGAAPGDLVAILEALK 355

Query: 358 AAGALQSEIII 368
             GAL +E+++
Sbjct: 356 QVGALSAELVV 366


>gi|302185578|ref|ZP_07262251.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           syringae 642]
 gi|330943212|gb|EGH45619.1| flagellar basal body P-ring protein [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 369

 Score =  402 bits (1033), Expect = e-110,   Method: Composition-based stats.
 Identities = 146/373 (39%), Positives = 214/373 (57%), Gaps = 11/373 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++  LI + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MIKLKQLIAATLLLSTAFGVHAERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT + G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGALLMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L   DF+TA R+ D+IN          +A+A D  +V+V+ P +   
Sbjct: 181 PSGFNQGNTLTLNLNRSDFTTAKRVVDKINEL----LGPGVAQALDGGSVRVTAPLDPGQ 236

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L V+     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP A  S G T     + +         F       L+ ++  +N +G     +++IL+ 
Sbjct: 297 QPGAL-SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEA 355

Query: 356 IKAAGALQSEIII 368
           +K AGALQ+++I+
Sbjct: 356 LKQAGALQADLIV 368


>gi|330967095|gb|EGH67355.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 369

 Score =  401 bits (1032), Expect = e-110,   Method: Composition-based stats.
 Identities = 146/373 (39%), Positives = 214/373 (57%), Gaps = 11/373 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++  LI + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MIKLKQLIAATLLLSAAFGVHAERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT + G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGALLMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L   DF+TA R+ D+IN          +A+A D  +V+V+ P +   
Sbjct: 181 PSGFNQGNTLTLNLNRSDFTTAKRVVDKINDL----LGPGVAQALDGGSVRVTAPLDPGQ 236

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L V+     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP A  S G T     + +         F       L+ ++  +N +G     +++IL+ 
Sbjct: 297 QPGAL-SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEA 355

Query: 356 IKAAGALQSEIII 368
           +K AGALQ+++I+
Sbjct: 356 LKQAGALQADLIV 368


>gi|330961203|gb|EGH61463.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 369

 Score =  401 bits (1032), Expect = e-110,   Method: Composition-based stats.
 Identities = 146/373 (39%), Positives = 214/373 (57%), Gaps = 11/373 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++  LI + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MIKLKQLIAATLLLSTAFGVHAERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT + G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGALLMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L   DF+TA R+ D+IN          +A+A D  +V+V+ P +   
Sbjct: 181 PSGFNQGNTLTLNLNRSDFTTAKRVVDKINDL----LGPGVAQALDGGSVRVTAPLDPGQ 236

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L V+     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP A  S G T     + +         F       L+ ++  +N +G     +++IL+ 
Sbjct: 297 QPGAL-SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEA 355

Query: 356 IKAAGALQSEIII 368
           +K AGALQ+++I+
Sbjct: 356 LKQAGALQADLIV 368


>gi|254720608|ref|ZP_05182419.1| flagellar basal body P-ring protein [Brucella sp. 83/13]
 gi|265985648|ref|ZP_06098383.1| flagellar basal body P-ring protein [Brucella sp. 83/13]
 gi|306838570|ref|ZP_07471407.1| flagellar basal body P-ring protein [Brucella sp. NF 2653]
 gi|264664240|gb|EEZ34501.1| flagellar basal body P-ring protein [Brucella sp. 83/13]
 gi|306406356|gb|EFM62598.1| flagellar basal body P-ring protein [Brucella sp. NF 2653]
          Length = 409

 Score =  401 bits (1032), Expect = e-110,   Method: Composition-based stats.
 Identities = 185/349 (53%), Positives = 264/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 62  SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 121

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 122 STRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 181

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA
Sbjct: 182 QGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTA 241

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 242 VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 301

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+GNLTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 302 DERTGTVVIGEKVRISKVAISHGNLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQ 360

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 361 NAKIGILTGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 409


>gi|319898639|ref|YP_004158732.1| flagellar P-ring protein precursor (Basal body P-ring protein)
           [Bartonella clarridgeiae 73]
 gi|319402603|emb|CBI76148.1| Flagellar P-ring protein precursor (Basal body P-ring protein)
           [Bartonella clarridgeiae 73]
          Length = 414

 Score =  401 bits (1031), Expect = e-110,   Method: Composition-based stats.
 Identities = 177/353 (50%), Positives = 261/353 (73%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
              +  V+R+KD+  +Q  R NQL+GYGLV+GL GTGDSLR++PFTEQSMR++L NLGIS
Sbjct: 62  LSRSSAVARLKDIAVVQGVRSNQLVGYGLVIGLNGTGDSLRNAPFTEQSMRAMLDNLGIS 121

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
            P G   + N+AAV+VTA + PFA+PGSRIDV+++SLGDA+SL+GG LVMT LLGADG  
Sbjct: 122 PPAGASRANNIAAVIVTAEMMPFATPGSRIDVTVSSLGDATSLQGGTLVMTPLLGADGKT 181

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAVAQG++V+SG   KG + S  +G+ T G+I NGA++ER++   F  S  +I++LRN D
Sbjct: 182 YAVAQGNMVISGFGAKGVAESVTQGVPTSGRIPNGALIERKVDGNFNHSNQIIMELRNSD 241

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPA 256
           FSTA+R++D IN ++  R+ + +A   D++T+ ++KP NI +TR ++E+E L + TD  A
Sbjct: 242 FSTAVRVSDLINIFANKRYKQRVARERDAKTIILNKPRNISITRFIAEIEGLPIPTDEVA 301

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV+++ERTGT+VIG+ VR+S+V +S+G+LTV++TE   V QPN FS  G T+    T + 
Sbjct: 302 RVVVDERTGTVVIGEKVRVSRVAISHGSLTVRVTEEPSVSQPNPFSETGDTIVVPRTSIN 361

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           V  +  +  +++  DL++L+ G+N IG+K   II++LQ IK +GAL +E+++Q
Sbjct: 362 VDQSPSNIGILNGVDLDNLVKGLNQIGVKPTAIIAVLQAIKTSGALHAELVVQ 414


>gi|330953729|gb|EGH53989.1| flagellar basal body P-ring protein [Pseudomonas syringae Cit 7]
          Length = 369

 Score =  401 bits (1031), Expect = e-110,   Method: Composition-based stats.
 Identities = 145/373 (38%), Positives = 214/373 (57%), Gaps = 11/373 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++  LI + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MIKLKQLIAATLLLSAAFGVHAERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPSGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT + G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGALLMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERAV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L   DF+TA R+ D+IN          +A+A D  +V+V+ P +   
Sbjct: 181 PSGFNQGNTLTLNLNRSDFTTAKRVVDKINDM----LGPGVAQALDGGSVRVTAPLDPSQ 236

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L ++     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSILENLEIDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP A  S G T     + +         F       L+ ++  +N +G     +++IL+ 
Sbjct: 297 QPGAL-SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEA 355

Query: 356 IKAAGALQSEIII 368
           +K AGALQ+++I+
Sbjct: 356 LKQAGALQADLIV 368


>gi|39998138|ref|NP_954089.1| flagellar basal body P-ring protein [Geobacter sulfurreducens PCA]
 gi|62286841|sp|Q748F5|FLGI_GEOSL RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|39985084|gb|AAR36439.1| flagellar P-ring protein FlgI [Geobacter sulfurreducens PCA]
 gi|298507075|gb|ADI85798.1| flagellar P-ring protein FlgI [Geobacter sulfurreducens KN400]
          Length = 368

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 160/354 (45%), Positives = 221/354 (62%), Gaps = 8/354 (2%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
               +  RIKD+ S    RDNQLIGYGL+VGL GTGDS   + F  QS+ ++L+ +GI+ 
Sbjct: 19  PQLALAIRIKDIASFDGVRDNQLIGYGLIVGLNGTGDSD-QTKFPVQSLANVLERMGITV 77

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
               +  KNVAAVMVTA LPPF+  G+R+DV ++SLGDA SL GG L+MT L GADG +Y
Sbjct: 78  NRDDIKVKNVAAVMVTAELPPFSKQGTRVDVLVSSLGDAKSLAGGTLLMTPLKGADGQVY 137

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           AVAQG ++ +     GQ+++  +   T G+I NGA+VERELP    D + L L L  PDF
Sbjct: 138 AVAQGGLLTNSFSYGGQAATAQKNHPTAGRIPNGALVERELPNVLADRSQLRLNLHQPDF 197

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTP 255
           +TA RIA  +N     +F   +A   D  +V +S P      +   ++++E L V  D P
Sbjct: 198 TTATRIARAVNE----QFKAGVASCNDPGSVVISLPDAYQGRVVEFVADMERLEVRPDNP 253

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+V++NERTGTIVIG+NVRI  V VS+GNLT+ I E  +V QP   S  G TV    T +
Sbjct: 254 AKVVLNERTGTIVIGENVRIDTVAVSHGNLTLLIKETPRVSQPQPLSRTGETVVVPRTGI 313

Query: 316 KVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           KVS+   G   L +   +  ++  +N++G+    +I ILQ IKAAGA+Q+E+ +
Sbjct: 314 KVSEESGGLAVLREGASIGDVVRALNALGVTPRDLIGILQAIKAAGAMQAELSV 367


>gi|121602656|ref|YP_989398.1| flagellar basal body P-ring protein [Bartonella bacilliformis
           KC583]
 gi|120614833|gb|ABM45434.1| flagellar P-ring protein FlgI [Bartonella bacilliformis KC583]
          Length = 412

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 181/353 (51%), Positives = 263/353 (74%), Gaps = 1/353 (0%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
                 V+R+KD+  +Q  R NQL+GYGLV+GL  TGDSLR+SPFTEQSMR++L NLGIS
Sbjct: 61  LARPGAVARLKDIAEIQGVRSNQLVGYGLVIGLNRTGDSLRNSPFTEQSMRAMLDNLGIS 120

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
            P G   + N+AAV+VTA + PFA+PGSRIDV+++SLGDA+SL+GG LVMT LLGADG  
Sbjct: 121 PPAGASRANNIAAVIVTAEMVPFATPGSRIDVTVSSLGDATSLQGGTLVMTPLLGADGKT 180

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAVAQG++V+SG   +G + S  +G+ T G+I NGA+VER++   F  S ++IL+LRN D
Sbjct: 181 YAVAQGNMVISGFGAQGVAESVTQGVPTSGRIPNGALVERKIEGNFNKSNEIILELRNSD 240

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPA 256
           FSTA+R+ D IN +S  R+ + +A+  DS+T+ +SKP NI +TR ++E+E L + TD  A
Sbjct: 241 FSTAVRVTDLINIFSNQRYKQGVAKERDSKTIVLSKPRNISITRFIAEIERLPIPTDEVA 300

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV+++ERTGT+VIG+ VR+S+V +S+G+LTV++TE+  V QPN F + G+TV    T++ 
Sbjct: 301 RVVVDERTGTVVIGEKVRVSRVAISHGSLTVRVTEDPLVSQPNPF-AEGNTVIVPRTNVD 359

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           ++    +  +++  DL++L+ G+N IG+K   II++LQ IK +GAL +E+I+Q
Sbjct: 360 IAQPPSNIGILNGVDLDNLVKGLNQIGVKPTAIIAVLQAIKTSGALHAELIVQ 412


>gi|304310889|ref|YP_003810487.1| Flagellar P-ring protein [gamma proteobacterium HdN1]
 gi|301796622|emb|CBL44834.1| Flagellar P-ring protein [gamma proteobacterium HdN1]
          Length = 367

 Score =  400 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 151/370 (40%), Positives = 215/370 (58%), Gaps = 8/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
                +I  +  L         R+KD+V +Q  R+NQLIGYGLVVGL GTGD    +PFT
Sbjct: 1   MSYRRIISIVCVLLMSGMAHADRLKDIVDIQGVRENQLIGYGLVVGLNGTGDKTSQTPFT 60

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            Q+ ++++   GIS P       KNVAAV V ANLP FA PG +ID++++SLG+A+SLRG
Sbjct: 61  VQTFKNMMAQFGISVPPNLEPKLKNVAAVSVNANLPAFAKPGQKIDITVSSLGNATSLRG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+MT L GADG +YAVAQG +VV G   +G   S     + + G+I +GA VE   P 
Sbjct: 121 GTLLMTPLKGADGRVYAVAQGELVVGGFGAEGADGSKITVNVPSAGRIPSGATVEVASPN 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-T 239
            F+    L   LRNPDF+TA RI D IN        +  A++ D  +++V+ P +     
Sbjct: 181 PFQTGNTLTFNLRNPDFTTARRITDSINQM----LGQGTAKSLDGASIQVAAPADPSQKV 236

Query: 240 RLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L +    P A+VIIN RTGTIVIG  V++    +S+GNLTV I+EN QV QP
Sbjct: 237 MFLSVLENLEISPGEPSAKVIINSRTGTIVIGSAVKVFPAAISHGNLTVTISENTQVSQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           NA     + V   +      +N   F       L+ ++  +N +G+    +++IL+ +K 
Sbjct: 297 NALGGGATVVAPQSQVDATQENNRMFLFEAGTTLDDIVRAVNRVGVAPGDLMAILEALKQ 356

Query: 359 AGALQSEIII 368
           AGAL++E+I+
Sbjct: 357 AGALRAELIV 366


>gi|306846276|ref|ZP_07478837.1| flagellar basal body P-ring protein [Brucella sp. BO1]
 gi|306273271|gb|EFM55140.1| flagellar basal body P-ring protein [Brucella sp. BO1]
          Length = 409

 Score =  400 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 184/349 (52%), Positives = 264/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 62  SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 121

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 122 STRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 181

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA
Sbjct: 182 QGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTA 241

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 242 VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 301

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 302 DERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAYEPNTDIAVNQQ 360

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 361 NAKIGILTGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 409


>gi|237799213|ref|ZP_04587674.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022068|gb|EGI02125.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 369

 Score =  400 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 146/373 (39%), Positives = 214/373 (57%), Gaps = 11/373 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++  LI + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MIKLKQLIAATLLLSTAFGVQAERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P G   +  KNVAAV V A+LP FA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT + G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGALLMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L   DF+TA R+ D+IN          +A+A D  +V+V+ P +   
Sbjct: 181 PSGFNQGNTLTLNLNRSDFTTAKRVVDKINDL----LGPGVAQALDGGSVRVTAPLDPGQ 236

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L V+     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP A  S G T     + +         F       L+ ++  +N +G     +++IL+ 
Sbjct: 297 QPGAL-SGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEA 355

Query: 356 IKAAGALQSEIII 368
           +K AGALQ+++I+
Sbjct: 356 LKQAGALQADLIV 368


>gi|192360563|ref|YP_001982396.1| flagellar basal body P-ring protein [Cellvibrio japonicus Ueda107]
 gi|190686728|gb|ACE84406.1| flagellar P-ring protein FlgI [Cellvibrio japonicus Ueda107]
          Length = 378

 Score =  400 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 148/371 (39%), Positives = 212/371 (57%), Gaps = 10/371 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R  + I ++       A    RIKD+ S+   R NQL+GYGLVVGL GTGD    SPFT
Sbjct: 12  MRSLYWITAIALFAISVAAQAERIKDIASVAGVRANQLVGYGLVVGLDGTGDQTTQSPFT 71

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS  S+L+  GI+ P G R+  KNVAAVMV A LP FA PG  +D++++S+ +A SLRG
Sbjct: 72  VQSFNSMLKQFGITVPEGARMQMKNVAAVMVQAELPAFAKPGQTLDITVSSISNAKSLRG 131

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+MT L G DG +YAVAQG++VV GL       S     + + G+I  GA+VER +  
Sbjct: 132 GSLLMTPLKGLDGKVYAVAQGNLVVGGLSATGADGSRITVNVPSAGRIPGGALVERMVET 191

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     ++  L   DF+TA R+A  IN +         A   D+ +V V  P N     
Sbjct: 192 NFTAGQPIVFNLNRADFTTANRLAQAINKF----LGPDTARPLDAVSVMVDSPQNPAQRV 247

Query: 240 RLMSEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++ +E L V     A RVIIN RTGTIV+G NVR+S V V++G+LTV + E+  V QP
Sbjct: 248 DFIAMLENLEVTPGEEAARVIINSRTGTIVVGKNVRVSPVAVTHGSLTVTVAESLTVSQP 307

Query: 299 NAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N     G+TV   +T++   +     F       L+ ++  +N++G     +++IL+ +K
Sbjct: 308 NPL-GQGTTVVVPSTNITAEEKTNPMFKFAPGASLDDIVRSVNNVGASPSDLMAILEALK 366

Query: 358 AAGALQSEIII 368
            AGAL++E+++
Sbjct: 367 QAGALKAELVV 377


>gi|70729008|ref|YP_258742.1| flagellar basal body P-ring protein [Pseudomonas fluorescens Pf-5]
 gi|115311529|sp|Q4KG91|FLGI_PSEF5 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|68343307|gb|AAY90913.1| flagellar P-ring protein FlgI [Pseudomonas fluorescens Pf-5]
          Length = 362

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 142/365 (38%), Positives = 213/365 (58%), Gaps = 9/365 (2%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           + + + L         R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+  +
Sbjct: 1   MAAALLLSTSLGVQAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPFTLQTFNN 60

Query: 69  LLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           +L   GI  P G   +  KNVAAV V+A+LP FA PG ++D++++S+G++ SLRGG L++
Sbjct: 61  MLSQFGIKVPAGSGNVQLKNVAAVSVSADLPAFAKPGQQVDITVSSIGNSKSLRGGTLLL 120

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           T L G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +P  F   
Sbjct: 121 TPLKGIDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAVPSGFNQG 180

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSE 244
             L L L   DF+TA RI D+IN          +A+A D  +++V+ P +       +S 
Sbjct: 181 NSLTLNLNRSDFTTAKRIVDKINDM----LGPGVAQAIDGGSIRVTAPLDPSQRVDYLSI 236

Query: 245 VEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           +E L ++     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP   S+
Sbjct: 237 LENLEIDPGQAVAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGPLSN 296

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
             + V   +      + K  F       L+ ++  +N +G     +++IL+ +K AGALQ
Sbjct: 297 GQTAVVPRSRVNAQQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGALQ 356

Query: 364 SEIII 368
           +++I+
Sbjct: 357 ADLIV 361


>gi|300024604|ref|YP_003757215.1| flagellar P-ring protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526425|gb|ADJ24894.1| flagellar P-ring protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 367

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 181/366 (49%), Positives = 252/366 (68%), Gaps = 3/366 (0%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
             +   L  L   SA   +RIKD+  ++  R NQL+GYGLVVGL GTGD+LR+SPFT+QS
Sbjct: 3   ICVALLLFILGAGSAAAATRIKDITDVKGIRTNQLVGYGLVVGLNGTGDTLRNSPFTQQS 62

Query: 66  MRSLLQNLGISTPGGR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           ++++L  +G++  G +    ++NVAAVMVTA LPPFAS GSR DV+++S+GDA SL GG 
Sbjct: 63  VQAMLDRMGVNIRGSQYEPRTRNVAAVMVTAELPPFASKGSRFDVTVSSMGDAKSLAGGS 122

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L++TSL GAD  IYA AQG + +SG   KG + S   GI T G+I NGAIVE+  P    
Sbjct: 123 LILTSLSGADQVIYAAAQGQITISGYLAKGAAESITSGIPTRGRIPNGAIVEQNAPGMPV 182

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMS 243
           +   L+L+LRNPDF+TAIRI D INS++  R+   +A A D +++ +S+P  +  TRL +
Sbjct: 183 EGMPLVLELRNPDFTTAIRIQDAINSFAGQRYGMKVARAEDFQSITLSRPRGLSATRLFA 242

Query: 244 EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           E+  +TV+ D  ARV+I+ERTGTIVIG  VRIS V V++GN+TV++ E  +V QP  F S
Sbjct: 243 EIGEITVDPDQTARVVIDERTGTIVIGSEVRISTVAVAHGNITVRVKEQPRVSQPLPF-S 301

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           NG TVT  +T++ V +  GS   +    L  L+S +N +GLK  GII+ILQ +K +GALQ
Sbjct: 302 NGETVTVPDTEVDVHEAGGSIETLRGASLRELVSALNRMGLKPIGIIAILQAMKTSGALQ 361

Query: 364 SEIIIQ 369
           +E+++Q
Sbjct: 362 AELVVQ 367


>gi|114320061|ref|YP_741744.1| flagellar basal body P-ring protein [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226455|gb|ABI56254.1| flagellar P-ring protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 376

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 153/370 (41%), Positives = 221/370 (59%), Gaps = 10/370 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
                + ++I L         RIKD+ S+Q  R NQL+GYGLVVGL GTGD    +PFT 
Sbjct: 11  LTLIGLLAVIVLLMGGLAQAERIKDIASVQGVRSNQLVGYGLVVGLDGTGDQSSQAPFTI 70

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS+RS+L   GI+ P    +   NVAAVMVTA LPPFA  G  +D++++SLG+A SLRGG
Sbjct: 71  QSIRSMLAAQGIAIPDNVNMQVDNVAAVMVTAELPPFARQGQTLDITVSSLGNADSLRGG 130

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKK 181
            L+MT L GADG +YA+AQG+++V G   +G   S     I + G I NGA VERE+   
Sbjct: 131 TLLMTPLRGADGEVYAMAQGNMLVGGFGAEGADGSRITVNIPSAGTIPNGATVEREVRSP 190

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F    D++L L  PDF+TA R+A+ IN           A+A D+ +++V  P        
Sbjct: 191 FAQQGDIVLNLNTPDFTTAHRVAEAINE----TLGPNTAQAQDAVSIRVQAPQTPNQRVS 246

Query: 241 LMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            MS +E + V   + PARVI+N RTG++VIG  V++    +++G+LTV ITE   VVQP+
Sbjct: 247 FMSYLEEIRVTPAEAPARVIVNARTGSVVIGSEVKVRPAAITHGSLTVTITEAPFVVQPD 306

Query: 300 AFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
            F + G T+    TD+++ +     F       L+ +++ +N +G     ++SIL+ +K 
Sbjct: 307 PF-TEGETMVVPQTDIEIEEQANPMFVFGPGTTLDEIVNAVNRVGAAPGDLVSILEALKR 365

Query: 359 AGALQSEIII 368
           AGAL++E+II
Sbjct: 366 AGALRAELII 375


>gi|37679151|ref|NP_933760.1| flagellar basal body P-ring protein [Vibrio vulnificus YJ016]
 gi|161501852|ref|NP_759229.2| flagellar basal body P-ring protein [Vibrio vulnificus CMCP6]
 gi|320157105|ref|YP_004189484.1| flagellar P-ring protein FlgI [Vibrio vulnificus MO6-24/O]
 gi|61213554|sp|Q7MMV0|FLGI_VIBVY RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|61213593|sp|Q8DFJ2|FLGI_VIBVU RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|37197893|dbj|BAC93731.1| flagellar basal-body P-ring protein FlgI [Vibrio vulnificus YJ016]
 gi|319932417|gb|ADV87281.1| flagellar P-ring protein FlgI [Vibrio vulnificus MO6-24/O]
 gi|319999023|gb|AAO08756.2| Flagellar P-ring protein flgI [Vibrio vulnificus CMCP6]
          Length = 363

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 157/368 (42%), Positives = 225/368 (61%), Gaps = 13/368 (3%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
            F +  L  +  +++   +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFTEQS
Sbjct: 3   KFTLLLLCFVLPMTSAYAARIKDVAQVAGVRSNQLVGYGLVSGLPGTGES---TPFTEQS 59

Query: 66  MRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
             ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG +IDV+++S+G A SLRGG L
Sbjct: 60  FAAMLQNFGIQLPAGTKPKIKNVAAVMVTAELPPFSKPGQQIDVTVSSIGSAKSLRGGTL 119

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           + T L G DG +YAVAQG++VVSG   +G   S  +    T G I +GA+VERE+P  F 
Sbjct: 120 LQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGIISSGAMVEREVPTPFG 179

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               +   L   DF+TA R+AD +N++        +A A D+ +V+V  P +I      +
Sbjct: 180 RGDFITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDISQRVAFL 235

Query: 243 SEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN F
Sbjct: 236 SAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLSVSQPNGF 295

Query: 302 SSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            S G TV   N+D+ V++ +G  F       L+ L+  +N +G     +++ILQ +K AG
Sbjct: 296 -SGGETVVVPNSDISVTEEQGKMFKFEPGLTLDDLVRAVNQVGAAPSDLMAILQALKQAG 354

Query: 361 ALQSEIII 368
           A++ ++II
Sbjct: 355 AIEGQLII 362


>gi|262276413|ref|ZP_06054222.1| flagellar P-ring protein FlgI [Grimontia hollisae CIP 101886]
 gi|262220221|gb|EEY71537.1| flagellar P-ring protein FlgI [Grimontia hollisae CIP 101886]
          Length = 363

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 155/368 (42%), Positives = 221/368 (60%), Gaps = 13/368 (3%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           ++L   LI L    A   +RIKDV  +   R NQL+GYGLVVGL GTG+S   +PFT+QS
Sbjct: 3   SWLKLFLIALLIAPAAQAARIKDVSEVAGVRSNQLVGYGLVVGLAGTGES---TPFTDQS 59

Query: 66  MRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
             ++L+N GI  P G +  +KNVAAV V+A LPPFA  G +ID++++S+G A SLRGG L
Sbjct: 60  FNAMLKNFGIQLPPGTKPKTKNVAAVAVSAELPPFAKQGQKIDITVSSIGSAKSLRGGTL 119

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           V T L G DG +YAVAQG+++V G   +G   SS +    T G++ NGA VE+E+P  F 
Sbjct: 120 VQTFLKGLDGKVYAVAQGNLIVGGFSAEGADGSSIVGNTPTVGRVTNGATVEQEVPSPFG 179

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLM 242
               +   L   DF+TA R+AD INS+         A A D+ +V+V  P +       +
Sbjct: 180 RGDHITFNLFESDFTTAQRMADSINSF----LGPNTASAMDAASVRVRAPRDLSQRVAFL 235

Query: 243 SEVEMLT-VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S VE L  V  D  A++I+N RTGTIV+G NVR+    +++G +TV I EN QV QP AF
Sbjct: 236 STVENLEFVPADAAAKIIVNSRTGTIVVGQNVRLRPAAITHGGMTVTINENLQVSQPGAF 295

Query: 302 SSNGSTVTQNNTDLKV-SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            S G TV   ++ ++V  ++   F       L+ L+  +N +G     +++ILQ +K AG
Sbjct: 296 -SGGETVVVPDSGVEVTEEDGRMFHFKPGVTLDDLVRAVNGVGAAPSDLMAILQALKQAG 354

Query: 361 ALQSEIII 368
           A+  ++I+
Sbjct: 355 AIDGQLIV 362


>gi|294853178|ref|ZP_06793850.1| flagellar P-ring protein FlgI [Brucella sp. NVSL 07-0026]
 gi|294818833|gb|EFG35833.1| flagellar P-ring protein FlgI [Brucella sp. NVSL 07-0026]
          Length = 380

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 184/349 (52%), Positives = 264/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 33  SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 92

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 93  STRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 152

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA
Sbjct: 153 QGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTA 212

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 213 VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 272

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 273 DERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQ 331

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 332 NAKIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 380


>gi|306841047|ref|ZP_07473771.1| flagellar basal body P-ring protein [Brucella sp. BO2]
 gi|306288936|gb|EFM60236.1| flagellar basal body P-ring protein [Brucella sp. BO2]
          Length = 409

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 183/349 (52%), Positives = 264/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 62  SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 121

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP F+  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 122 STRSKNTAAVIVTANLPAFSGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 181

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA
Sbjct: 182 QGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTA 241

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 242 VRAADTINIFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 301

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 302 DERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAYEPNTDIAVNQQ 360

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 361 NAKIGILTGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 409


>gi|95929877|ref|ZP_01312618.1| flagellar P-ring protein [Desulfuromonas acetoxidans DSM 684]
 gi|95134173|gb|EAT15831.1| flagellar P-ring protein [Desulfuromonas acetoxidans DSM 684]
          Length = 368

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 158/372 (42%), Positives = 234/372 (62%), Gaps = 9/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEI-SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           M  R+  +I +L+      S  + SRIKD+  ++  R NQL+GYGLVVGL GTGDS  S+
Sbjct: 1   MTKRVHIVIIALVLFSLSCSTGLASRIKDLADIEGVRTNQLVGYGLVVGLNGTGDSS-ST 59

Query: 60  PFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
            FT QS+ ++++ LG+     ++   NVAAVMVTA LP FA  GS IDV ++S+GDA SL
Sbjct: 60  EFTIQSLVNMMERLGMRVERDKVKVDNVAAVMVTAELPAFAKAGSAIDVLVSSIGDADSL 119

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
            GG L+MT L   DGN+YAVAQG++ V  L   G+++   +   T G+I +GAIVERE+P
Sbjct: 120 VGGTLLMTPLKAPDGNVYAVAQGALAVGALSFGGKAAKVQKNHPTVGRIPSGAIVEREVP 179

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--D 237
            +  ++  L  +LR  DF+T  R+AD +N Y    F +P+A A DS +++V         
Sbjct: 180 FRLPENRALNYRLRTADFTTVSRMADVVNGY----FGQPLAHALDSGSLQVIVADEYADS 235

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           L   ++ VE L V+ D  A++I+NER+GTIV+G++VR+S V VS+GNL + I ++  V Q
Sbjct: 236 LVEFIARVEHLEVQPDMIAKIIVNERSGTIVMGEHVRLSTVAVSHGNLNLVINDSALVSQ 295

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGI 356
           P+  S  G+TV    TD+ VS+++G+  ++     +  +   +N+IG     +I+I Q I
Sbjct: 296 PSPLSETGNTVEVPQTDISVSEDRGNLVVLPMGVSIGDVARALNAIGATPRDLIAIFQAI 355

Query: 357 KAAGALQSEIII 368
           KAAGAL +E+ I
Sbjct: 356 KAAGALHAELEI 367


>gi|209963555|ref|YP_002296470.1| flagellar P-ring protein FlgI [Rhodospirillum centenum SW]
 gi|209957021|gb|ACI97657.1| flagellar P-ring protein FlgI [Rhodospirillum centenum SW]
          Length = 377

 Score =  398 bits (1023), Expect = e-109,   Method: Composition-based stats.
 Identities = 178/370 (48%), Positives = 242/370 (65%), Gaps = 9/370 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVS-RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
               L F L  L          RIKD+V ++  R NQLIGYGLVVGL GTGD L++SPFT
Sbjct: 11  LAVVLAFLLSVLPSAGPAFAQMRIKDLVEVEGVRSNQLIGYGLVVGLDGTGDRLQNSPFT 70

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           +QS+  +L+ +G++  G  + ++NVAAVMVTA LPPFA  GSR+DVSI+++GDA+SL GG
Sbjct: 71  QQSLEGMLERMGVNITGLNVKTRNVAAVMVTAELPPFARQGSRLDVSISTMGDATSLLGG 130

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+ T L+GADG++YAVAQGSV V G   +G+++S  +G+ T G+I NG IVERE+    
Sbjct: 131 SLLATPLIGADGSVYAVAQGSVAVGGFSARGEAASVTKGVPTAGRIPNGGIVEREVEFAL 190

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTR 240
            D A + L LRNPDFSTA RIA  +N     +     A A D  TV+++ P     ++  
Sbjct: 191 NDLARVRLTLRNPDFSTATRIAQAVN----RQLGAYSARATDPTTVELTVPGAYAGNVAD 246

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           L+S VE L V  D PARV+I+E++GTIV+GD+VRIS V ++ GNLTV++TE  QV QP  
Sbjct: 247 LISRVETLPVTPDQPARVVIDEQSGTIVMGDSVRISTVAIAQGNLTVRVTETPQVSQPGP 306

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSF--SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           F+  G TV    TD++V D  G+    +  +  L  L+ G+N +G     IISILQ IKA
Sbjct: 307 FAQQGQTVVVPRTDIEVEDGSGNRLNIVQGSVSLRELVDGLNRLGAGPRDIISILQAIKA 366

Query: 359 AGALQSEIII 368
           AGAL +++ +
Sbjct: 367 AGALHADLEV 376


>gi|227820860|ref|YP_002824830.1| flagellar basal body P-ring protein [Sinorhizobium fredii NGR234]
 gi|254789295|sp|C3MG26|FLGI_RHISN RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|227339859|gb|ACP24077.1| flagellar P-ring protein precursor [Sinorhizobium fredii NGR234]
          Length = 371

 Score =  398 bits (1023), Expect = e-109,   Method: Composition-based stats.
 Identities = 223/372 (59%), Positives = 284/372 (76%), Gaps = 4/372 (1%)

Query: 1   MIFRI---AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLR 57
           M  R+         L       A   SRIKDV SLQ+GRDNQLIGYGLVVGLQGTGDSLR
Sbjct: 1   MTMRVCKWLLTFALLFAATLTPAHSASRIKDVASLQAGRDNQLIGYGLVVGLQGTGDSLR 60

Query: 58  SSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           SSPFT+QS+R++LQNLGIST GG   ++NVAAV+VTA LPPFASPGSR+DV++ SLGDA+
Sbjct: 61  SSPFTDQSIRAMLQNLGISTQGGESRTRNVAAVLVTATLPPFASPGSRVDVTVGSLGDAT 120

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SLRGG LVMTSL GADG IYAVAQGS+VV+G   +G ++S  +G++T G++ NGAI+ERE
Sbjct: 121 SLRGGTLVMTSLSGADGQIYAVAQGSIVVTGFSAQGDAASLSQGVTTAGRVPNGAIIERE 180

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           LP KFKD  +L+LQLRNPDFSTA+ +A  IN ++  +F   IAEA DS++V V KP   D
Sbjct: 181 LPSKFKDGFNLVLQLRNPDFSTAVGMAAAINKFASAQFGGRIAEALDSQSVLVQKPKMAD 240

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           L RLM+++E L VETD PARV++NERTGTIVIG +VR+++V VSYG LTVQ+TE   VVQ
Sbjct: 241 LARLMADIENLVVETDVPARVVVNERTGTIVIGQDVRVNEVAVSYGTLTVQVTETPTVVQ 300

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           P  F S G T  + NT ++   + G+ ++++   L SL++G+NSIG+K DGII+ILQ IK
Sbjct: 301 PAPF-SRGETAVEPNTTIEAQSDGGTVAILNGSSLRSLVAGLNSIGVKPDGIIAILQSIK 359

Query: 358 AAGALQSEIIIQ 369
            AGALQ+E+++Q
Sbjct: 360 TAGALQAELVLQ 371


>gi|153011522|ref|YP_001372736.1| flagellar basal body P-ring protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151563410|gb|ABS16907.1| flagellar P-ring protein [Ochrobactrum anthropi ATCC 49188]
          Length = 413

 Score =  398 bits (1023), Expect = e-109,   Method: Composition-based stats.
 Identities = 184/349 (52%), Positives = 264/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 66  SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 125

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 126 STRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 185

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA
Sbjct: 186 QGNMIVSGFAAEGEAASVTQGVPTSGRIPNGALVEREVAGNFGKETEMIVELRDPDFTTA 245

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 246 VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 305

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 306 DERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGVTAVEPNTDIAVNQQ 364

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 365 NAKIGILTGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 413


>gi|312962291|ref|ZP_07776782.1| flagellar P-ring protein precursor FlgI [Pseudomonas fluorescens
           WH6]
 gi|311283218|gb|EFQ61808.1| flagellar P-ring protein precursor FlgI [Pseudomonas fluorescens
           WH6]
          Length = 371

 Score =  398 bits (1022), Expect = e-109,   Method: Composition-based stats.
 Identities = 140/352 (39%), Positives = 208/352 (59%), Gaps = 9/352 (2%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG- 80
              R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+  ++L   GI  P G 
Sbjct: 23  QAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPFTLQTFNNMLSQFGIKVPAGS 82

Query: 81  -RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
             +  KNVAAV ++A+LP F+ PG  +D++++S+G++ SLRGG L+MT L G DGN+YA+
Sbjct: 83  GNVQLKNVAAVSISADLPAFSKPGQVVDITVSSIGNSKSLRGGTLLMTPLKGIDGNVYAI 142

Query: 140 AQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           AQG++VV G   +G   S     + + G+I  GA VER +P  F     L L L   DF+
Sbjct: 143 AQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGATVERTVPSGFNQGNSLTLNLNRSDFT 202

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETD-TPA 256
           TA R+ D+IN          +A+A D  +++V+ P +       +S +E L V+     A
Sbjct: 203 TAKRVVDKINDM----LGPGVAQALDGGSIRVTAPLDPSQRVDYLSILENLEVDPGQAVA 258

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP   S+  + V   +    
Sbjct: 259 KVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGPLSNGQTAVVPRSRVNA 318

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 319 QQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGALQADLIV 370


>gi|158422256|ref|YP_001523548.1| flagellar basal body P-ring protein [Azorhizobium caulinodans ORS
           571]
 gi|158329145|dbj|BAF86630.1| flagellar P-ring protein precursor [Azorhizobium caulinodans ORS
           571]
          Length = 366

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 180/367 (49%), Positives = 264/367 (71%), Gaps = 1/367 (0%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
               FLI +L+ L    A  ++RIKD+ S+Q  RDNQLIGYGLV+GLQGTGD+LR+SPFT
Sbjct: 1   MISRFLIAALVVLLAGPALALTRIKDISSVQGVRDNQLIGYGLVMGLQGTGDTLRNSPFT 60

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           EQ+++++L  +GI+  G  L ++N AAVMVTANLP FA+ GSR+DV+++S+GDA+SL+GG
Sbjct: 61  EQALQAMLDRMGINVVGSPLRARNTAAVMVTANLPAFAAIGSRVDVTVSSIGDATSLKGG 120

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L++T L   DG  YAVAQG + VSG  V+GQ+ +  +G+ T G+I NGA+VER++P + 
Sbjct: 121 TLLITQLNNTDGLTYAVAQGQLAVSGFSVQGQAETLTQGVPTSGRIPNGALVERQIPGQL 180

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLM 242
           +D  + ++ L NPDF TA  +AD IN+Y+  R+ RP+A   D RTV V +P   +  R +
Sbjct: 181 RDLNEYLIDLTNPDFKTASLMADAINAYTQARYGRPLARERDLRTVVVQRPPQANPARFL 240

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +E+  L +E DTPA+V++++RTGT+VIG NV++S V V+ G++TV++TE   V QPN F+
Sbjct: 241 AEIGELGIEVDTPAKVVVDQRTGTVVIGRNVQVSTVAVTQGSVTVRVTETPVVSQPNPFA 300

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           S GSTV    TD++  +  G  +++   DL +L+ G+N +GLK   II+ILQ IK +GAL
Sbjct: 301 S-GSTVVVPRTDIQADEAGGHLAVVRGTDLQTLVRGLNRLGLKPSDIIAILQAIKTSGAL 359

Query: 363 QSEIIIQ 369
           Q+E+++Q
Sbjct: 360 QAELVVQ 366


>gi|239834440|ref|ZP_04682768.1| Flagellar P-ring protein 1 precursor [Ochrobactrum intermedium LMG
           3301]
 gi|239822503|gb|EEQ94072.1| Flagellar P-ring protein 1 precursor [Ochrobactrum intermedium LMG
           3301]
          Length = 409

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 184/349 (52%), Positives = 265/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 62  SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 121

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 122 STRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 181

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F   +++I++LR+PDF+TA
Sbjct: 182 QGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGNFGKESEMIVELRDPDFTTA 241

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 242 VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 301

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 302 DERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGVTAVEPNTDIAVNQQ 360

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 361 NAKIGILTGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 409


>gi|328545503|ref|YP_004305612.1| flagellar P-ring protein I [polymorphum gilvum SL003B-26A1]
 gi|326415244|gb|ADZ72307.1| Flagellar P-ring protein I [Polymorphum gilvum SL003B-26A1]
          Length = 366

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 179/353 (50%), Positives = 254/353 (71%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
              A  + RIKD+ SLQ  RDNQL+GYGLV+GLQG+GD+LR+SPFTEQS++S+L ++G++
Sbjct: 14  VPPAAAMVRIKDIASLQGVRDNQLVGYGLVIGLQGSGDTLRNSPFTEQSLQSMLDSMGVN 73

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
             G RL ++NVAAV+VTA+LP F   GSRIDVS++SLGDA SL GG L+ T L+GADG++
Sbjct: 74  VRGARLRTRNVAAVVVTADLPAFTGKGSRIDVSVSSLGDAGSLAGGTLIATPLMGADGSV 133

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAVAQG+V VSG    GQ+    +GI T G+I NGA++ER++P +F +   L+L+L NPD
Sbjct: 134 YAVAQGAVAVSGFSEAGQAERLKQGIPTVGRIPNGALIERDIPDRFANIPALVLELSNPD 193

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPA 256
           F TA+R+AD IN ++  ++    A   D R++ +  P N+ +TR ++E+E L V+ D  A
Sbjct: 194 FRTAVRVADAINRHTKAQYGMTAARERDYRSIDLKAPANVGVTRFIAEIEGLLVQPDQAA 253

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV+I+ERTGT+VIG +V++S V V++GNLTV+ITE  ++ QP  FS  G T     T + 
Sbjct: 254 RVVIDERTGTVVIGRDVQVSTVAVTHGNLTVRITEAPEISQPAPFSYQGQTAVAPRTFID 313

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
              + G  +++   DL +L+ G+N IGLK  GII+ILQ IK AGALQ++++IQ
Sbjct: 314 AQQDGGQLAIVGGSDLQTLVRGLNRIGLKPTGIIAILQAIKTAGALQADLVIQ 366


>gi|261253610|ref|ZP_05946183.1| flagellar P-ring protein FlgI [Vibrio orientalis CIP 102891]
 gi|260937001|gb|EEX92990.1| flagellar P-ring protein FlgI [Vibrio orientalis CIP 102891]
          Length = 363

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 153/368 (41%), Positives = 217/368 (58%), Gaps = 13/368 (3%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
            + +     L   +    +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+QS
Sbjct: 3   KWFLLVTSLLFIATHTHAARIKDVSQVAGVRSNQLVGYGLVTGLPGTGES---TPFTDQS 59

Query: 66  MRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
             ++LQN GI  P G +  SKNVAAV+VTA LP F+  G  IDV+++S+G A SLRGG L
Sbjct: 60  FNAMLQNFGIQMPPGTKPKSKNVAAVIVTAELPAFSKQGQTIDVTVSSIGSAKSLRGGTL 119

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           + T L G DG IYAVAQG++VVSG        S  +    T G I NGA+VERE+P  F 
Sbjct: 120 MQTMLKGLDGQIYAVAQGNLVVSGFSATGADGSKIVGNNPTAGMISNGAMVEREIPTPFS 179

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               +   L   DF+TA R+AD +N++        +A A D+ +VKV  P +I      +
Sbjct: 180 RGDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAIDATSVKVRAPRDITQRVAFL 235

Query: 243 SEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E L        A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPNAF
Sbjct: 236 SAIENLEFNPAEGSAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPNAF 295

Query: 302 SSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
              G TV   +TD++V++ +G  F       L+ L+  +N +G     +++ILQ +K AG
Sbjct: 296 -GGGETVVVPDTDIEVTEEQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAG 354

Query: 361 ALQSEIII 368
           A++ ++I+
Sbjct: 355 AIEGQLIV 362


>gi|17989429|ref|NP_542062.1| flagellar basal body P-ring protein [Brucella melitensis bv. 1 str.
           16M]
 gi|161486704|ref|NP_699358.2| flagellar basal body P-ring protein [Brucella suis 1330]
 gi|17985306|gb|AAL54326.1| flagellar p-ring protein flgi [Brucella melitensis bv. 1 str. 16M]
          Length = 357

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 184/349 (52%), Positives = 264/349 (75%), Gaps = 1/349 (0%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
             V+R+KD+ ++Q  R+NQL+GYGLV+GL+GTGDSLR+SPFTEQSMR++L NLGIS P  
Sbjct: 10  SAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRN 69

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
              SKN AAV+VTANLP FA  GSRIDV+++SLGDA+SL+GG LVMT L+GAD  IYAVA
Sbjct: 70  STRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVA 129

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++VSG   +G+++S  +G+ T G+I NGA+VERE+   F    ++I++LR+PDF+TA
Sbjct: 130 QGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTA 189

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
           +R AD IN ++  R+ R +A A D++T+++S+P N+   R ++E+E L + TD  ARV++
Sbjct: 190 VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAELEGLPITTDEVARVVV 249

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGT+VIG+ VRISKV +S+G+LTV++TE   VVQP  F S+G T  + NTD+ V+  
Sbjct: 250 DERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQPEPF-SDGETAVEPNTDIAVNQQ 308

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
                ++   +L +L+ G+N IG+K  GII+ILQ IK +GAL +E+++Q
Sbjct: 309 NAKIGILSGANLENLVKGLNQIGVKPTGIIAILQAIKTSGALHAELVVQ 357


>gi|229591867|ref|YP_002873986.1| flagellar basal body P-ring protein [Pseudomonas fluorescens SBW25]
 gi|229363733|emb|CAY51137.1| flagellar P-ring protein precuror [Pseudomonas fluorescens SBW25]
          Length = 368

 Score =  396 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 140/353 (39%), Positives = 208/353 (58%), Gaps = 9/353 (2%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
               R+KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+  ++L   GI  P G
Sbjct: 19  AQAERLKDIASISGVRSNQLIGYGLVVGLSGTGDQTTQTPFTLQTFNNMLSQFGIKVPAG 78

Query: 81  --RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
              +  KNVAAV ++A+LP F+ PG  +D++++S+G++ SLRGG L+MT L G DGN+YA
Sbjct: 79  SGNVQLKNVAAVSISADLPAFSKPGQVVDITVSSIGNSKSLRGGTLLMTPLKGIDGNVYA 138

Query: 139 VAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           +AQG++VV G   +G   S     + + G+I  GA VER +P  F     L L L   DF
Sbjct: 139 IAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGATVERTVPSGFNQGNSLTLNLNRSDF 198

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETD-TP 255
           +TA R+ D+IN          +A+A D  +++V+ P +       +S +E L V+     
Sbjct: 199 TTAKRVVDKINDM----LGPGVAQAIDGGSIRVTAPLDPSQRVDYLSILENLEVDPGQAV 254

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V QP   S+  + V   +   
Sbjct: 255 AKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGPLSNGQTAVVPRSRVN 314

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 315 AQQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGALQADLIV 367


>gi|319409185|emb|CBI82829.1| Flagellar P-ring protein [Bartonella schoenbuchensis R1]
          Length = 412

 Score =  396 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 178/353 (50%), Positives = 261/353 (73%), Gaps = 1/353 (0%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
                 V+R+KD+  +Q  R NQL+GYGLV+GL GTGDSLR++PFTEQ+MR++L NLG+S
Sbjct: 61  LARPGAVARLKDIAEIQGVRSNQLVGYGLVIGLNGTGDSLRNAPFTEQAMRAMLDNLGMS 120

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
            P G   + N+AAV+VTA + PFA+PGSRIDV++++LGDA+SL+GG LVMT LLGADG  
Sbjct: 121 PPAGASRANNIAAVIVTAEMVPFATPGSRIDVTVSALGDATSLQGGTLVMTPLLGADGKT 180

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAVAQG++V+SG   +G + S  +G+ T G+I NGA+VE+++   F    ++IL+LRN D
Sbjct: 181 YAVAQGNMVISGFGAQGVAESVTQGVPTSGRIPNGALVEQKIEGNFNQGNEVILELRNSD 240

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPA 256
           FSTA+R++D IN ++  R+   +A+  D++TV ++KP NI + R ++E+EML + TD  A
Sbjct: 241 FSTAVRVSDLINIFANKRYKHNVAKERDAKTVVLNKPRNISMARFIAEIEMLPIPTDEVA 300

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV+++ERTGT+VIG+ VR+S+V +S+G+LTV++TE  +V QPN F S+G TV    T + 
Sbjct: 301 RVVVDERTGTVVIGEKVRVSRVAISHGSLTVRVTEEPEVSQPNPF-SDGDTVVVPRTSVD 359

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           V     +  ++D  DL++LI G+N IG+K   II++LQ IK AGAL +E+++Q
Sbjct: 360 VDQPVSNIGILDGVDLDNLIKGLNQIGVKPTAIIAVLQAIKTAGALHAELVVQ 412


>gi|218672799|ref|ZP_03522468.1| flagellar basal body P-ring protein [Rhizobium etli GR56]
          Length = 370

 Score =  396 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 233/371 (62%), Positives = 292/371 (78%), Gaps = 3/371 (0%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVV--SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS 58
           M   +       + + +++      SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  RS
Sbjct: 1   MFRFLTLAAVLAMSMADVAPAWALTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGFRS 60

Query: 59  SPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           SPFTEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSRIDV+++SLGDA+S
Sbjct: 61  SPFTEQSMRAMLQNLGISTQGGQSSAKNTAAVMVTANLPPFASPGSRIDVTVSSLGDATS 120

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           LRGG LVMTSL GADG IYAVAQGSV+VSG   +GQ+++  EG++T G++  GAI+EREL
Sbjct: 121 LRGGTLVMTSLSGADGQIYAVAQGSVIVSGFQAQGQAATVTEGVTTAGRVPGGAIIEREL 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL 238
           P +FKDS +L+LQLRNPDFSTAIRIAD +N Y+  RF  P+AEA DS+ V + KP   DL
Sbjct: 181 PSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRQADL 240

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           TRLM++VE L VETDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++QP
Sbjct: 241 TRLMADVENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQIIQP 300

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
             F S G T  Q  TD+      G  ++ID PDL +L++G+N+IG+K DGII+ILQGIK+
Sbjct: 301 EPF-SRGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGIKS 359

Query: 359 AGALQSEIIIQ 369
           AGALQ+E+++Q
Sbjct: 360 AGALQAELVLQ 370


>gi|326796593|ref|YP_004314413.1| flagellar P-ring protein [Marinomonas mediterranea MMB-1]
 gi|326547357|gb|ADZ92577.1| Flagellar P-ring protein [Marinomonas mediterranea MMB-1]
          Length = 366

 Score =  396 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 146/373 (39%), Positives = 228/373 (61%), Gaps = 13/373 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ +    +  L  L      +  R+KD+ S+   R+NQL GYGLV+GL GTGD   ++ 
Sbjct: 1   MVMKCCVRLIILFTLVVSQLSLADRLKDIASVAGVRENQLFGYGLVIGLNGTGD---NTD 57

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS  S+L   GI+ P G    S NVAAV +TA LPPF+ PG +IDV+++SLG+ASSL
Sbjct: 58  FTNQSFLSMLNQFGINLPAGTDADSDNVAAVSLTATLPPFSKPGQQIDVTVSSLGNASSL 117

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L++++L GADG +YA+AQG++VV GL  +G   S     I T G+I NGA VE+ +
Sbjct: 118 RGGTLLLSALKGADGEVYAIAQGNLVVGGLGAQGADGSRLSINIPTVGRIPNGASVEKVV 177

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L   L  PDF+TA ++AD+IN          +A + D+ +++V+ P +   
Sbjct: 178 PSSFNRGDTLTFNLNRPDFTTAKQVADKINGL----LGPGVATSLDATSIRVTAPRDPSQ 233

Query: 238 LTRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L V+  +  A+++IN RTGTI+IG +V++S   V++G+LTV I EN ++ 
Sbjct: 234 RVTFLSILENLDVQLGEERAKIVINSRTGTIIIGQHVKVSPAAVTHGSLTVTIKENPEIG 293

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPNA  + G T+    +++ V ++ G  F       LN ++  +N +G     +++IL+G
Sbjct: 294 QPNAL-AGGETILAPRSEITVDEDSGHMFVFDPGASLNDIVRAVNQVGAAPGDVMAILEG 352

Query: 356 IKAAGALQSEIII 368
           +K AGA+ +++++
Sbjct: 353 LKQAGAINADLVV 365


>gi|260772278|ref|ZP_05881194.1| flagellar P-ring protein FlgI [Vibrio metschnikovii CIP 69.14]
 gi|260611417|gb|EEX36620.1| flagellar P-ring protein FlgI [Vibrio metschnikovii CIP 69.14]
          Length = 362

 Score =  396 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 163/373 (43%), Positives = 223/373 (59%), Gaps = 17/373 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ +I      L+ +   S+   +RIKDV  +   R NQL+GYGLV GL GTG+S   +P
Sbjct: 1   MMKKILL----LLMVFMASSAHATRIKDVAQVAGVRSNQLVGYGLVTGLPGTGES---NP 53

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+QS R++LQN GI  P G R  +KNVAAVM+TA LPPF   G  IDV+++S+G ASSL
Sbjct: 54  FTDQSFRAMLQNFGIQLPPGTRTNTKNVAAVMLTAELPPFTKQGQTIDVTVSSIGSASSL 113

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L  T L G DG +YAVAQG++VVSG        SS +    T G I NGAIVERE+
Sbjct: 114 RGGTLTQTFLKGLDGQVYAVAQGNLVVSGFSATGADGSSLVGNNPTVGMISNGAIVEREI 173

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     +   L   DF+TA R+AD +N +        +A A D+ +V+V  P  +  
Sbjct: 174 PTPFGRGDFITFNLFQSDFTTAQRMADTVNQF----LGPDMASAIDATSVRVRAPREVSQ 229

Query: 238 LTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S VE L  E  D  A++I+N RTGTIVIG +VR+    V++G +TV I EN  V 
Sbjct: 230 RVAFLSAVENLEFEPADMAAKIIVNSRTGTIVIGQHVRLRPAAVTHGGMTVAIKENWGVD 289

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPN F + G T    +TD++V + +G  F L     L+ L+  +N +G     +++ILQ 
Sbjct: 290 QPNPF-AGGETAIIPDTDIEVVEQQGKMFKLETGTTLDELVRAVNEVGAAPSDLMAILQA 348

Query: 356 IKAAGALQSEIII 368
           +K AGA+Q ++II
Sbjct: 349 LKQAGAIQGQLII 361


>gi|330445352|ref|ZP_08309004.1| flagellar P-ring family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489543|dbj|GAA03501.1| flagellar P-ring family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 363

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 150/372 (40%), Positives = 220/372 (59%), Gaps = 14/372 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M FR   L+  ++     S+   +RIKDV S+   R NQL+GYGLVVGL GTG+   ++P
Sbjct: 1   MNFRTIILLGFVLL---SSSANAARIKDVSSVAGVRSNQLVGYGLVVGLPGTGE---TTP 54

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+QS  ++LQN GI  P G +   KNVAAV V A LPPF   G  ID++++S+G A SL
Sbjct: 55  FTDQSFNAMLQNFGIQLPVGTKPKIKNVAAVAVNATLPPFTKQGQTIDITVSSIGSAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T L G DG +YA+AQG++VV G   +G   S  +    T G+I NGA+VE+E+
Sbjct: 115 RGGTLLQTFLKGLDGKVYAIAQGTLVVGGFSAEGADGSKVIGNTPTVGRISNGAMVEQEV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L   L + DF+TA R+AD IN +        +A A D+ ++KV  P ++  
Sbjct: 175 PNPFGRGDYLTFNLHDSDFTTAQRMADSINQF----LGPNMASAVDATSIKVRAPRDVSQ 230

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S VE +  +     A++I+N RTGTIVIG +V++    +++G +TV I EN +V 
Sbjct: 231 RVAFLSTVENIEFDPAEGSAKIIVNSRTGTIVIGQHVKLKPAAITHGGMTVSIKENPKVS 290

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPNAF+   +TV QN+       +   F       L+ L+  +N +G     +++ILQ +
Sbjct: 291 QPNAFAGGETTVVQNSNITVEESDSRMFKFEPGVTLDELVRAVNQVGAAPSDLMAILQAL 350

Query: 357 KAAGALQSEIII 368
           K AGA++ ++II
Sbjct: 351 KQAGAIEGQLII 362


>gi|260466617|ref|ZP_05812805.1| flagellar P-ring protein [Mesorhizobium opportunistum WSM2075]
 gi|259029623|gb|EEW30911.1| flagellar P-ring protein [Mesorhizobium opportunistum WSM2075]
          Length = 413

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 200/354 (56%), Positives = 267/354 (75%), Gaps = 1/354 (0%)

Query: 16  HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI 75
                QV SRIKD+  LQS RDNQL+GYGLV+GL G+GDSLR+SPFTEQS+R++L+NLGI
Sbjct: 61  SLPPGQVASRIKDIAQLQSSRDNQLVGYGLVIGLAGSGDSLRNSPFTEQSIRAMLENLGI 120

Query: 76  STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
           +T GG   +KNVAAV+VTAN+PP+   G+RID+ ++S+GDA+SL GG L+MT L  ADG 
Sbjct: 121 ATEGGSARAKNVAAVIVTANMPPYVQSGARIDIDVSSMGDATSLAGGTLIMTPLKAADGE 180

Query: 136 IYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           IYAV QG+V+VSG   +GQ+    +G+ T G++ NGAIVER +  +F D A L LQLRNP
Sbjct: 181 IYAVGQGAVIVSGFTAQGQAEQLTQGVPTAGRVPNGAIVERSVKAEFDDQAILTLQLRNP 240

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTP 255
           DFSTAIRIAD IN Y+  RF   +A   DSRTV++ +P N+   R  +E+E L VE+DTP
Sbjct: 241 DFSTAIRIADAINDYTSQRFGMRVAGERDSRTVQIRRPKNVSAARFYAEIENLVVESDTP 300

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           ARV+I+ERTGTIVIG++V+IS+V +S+G LTV+ITE  +VVQP  FS  G T  +  T +
Sbjct: 301 ARVVIDERTGTIVIGNDVKISRVAISHGTLTVRITEAPRVVQPEPFSK-GETAVEPFTAI 359

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
             S      +++D PDL +L+SG+N +G+K DGII+ILQGIK+AGALQ+++++Q
Sbjct: 360 DASRPDARVAVLDGPDLQTLVSGLNRLGVKPDGIIAILQGIKSAGALQADLVLQ 413


>gi|167623365|ref|YP_001673659.1| flagellar basal body P-ring protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167353387|gb|ABZ76000.1| flagellar P-ring protein [Shewanella halifaxensis HAW-EB4]
          Length = 364

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 151/372 (40%), Positives = 222/372 (59%), Gaps = 13/372 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+     L+ +++ L   +     RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   
Sbjct: 1   MMKLKLVLLCAMLVL--TTPVHAQRIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTR--- 55

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+ +++L+N GI+ P   R   KN+A V V+A++PPF  PG  +DV+++SLG+A SL
Sbjct: 56  YTEQTFKTMLKNFGINLPDNFRPKIKNIAVVAVSADMPPFIKPGQTLDVTVSSLGEAKSL 115

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG+L+ T L G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGAI+ER +
Sbjct: 116 RGGMLLQTFLKGVDGNVYAIAQGSMVVSGFSAEGMDGSKVIQNTPTVGRIPNGAIIERTV 175

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R+AD IN          +A   D+ +V+VS P ++  
Sbjct: 176 ATPFSTGDHLTFNLRRADFSTAKRLADSINDL----LGPGMARPLDAASVQVSAPRDVSQ 231

Query: 238 LTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E + VE     A+VI+N RTGTIV+G NV++    V++G LTV I E  QV 
Sbjct: 232 RVSFLATLENIEVEPAAESAKVIVNSRTGTIVVGQNVKLLPAAVTHGGLTVTIAEATQVS 291

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPN F +  + VT ++T     ++   F       L+ L+  +N +G     +++IL+ +
Sbjct: 292 QPNPFGNGQTVVTTDSTIDVAEEDSRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEAL 351

Query: 357 KAAGALQSEIII 368
           K AGAL  E+II
Sbjct: 352 KMAGALHGELII 363


>gi|115523181|ref|YP_780092.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           BisA53]
 gi|115517128|gb|ABJ05112.1| flagellar P-ring protein [Rhodopseudomonas palustris BisA53]
          Length = 367

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 191/369 (51%), Positives = 267/369 (72%), Gaps = 2/369 (0%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M++R+ +    ++ L   +A    RIKD+ +L+  R+NQL GYGLV+GL+GTGD+LR+SP
Sbjct: 1   MMWRLFW--GIVVALSVTTASAAVRIKDIANLKGVRENQLFGYGLVIGLKGTGDTLRNSP 58

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTEQS++S+L N+GI+  G  L ++NVAAV+VTA+LPPF++ G+RIDVSI+SLGD+SSL 
Sbjct: 59  FTEQSLQSMLDNMGINIRGTALRTRNVAAVVVTADLPPFSAGGTRIDVSISSLGDSSSLM 118

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG LVMTSL GADG IYAVAQG+V V G  ++G + S  +G++T G+I NGA++ERE+  
Sbjct: 119 GGTLVMTSLRGADGEIYAVAQGAVAVGGYNIEGAAQSLSQGVATAGRIPNGALIEREVRG 178

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           +F D   L+L+L+NPDF TA RI D IN +S  R+   +A   D RTV +++P  +   R
Sbjct: 179 RFSDMESLVLELKNPDFVTATRILDVINQHSRGRYQVGVAVEQDYRTVILTRPRAVSPVR 238

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
            ++E+E L VE DTPARV+++ERTGT+VIG NV+IS V V++GNLTV+ITE   V QP  
Sbjct: 239 FIAEIEELLVEPDTPARVVVDERTGTVVIGRNVQISTVAVTHGNLTVRITEAPIVSQPAP 298

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           FS  G TV    T +  ++     +++   DL  L+ G+N IGLK  GII+ILQ IK+AG
Sbjct: 299 FSPRGETVVVPQTFIDANEPGAKIAILRGTDLQRLVRGLNQIGLKPSGIIAILQAIKSAG 358

Query: 361 ALQSEIIIQ 369
           ALQ++++IQ
Sbjct: 359 ALQADLVIQ 367


>gi|59712477|ref|YP_205253.1| flagellar basal body P-ring protein [Vibrio fischeri ES114]
 gi|75431558|sp|Q5E3N1|FLGI_VIBF1 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|59480578|gb|AAW86365.1| flagellar basal body P ring protein flgI [Vibrio fischeri ES114]
          Length = 373

 Score =  395 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 150/370 (40%), Positives = 220/370 (59%), Gaps = 13/370 (3%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           +    +        IS    +RIKDV  +   R NQLIGYGLV GL GTG+S   +PFT+
Sbjct: 11  KNLVTVLFTWLCLSISTAHAARIKDVAEVAGVRSNQLIGYGLVSGLPGTGES---TPFTD 67

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS  ++LQN GI  P G +  +KNVAAVMVTA LPPF+  G  +DV+++S+G A SLRGG
Sbjct: 68  QSFNAMLQNFGIQLPPGTKPKTKNVAAVMVTATLPPFSKQGQVVDVTVSSVGSAKSLRGG 127

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPKK 181
            L+ T L G DG  YA+AQG+++VSG        S  +    T G+I  GA+VERE+P  
Sbjct: 128 TLLQTFLKGLDGKTYAIAQGNLIVSGFSATGADGSKIVGNNPTVGRISGGAMVEREVPSP 187

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F     +   L   DF+TA R+AD +N++        +A A D+ +V+V  P +I     
Sbjct: 188 FGRGDFITFNLLESDFTTAQRMADAVNNF----LGPNMASAVDATSVRVRAPRDISQRVA 243

Query: 241 LMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +S VE +  +  D  A++I+N RTGTIV+G +V++    V++G +TV I EN QV QP 
Sbjct: 244 FLSAVENVDFDPADGSAKIIVNSRTGTIVVGKHVKLKPAAVTHGGMTVAIKENLQVSQPG 303

Query: 300 AFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
            F S+G TV   ++D++V++ +G  F       L+ L+  +N +G     +++ILQ +K 
Sbjct: 304 PF-SDGQTVVTPDSDIEVTEEQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQ 362

Query: 359 AGALQSEIII 368
           AGA++ ++II
Sbjct: 363 AGAIEGQLII 372


>gi|88799027|ref|ZP_01114608.1| Flagellar basal-body P-ring protein [Reinekea sp. MED297]
 gi|88778254|gb|EAR09448.1| Flagellar basal-body P-ring protein [Reinekea sp. MED297]
          Length = 364

 Score =  395 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 152/373 (40%), Positives = 222/373 (59%), Gaps = 15/373 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M      LIF+L  L   S     RIKD+ ++Q  R+NQL+GYGLVVGL G+GD    +P
Sbjct: 1   MTAMTRILIFTLCLL--QSFAFADRIKDLSAVQGVRNNQLVGYGLVVGLDGSGDK---AP 55

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT Q+ R++++  GI+ P G      NVAAV V A LPPFA PG  IDV+++S+G++ SL
Sbjct: 56  FTNQTFRNMMEQFGITIPEGEDPKLANVAAVSVHATLPPFAKPGQEIDVTVSSIGNSDSL 115

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L++T L GADG +YAVAQG+++V G   +G   SS    I + G+I NGAIVERE+
Sbjct: 116 RGGSLLLTPLRGADGKVYAVAQGNMIVGGFGAEGEDGSSIKVNIQSAGRIPNGAIVEREV 175

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L   L  PDF+TA R+ + IN           A A D+ +V+V+ P +   
Sbjct: 176 PTAFSQGDYLTFNLHRPDFTTAKRMQEVINEL----LGPDAAYAVDAASVRVTAPRDASQ 231

Query: 238 LTRLMSEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L V     A +VIIN RTGTIV+G +V+I  V +++G+LTV I  + + V
Sbjct: 232 RVSFLSVLENLEVTPGEEAAKVIINSRTGTIVVGQHVKIEPVAITHGDLTVTIQNDLEAV 291

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP   S+ G TV   + ++   + +   F       L+ L+  +N +G     +++IL+ 
Sbjct: 292 QPEGLSA-GETVVVPDAEVNAEEEQNPMFLFGPTVTLSDLVDAVNEVGAAPGDLMAILEA 350

Query: 356 IKAAGALQSEIII 368
           +K+AGAL++E+I+
Sbjct: 351 LKSAGALKAELIV 363


>gi|323495373|ref|ZP_08100450.1| flagellar basal body P-ring protein [Vibrio brasiliensis LMG 20546]
 gi|323310296|gb|EGA63483.1| flagellar basal body P-ring protein [Vibrio brasiliensis LMG 20546]
          Length = 365

 Score =  395 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 156/373 (41%), Positives = 224/373 (60%), Gaps = 14/373 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ +  FL+ + + +   SAQ   RIKDV  +   R NQL+GYGLV GL GTG+S   +P
Sbjct: 1   MVMKKLFLLITSLLVIATSAQAA-RIKDVAQVAGVRSNQLVGYGLVTGLPGTGES---TP 56

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+QS  ++LQN GI  P G +  SKNVAAV+VTA LP F+  G  IDV+++S+G A SL
Sbjct: 57  FTDQSFNAMLQNFGIQMPPGTKPKSKNVAAVIVTAELPAFSKQGQTIDVTVSSIGSAKSL 116

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T L G DG IYAVAQG++VVSG        S  +    T G I NGA+VERE+
Sbjct: 117 RGGTLMQTMLKGLDGQIYAVAQGNLVVSGFSATGADGSKIVGNNPTAGMISNGAMVEREI 176

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     +   L   DF+TA R+AD +N++        +A A D+ +VKV  P ++  
Sbjct: 177 PTPFSRGDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVKVRAPRDVTQ 232

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E +        A++I+N RTGTIV+G +VR+    V++G +TV I EN  V 
Sbjct: 233 RVAFLSAIENIEFNPAEGSAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVS 292

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPNAF   G TV   +TD++V++ +G  F       L+ L+  +N +G     +++ILQ 
Sbjct: 293 QPNAF-GGGETVVVPDTDIEVTEEQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQA 351

Query: 356 IKAAGALQSEIII 368
           +K AGA++ ++I+
Sbjct: 352 LKQAGAIEGQLIV 364


>gi|254230136|ref|ZP_04923531.1| flagellar P-ring protein FlgI [Vibrio sp. Ex25]
 gi|151937329|gb|EDN56192.1| flagellar P-ring protein FlgI [Vibrio sp. Ex25]
          Length = 363

 Score =  395 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 156/371 (42%), Positives = 225/371 (60%), Gaps = 14/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +   LI   + L   +A   +RIKDV  +   R NQL+GYGLV GL GTG+   ++PFT
Sbjct: 1   MKKLLLILMSVALF-STAAQAARIKDVAQVAGVRSNQLVGYGLVSGLPGTGE---ANPFT 56

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQS  ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRG
Sbjct: 57  EQSFAAMLQNFGIQMPPGTKPKIKNVAAVMVTAELPPFSKPGQQVDVTVSSIGSAKSLRG 116

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DG +YAVAQG++VVSG   +G   S  +    T G I +GA VERE+P 
Sbjct: 117 GTLLQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPN 176

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L   DF+TA R+AD +N++        +A A D+ +V+V  P ++    
Sbjct: 177 PFGRGDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDVSQRV 232

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QP
Sbjct: 233 AFLSAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQP 292

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N F S G TV   ++D++VS+ +G  F       L+ L+  +N +G     +++ILQ +K
Sbjct: 293 NGF-SGGQTVVVPDSDIEVSEEQGKMFKFEPGLTLDDLVRAVNQVGAAPSDLMAILQALK 351

Query: 358 AAGALQSEIII 368
            AGA++ ++II
Sbjct: 352 QAGAIEGQLII 362


>gi|157961175|ref|YP_001501209.1| flagellar basal body P-ring protein [Shewanella pealeana ATCC
           700345]
 gi|157846175|gb|ABV86674.1| flagellar P-ring protein [Shewanella pealeana ATCC 700345]
          Length = 364

 Score =  395 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 152/372 (40%), Positives = 222/372 (59%), Gaps = 13/372 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+     L+ +++ L   +     RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   
Sbjct: 1   MMKLKLVLLCAILAL--SAPVHAQRIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTR--- 55

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+ +++L+N GI+ P   R   KN+A V V+A +PPF  PG  +DV+++SLG+A SL
Sbjct: 56  YTEQTFKTMLKNFGINLPDNFRPKIKNIAVVAVSAEMPPFIKPGQTLDVTVSSLGEAKSL 115

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG+L+ T L G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGAI+ER +
Sbjct: 116 RGGMLLQTFLKGVDGNVYAIAQGSMVVSGFSAEGMDGSKVVQNTPTVGRIPNGAIIERTV 175

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R+AD IN          +A   D+ +V+VS P ++  
Sbjct: 176 ATPFSTGDHLTFNLRRADFSTAKRLADSINDL----LGPGMARPLDAASVQVSAPRDVSQ 231

Query: 238 LTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E + VE     A+VI+N RTGTIV+G NV++    V++G LTV I E  QV 
Sbjct: 232 RVSFLATLENIEVEPAAESAKVIVNSRTGTIVVGQNVKLLPAAVTHGGLTVTIAEATQVS 291

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPNAF +  + VT ++T     ++   F       L+ L+  +N +G     +++IL+ +
Sbjct: 292 QPNAFGNGQTVVTTDSTIDVAEEDSRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEAL 351

Query: 357 KAAGALQSEIII 368
           K AGAL  E+II
Sbjct: 352 KMAGALHGELII 363


>gi|24374753|ref|NP_718796.1| flagellar basal body P-ring protein [Shewanella oneidensis MR-1]
 gi|62286885|sp|Q8ECA2|FLGI_SHEON RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|24349417|gb|AAN56240.1|AE015761_10 flagellar P-ring protein FlgI [Shewanella oneidensis MR-1]
          Length = 363

 Score =  395 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 153/365 (41%), Positives = 217/365 (59%), Gaps = 11/365 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           LIF++  L         RIKD+ ++Q  R+NQLIGYGLVVGL GTG+      +TEQ+  
Sbjct: 5   LIFAVFMLAFSMPSQAERIKDIANVQGVRNNQLIGYGLVVGLPGTGEKTN---YTEQTFT 61

Query: 68  SLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L+N GI+ P   R   KNVA V V A++P F  PG  +DV+++SLG+A SLRGG L+ 
Sbjct: 62  TMLKNFGINLPENFRPKIKNVAVVAVHADMPAFIKPGQELDVTVSSLGEAKSLRGGTLLQ 121

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           T L G DGN+YA+AQGS+VVSG    G   S  ++   T G+I NGAIVER +   F   
Sbjct: 122 TFLKGVDGNVYAIAQGSLVVSGFSADGLDGSKVIQNTPTVGRIPNGAIVERSVATPFSTG 181

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSE 244
             L   LR  DFSTA R+AD IN          +A   D+ +++VS P ++      ++ 
Sbjct: 182 DYLTFNLRRSDFSTAQRMADAINDL----LGPDMARPLDATSIQVSAPRDVSQRVSFLAT 237

Query: 245 VEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           +E + VE  +  A+VI+N RTGTIV+G NV++    V++G LTV I E  QV QPNA ++
Sbjct: 238 LENIEVEPAEESAKVIVNSRTGTIVVGQNVKLLPAAVTHGGLTVTIAEATQVSQPNALAN 297

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
             +TVT N+T      ++  F       L+ L+  +N +G     +++IL+ +K AGAL 
Sbjct: 298 GQTTVTSNSTINATESDRRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEALKVAGALH 357

Query: 364 SEIII 368
            E+II
Sbjct: 358 GELII 362


>gi|190890365|ref|YP_001976907.1| flagellar basal body P-ring protein [Rhizobium etli CIAT 652]
 gi|226701953|sp|B3PPM2|FLGI_RHIE6 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|190695644|gb|ACE89729.1| flagellar basal body P-ring protein [Rhizobium etli CIAT 652]
          Length = 373

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 232/371 (62%), Positives = 293/371 (78%), Gaps = 3/371 (0%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVV--SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS 58
           +   +  +    + L +++      SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  RS
Sbjct: 4   LFRFLTLVAVLAMSLADVAPAWALTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGFRS 63

Query: 59  SPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           SPFTEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSRIDV+++SLGDA+S
Sbjct: 64  SPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPFASPGSRIDVTVSSLGDATS 123

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           LRGG LVMTSL GADG IYAVAQG+V+VSG   +GQ+++  EG++T G++  GAI+EREL
Sbjct: 124 LRGGTLVMTSLSGADGQIYAVAQGAVIVSGFQAQGQAATVTEGVTTAGRVPGGAIIEREL 183

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL 238
           P +FKDS +L+LQLRNPDFSTAIRIAD +N Y+  RF  P+AEA DS+ V + KP   DL
Sbjct: 184 PSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRTADL 243

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           TRLM++VE L VETDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++QP
Sbjct: 244 TRLMADVENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQIIQP 303

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
             F S G T  Q  TD+      G  ++ID PDL +L++G+N+IG+K DGII+ILQGIK+
Sbjct: 304 EPF-SRGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGIKS 362

Query: 359 AGALQSEIIIQ 369
           AGALQ+E+++Q
Sbjct: 363 AGALQAELVLQ 373


>gi|116250484|ref|YP_766322.1| flagellar basal body P-ring protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|123082046|sp|Q1MLE7|FLGI_RHIL3 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|115255132|emb|CAK06206.1| putative flagellar P-ring protein precursor (basal body p-ring
           protein) [Rhizobium leguminosarum bv. viciae 3841]
          Length = 373

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 231/372 (62%), Positives = 293/372 (78%), Gaps = 5/372 (1%)

Query: 2   IFRIAFLIFSLIGLHEISAQVV----SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLR 57
           +F     + +++ +   +        SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  R
Sbjct: 3   LFFRFVTLVAVLAMSLANVAPAWALTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGFR 62

Query: 58  SSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           +SPFTEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSRIDV+++SLGDA+
Sbjct: 63  ASPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPFASPGSRIDVTVSSLGDAT 122

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SLRGG LVMTSL GADG IYAVAQG+V+VSG   +GQ+++  EG++T G++  GAI+ERE
Sbjct: 123 SLRGGTLVMTSLSGADGQIYAVAQGAVIVSGFQAQGQAATVTEGVTTAGRVPGGAIIERE 182

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           LP +FKDS +L+LQLRNPDFSTAIRIAD +N Y+  RF  P+AEA DS+ V + KP   D
Sbjct: 183 LPSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRAAD 242

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           LTRLM++VE L VETDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++Q
Sbjct: 243 LTRLMADVENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQIIQ 302

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           P  F S G T  Q  TD+      G  ++ID PDL +L++G+N+IG+K DGII+ILQGIK
Sbjct: 303 PEPF-SRGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGIK 361

Query: 358 AAGALQSEIIIQ 369
           +AGALQ+E+++Q
Sbjct: 362 SAGALQAELVLQ 373


>gi|153834468|ref|ZP_01987135.1| flagellar P-ring protein FlgI [Vibrio harveyi HY01]
 gi|156973591|ref|YP_001444498.1| flagellar basal body P-ring protein [Vibrio harveyi ATCC BAA-1116]
 gi|269961603|ref|ZP_06175965.1| flagellar P-ring protein FlgI [Vibrio harveyi 1DA3]
 gi|148869164|gb|EDL68196.1| flagellar P-ring protein FlgI [Vibrio harveyi HY01]
 gi|156525185|gb|ABU70271.1| hypothetical protein VIBHAR_01294 [Vibrio harveyi ATCC BAA-1116]
 gi|269833644|gb|EEZ87741.1| flagellar P-ring protein FlgI [Vibrio harveyi 1DA3]
          Length = 363

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 155/367 (42%), Positives = 223/367 (60%), Gaps = 13/367 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+  L      +    +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFTEQS 
Sbjct: 4   ILLALLSVALFATTAQAARIKDVAQVAGVRSNQLVGYGLVSGLPGTGES---NPFTEQSF 60

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRGG L+
Sbjct: 61  AAMLQNFGIQMPPGTKPKIKNVAAVMVTATLPPFSKPGQQVDVTVSSIGSAKSLRGGTLL 120

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
            T L G DG +YAVAQG++VVSG   +G   S  +    T G I +GA VERE+P  F  
Sbjct: 121 QTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPNPFGR 180

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMS 243
              +   L + DF+TA R+AD +N++        +A A D+ +V+V  P ++      +S
Sbjct: 181 GDYITFNLLDSDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDVSQRVAFLS 236

Query: 244 EVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN F 
Sbjct: 237 AIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPNGF- 295

Query: 303 SNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S G TV   ++D++V++ KG  F       L+ L+  +N +G     +++ILQ +K AGA
Sbjct: 296 SGGQTVVVPDSDIEVNEEKGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAGA 355

Query: 362 LQSEIII 368
           ++ ++II
Sbjct: 356 IEGQLII 362


>gi|240137199|ref|YP_002961668.1| flagella basal body P-ring protein [Methylobacterium extorquens
           AM1]
 gi|240007165|gb|ACS38391.1| flagella basal body P-ring protein [Methylobacterium extorquens
           AM1]
          Length = 375

 Score =  395 bits (1014), Expect = e-108,   Method: Composition-based stats.
 Identities = 182/358 (50%), Positives = 256/358 (71%), Gaps = 1/358 (0%)

Query: 12  LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
              +        +RIKD+ +L+  RDNQL GYGLV GLQGTGD+LR++ FTEQS++SLL 
Sbjct: 19  FAVMTGPVFAAGTRIKDIATLKGVRDNQLFGYGLVTGLQGTGDTLRNAQFTEQSLQSLLD 78

Query: 72  NLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
            LGI+    RL ++N+AAVMVTA+LPP+   GSRIDV++ S+GDA+SLRGG L+MTSL G
Sbjct: 79  RLGINVRDARLRTRNIAAVMVTADLPPYTGTGSRIDVTVTSMGDATSLRGGTLLMTSLTG 138

Query: 132 ADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQ 191
            DG +YA AQG + VSG  V+GQ+    +G+ T G+I NGA++ERE+P  F+D  +L+ +
Sbjct: 139 GDGLVYAAAQGPLAVSGFSVQGQAEQLTQGVPTAGRIPNGAMIEREVPGTFRDLPELVFE 198

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVE 251
           L+NPDF TA +IAD IN++SL  F R IA A D R V V +   +  TRL++++  LT++
Sbjct: 199 LKNPDFKTATQIADAINAWSLGAFGRRIASARDQRAVVVMRGRQMAQTRLVAQIGDLTIQ 258

Query: 252 TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
            DTPARV++++RTGT+VIG NV IS V V++GNLTV++TE  +V QP  F SNG TV   
Sbjct: 259 PDTPARVVVDQRTGTVVIGRNVTISTVAVTHGNLTVRVTEAPEVSQPEPF-SNGQTVVVP 317

Query: 312 NTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            T++   + +G  +++   DL +L+ G+N +GLK   II+ILQ +K AGALQ+E+++Q
Sbjct: 318 RTEVSAREERGKLAILGGSDLQTLVRGLNQVGLKPTDIIAILQAVKTAGALQAELVVQ 375


>gi|148266113|ref|YP_001232819.1| flagellar basal body P-ring protein [Geobacter uraniireducens Rf4]
 gi|189044484|sp|A5G8X8|FLGI_GEOUR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|146399613|gb|ABQ28246.1| flagellar P-ring protein [Geobacter uraniireducens Rf4]
          Length = 368

 Score =  395 bits (1014), Expect = e-108,   Method: Composition-based stats.
 Identities = 157/369 (42%), Positives = 225/369 (60%), Gaps = 8/369 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
                +  + + L      +  RIKD+ +    R+NQLIGYGLVVGL GTGDS   + F 
Sbjct: 4   IFRKIVFAAFLLLALPQFALAVRIKDIAAFDGVRENQLIGYGLVVGLNGTGDSD-QTKFP 62

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
            QS+ + L+ +GI+     +  KNVAAVMVTA LPPFA  G+ +DV ++S+GD+ SL GG
Sbjct: 63  VQSLVNTLERMGITINRADITVKNVAAVMVTAALPPFAKQGNSLDVLVSSVGDSKSLAGG 122

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L GAD  IYAVAQG V+ +     GQ++S  +   T G++  GA+VERELP   
Sbjct: 123 TLLMTPLKGADSQIYAVAQGGVLTNSFSYGGQAASVQKNHPTAGRVPGGALVERELPNVL 182

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTR 240
              + L L L  PDF+TA R+A  IN    N+F   +A   D  +V+++ P +       
Sbjct: 183 AGRSQLRLNLHQPDFTTASRVAAVIN----NKFKMTVASLTDPGSVQLAIPDDYQGKTVE 238

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
            ++ +E L V  D  ARV++NERTGTIVIG+NVRIS V VS+GNLT+ + E  +V QP  
Sbjct: 239 FVAALERLEVTPDVMARVVLNERTGTIVIGENVRISTVAVSHGNLTLYVKETPRVSQPAP 298

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           FSS G T     T +KV++++GS   L    ++  ++  +N++G+    +I I+Q IKAA
Sbjct: 299 FSSTGETKVVPRTSIKVTEDRGSLAILQQGANIGDVVRALNALGVTPRDLIGIMQAIKAA 358

Query: 360 GALQSEIII 368
           GAL +E+++
Sbjct: 359 GALNAELMV 367


>gi|28897557|ref|NP_797162.1| flagellar basal body P-ring protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153840136|ref|ZP_01992803.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ3810]
 gi|260364615|ref|ZP_05777217.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus K5030]
 gi|260878280|ref|ZP_05890635.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AN-5034]
 gi|260898110|ref|ZP_05906606.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus Peru-466]
 gi|260901958|ref|ZP_05910353.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ4037]
 gi|29611971|sp|Q9X9J4|FLGI2_VIBPA RecName: Full=Flagellar P-ring protein 2; AltName: Full=Basal body
           P-ring protein 2; Flags: Precursor
 gi|28805769|dbj|BAC59046.1| flagellar P-ring protein precursor FlgI [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149746244|gb|EDM57334.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ3810]
 gi|308086128|gb|EFO35823.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus Peru-466]
 gi|308090125|gb|EFO39820.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AN-5034]
 gi|308106774|gb|EFO44314.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ4037]
 gi|308115118|gb|EFO52658.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus K5030]
 gi|328473449|gb|EGF44297.1| flagellar basal body P-ring protein [Vibrio parahaemolyticus 10329]
          Length = 363

 Score =  395 bits (1014), Expect = e-108,   Method: Composition-based stats.
 Identities = 155/371 (41%), Positives = 226/371 (60%), Gaps = 14/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +   L+   + L   +A   +RIKDV  +   R NQL+GYGLV GL GTG+   ++PFT
Sbjct: 1   MKRIVLLLMSVALF-STAAQAARIKDVAQVAGVRSNQLVGYGLVSGLPGTGE---ANPFT 56

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQS  ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRG
Sbjct: 57  EQSFAAMLQNFGIQLPPGTKPKIKNVAAVMVTAELPPFSKPGQQVDVTVSSIGSAKSLRG 116

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DG +YAVAQG++VVSG   +G   S  +    T G I +GA VERE+P 
Sbjct: 117 GTLLQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPN 176

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L   DF+TA R+AD +N++        +A A D+ +V+V  P ++    
Sbjct: 177 PFGRGDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDVSQRV 232

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QP
Sbjct: 233 AFLSAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQP 292

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N+F S G TV   ++D++V++ KG  F       L+ L+  +N +G     +++ILQ +K
Sbjct: 293 NSF-SGGQTVVVPDSDIEVTEEKGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALK 351

Query: 358 AAGALQSEIII 368
            AGA++ ++II
Sbjct: 352 QAGAIEGQLII 362


>gi|218528668|ref|YP_002419484.1| flagellar basal body P-ring protein [Methylobacterium
           chloromethanicum CM4]
 gi|254559211|ref|YP_003066306.1| flagella basal body P-ring protein [Methylobacterium extorquens
           DM4]
 gi|218520971|gb|ACK81556.1| flagellar P-ring protein [Methylobacterium chloromethanicum CM4]
 gi|254266489|emb|CAX22253.1| flagella basal body P-ring protein [Methylobacterium extorquens
           DM4]
          Length = 375

 Score =  394 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 181/358 (50%), Positives = 256/358 (71%), Gaps = 1/358 (0%)

Query: 12  LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
              +        +RIKD+ +L+  RDNQL GYGLV GLQGTGD+LR++ FTEQS++SLL 
Sbjct: 19  FAVMTGPVFAAGTRIKDIATLKGVRDNQLFGYGLVTGLQGTGDTLRNAQFTEQSLQSLLD 78

Query: 72  NLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
            LGI+    RL ++N+AAVMVTA+LPP+   GSRIDV++ S+GDA+SLRGG L+MTSL G
Sbjct: 79  RLGINVRDARLRTRNIAAVMVTADLPPYTGTGSRIDVTVTSMGDATSLRGGTLLMTSLTG 138

Query: 132 ADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQ 191
            DG +YA AQG + VSG  V+GQ+    +G+ T G+I NGA++ERE+P  F+D  +L+ +
Sbjct: 139 GDGLVYAAAQGPLAVSGFSVQGQAEQLTQGVPTAGRIPNGAMIEREVPGTFRDLPELVFE 198

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVE 251
           L+NPDF TA +I+D IN++SL  F R IA A D R V V +   +  TRL++++  LT++
Sbjct: 199 LKNPDFKTATQISDAINAWSLGAFGRRIASARDQRAVVVMRGRQMAQTRLVAQIGDLTIQ 258

Query: 252 TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
            DTPARV++++RTGT+VIG NV IS V V++GNLTV++TE  +V QP  F SNG TV   
Sbjct: 259 PDTPARVVVDQRTGTVVIGRNVTISTVAVTHGNLTVRVTEAPEVSQPEPF-SNGQTVVVP 317

Query: 312 NTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            T++   + +G  +++   DL +L+ G+N +GLK   II+ILQ +K AGALQ+E+++Q
Sbjct: 318 RTEVSAREERGKLAILGGSDLQTLVRGLNQVGLKPTDIIAILQAVKTAGALQAELVVQ 375


>gi|315121845|ref|YP_004062334.1| flagellar basal body P-ring protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495247|gb|ADR51846.1| flagellar basal body P-ring protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 369

 Score =  394 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 322/369 (87%), Positives = 344/369 (93%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           MIFRIA  +FS I L+   AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP
Sbjct: 1   MIFRIALFVFSCIILNSTLAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTEQSMRSLLQNLGIST GG+LGSKN+AAVMVTANLPPFASPGSRIDVSINSLGDASSLR
Sbjct: 61  FTEQSMRSLLQNLGISTQGGKLGSKNIAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GGILVMTSL+GADGNIYAVAQGSVVVSG F+KG+ SS MEGI+TGGKIVNGAIVERELPK
Sbjct: 121 GGILVMTSLVGADGNIYAVAQGSVVVSGFFIKGELSSIMEGIATGGKIVNGAIVERELPK 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           KF+D+ DLILQLRNPDFST+IRIADQIN+YSL RF +PIAEA+DSRTVKVSKPTNIDLTR
Sbjct: 181 KFRDAIDLILQLRNPDFSTSIRIADQINTYSLGRFGKPIAEAHDSRTVKVSKPTNIDLTR 240

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           LMSE+EMLTVETDTPAR+IINERTGTIVIGDNVRISKVVVSYG+LTVQITEN QVVQPN 
Sbjct: 241 LMSEIEMLTVETDTPARIIINERTGTIVIGDNVRISKVVVSYGSLTVQITENRQVVQPNV 300

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            SS G T+ Q +TDL+  +NK  FSLIDAPDLNSLISGMNS+GLKTDGIISILQGIKAAG
Sbjct: 301 LSSGGKTLVQQSTDLQTFNNKSPFSLIDAPDLNSLISGMNSMGLKTDGIISILQGIKAAG 360

Query: 361 ALQSEIIIQ 369
           ALQSEIIIQ
Sbjct: 361 ALQSEIIIQ 369


>gi|86356314|ref|YP_468206.1| flagellar basal body P-ring protein [Rhizobium etli CFN 42]
 gi|123513034|sp|Q2KCF7|FLGI_RHIEC RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|86280416|gb|ABC89479.1| flagellar basal-body P-ring protein [Rhizobium etli CFN 42]
          Length = 373

 Score =  394 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 236/372 (63%), Positives = 292/372 (78%), Gaps = 4/372 (1%)

Query: 1   MIFRIAFLIFSLIGLHEISAQV---VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLR 57
           + FRI  L+  +       A      SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  R
Sbjct: 3   LFFRIVTLVAVVAMSLADMAPAWALTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGFR 62

Query: 58  SSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           SSPFTEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSR+DV+++SLGDA+
Sbjct: 63  SSPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPFASPGSRLDVTVSSLGDAT 122

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SLRGG LVMTSL GADG IYAVAQGSV+VSG   +GQ+++  EG++T G++  GAI+ERE
Sbjct: 123 SLRGGTLVMTSLSGADGQIYAVAQGSVIVSGFQAQGQAATVTEGVTTAGRVPGGAIIERE 182

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           LP  FKDS +L+LQLRNPDFSTAIRIAD +N Y+  RF  P+AEA DS+ V + KP   D
Sbjct: 183 LPSHFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRTAD 242

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           LTRLM++VE L VETDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++Q
Sbjct: 243 LTRLMADVENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQIIQ 302

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           P  F S G T  Q  TD+      G  ++ID PDL +L++G+N+IG+K DGII+ILQGIK
Sbjct: 303 PEPF-SRGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGIK 361

Query: 358 AAGALQSEIIIQ 369
           +AGALQ+E+++Q
Sbjct: 362 SAGALQAELVLQ 373


>gi|163802599|ref|ZP_02196491.1| flagellar P-ring protein precursor I [Vibrio sp. AND4]
 gi|159173682|gb|EDP58501.1| flagellar P-ring protein precursor I [Vibrio sp. AND4]
          Length = 363

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 155/367 (42%), Positives = 223/367 (60%), Gaps = 13/367 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+  L      +    +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFTEQS 
Sbjct: 4   ILLVLLSVALFATTAQAARIKDVAQVAGVRSNQLVGYGLVSGLPGTGES---NPFTEQSF 60

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRGG L+
Sbjct: 61  AAMLQNFGIQMPPGTKPKIKNVAAVMVTATLPPFSKPGQQVDVTVSSVGSAKSLRGGTLL 120

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
            T L G DG +YAVAQG++VVSG   +G   S  +    T G I +GA VERE+P  F  
Sbjct: 121 QTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPNPFGR 180

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMS 243
              +   L + DF+TA R+AD +N++        +A A D+ +V+V  P ++      +S
Sbjct: 181 GDYITFNLLDSDFTTAQRMADSVNNF----LGPQMASAVDATSVRVRAPRDVSQRVAFLS 236

Query: 244 EVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPN F 
Sbjct: 237 AIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPNGF- 295

Query: 303 SNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S G TV   ++D+++S+ KG  F       L+ L+  +N +G     +++ILQ +K AGA
Sbjct: 296 SGGQTVVVPDSDIEISEEKGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAGA 355

Query: 362 LQSEIII 368
           ++ ++II
Sbjct: 356 IEGQLII 362


>gi|188579869|ref|YP_001923314.1| flagellar basal body P-ring protein [Methylobacterium populi BJ001]
 gi|179343367|gb|ACB78779.1| flagellar P-ring protein [Methylobacterium populi BJ001]
          Length = 377

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 179/358 (50%), Positives = 255/358 (71%), Gaps = 1/358 (0%)

Query: 12  LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
              +        +RIKD+ +L+  RDNQ+ GYGLV GLQGTGD+LR++ FTEQS++SLL 
Sbjct: 21  FAVMTGPVFAAGTRIKDIATLKGVRDNQIFGYGLVTGLQGTGDTLRNAQFTEQSLQSLLD 80

Query: 72  NLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
            LGI+    RL ++N+AAVMVTA+LPP+   GSRIDV++ S+GDA+SLRGG L+MT L G
Sbjct: 81  RLGINVRDARLRTRNIAAVMVTADLPPYTGTGSRIDVTVTSMGDATSLRGGTLLMTPLTG 140

Query: 132 ADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQ 191
            DG +YA AQG + VSG  V+GQ+    +G+ T G+I NGA++ERE+P  F+D  +L+ +
Sbjct: 141 GDGLVYAAAQGPLAVSGFTVQGQAEQLTQGVPTAGRIPNGALIEREVPGTFRDLPELVFE 200

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVE 251
           L+NPDF TA +I+D IN++SL  F R IA A D R V V +   +  TRL++++  LT++
Sbjct: 201 LKNPDFKTATQISDAINAWSLGAFGRRIASARDQRAVVVMRSRQMAQTRLVAQIGDLTIQ 260

Query: 252 TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
            DTPARV++++RTGT+VIG NV IS V V++GNLTV++TE  +V QP  F SNG TV   
Sbjct: 261 PDTPARVVVDQRTGTVVIGRNVTISTVAVTHGNLTVRVTEAPEVSQPEPF-SNGQTVVVP 319

Query: 312 NTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            T++   + +G  +++   DL +L+ G+N +GLK   II+ILQ +K AGALQ+E+++Q
Sbjct: 320 RTEVAAREERGKLAILGGSDLQTLVRGLNQVGLKPTDIIAILQAVKTAGALQAELVVQ 377


>gi|269965420|ref|ZP_06179539.1| flagellar P-ring protein FlgI [Vibrio alginolyticus 40B]
 gi|269829899|gb|EEZ84129.1| flagellar P-ring protein FlgI [Vibrio alginolyticus 40B]
          Length = 363

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 155/371 (41%), Positives = 224/371 (60%), Gaps = 14/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +   LI   + L   +    +RIKDV  +   R NQL+GYGLV GL GTG+   ++PFT
Sbjct: 1   MKKLLLILMSVALF-STVAQAARIKDVAQVAGVRSNQLVGYGLVSGLPGTGE---ANPFT 56

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQS  ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRG
Sbjct: 57  EQSFAAMLQNFGIQMPPGTKPKIKNVAAVMVTAELPPFSKPGQQVDVTVSSIGSAKSLRG 116

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DG +YAVAQG++VVSG   +G   S  +    T G I +GA VERE+P 
Sbjct: 117 GTLLQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPN 176

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L   DF+TA R+AD +N++        +A A D+ +V+V  P ++    
Sbjct: 177 PFGRGDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDVSQRV 232

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QP
Sbjct: 233 AFLSAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQP 292

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N F S G TV   ++D++VS+ +G  F       L+ L+  +N +G     +++ILQ +K
Sbjct: 293 NGF-SGGQTVVVPDSDIEVSEEQGKMFKFEPGLTLDDLVRAVNQVGAAPSDLMAILQALK 351

Query: 358 AAGALQSEIII 368
            AGA++ ++II
Sbjct: 352 QAGAIEGQLII 362


>gi|212634352|ref|YP_002310877.1| flagellar basal body P-ring protein [Shewanella piezotolerans WP3]
 gi|212555836|gb|ACJ28290.1| Flagellar P-ring protein [Shewanella piezotolerans WP3]
          Length = 364

 Score =  393 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 153/372 (41%), Positives = 222/372 (59%), Gaps = 13/372 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+     L+ +++ +   S     RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   
Sbjct: 1   MMKLKLALLCAILVI--ASPVHAQRIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTR--- 55

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+ +++L+N GI+ P   R   KNVA V V+AN+PPF  PG  +DVS++SLG+A SL
Sbjct: 56  YTEQTFKTMLKNFGINLPDNFRPKIKNVAVVAVSANMPPFIKPGQTLDVSVSSLGEAKSL 115

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG+L+ T L G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGAI+ER +
Sbjct: 116 RGGMLLQTFLKGVDGNVYAIAQGSMVVSGFSAEGQDGSKVIQNTPTVGRIPNGAIIERTV 175

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R++D IN          +A   D+ +V+VS P ++  
Sbjct: 176 ATPFSTGDYLTFNLRRADFSTAKRLSDAINDL----LGPGMARPLDAASVQVSAPRDVSQ 231

Query: 238 LTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E + VE     A+VI+N RTGTIV+G +V++    V++G LTV I E  QV 
Sbjct: 232 RVSFLATLENIEVEPAAESAKVIVNSRTGTIVVGQDVKLLPAAVTHGGLTVTIAEATQVS 291

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPN F+   + VT ++T     D+   F       L+ L+  +N +G     +++IL+ +
Sbjct: 292 QPNPFAGGQTVVTTDSTIDVAEDDSRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEAL 351

Query: 357 KAAGALQSEIII 368
           K AGAL  E+II
Sbjct: 352 KMAGALHGELII 363


>gi|197335118|ref|YP_002156696.1| flagellar P-ring protein FlgI [Vibrio fischeri MJ11]
 gi|197316608|gb|ACH66055.1| flagellar P-ring protein FlgI [Vibrio fischeri MJ11]
          Length = 365

 Score =  393 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 150/372 (40%), Positives = 221/372 (59%), Gaps = 13/372 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + +    +        IS    +RIKDV  +   R NQLIGYGLV GL GTG+S   +PF
Sbjct: 1   MNKNLVTVLFTWLCLSISTAHAARIKDVAEVAGVRSNQLIGYGLVSGLPGTGES---TPF 57

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T+QS  ++LQN GI  P G +  +KNVAAVMVTA LPPF+  G  +DV+++S+G A SLR
Sbjct: 58  TDQSFNAMLQNFGIQLPPGTKPKTKNVAAVMVTATLPPFSKQGQVVDVTVSSVGSAKSLR 117

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+ T L G DG  YA+AQG+++VSG        S  +    T G+I  GA+VERE+P
Sbjct: 118 GGTLLQTFLKGLDGKTYAIAQGNLIVSGFSATGADGSKIVGNNPTVGRISGGAMVEREVP 177

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     +   L   DF+TA R+AD +N++        +A A D+ +V+V  P +I   
Sbjct: 178 SPFGRGDFITFNLLESDFTTAQRMADAVNNF----LGPNMASAVDATSVRVRAPRDISQR 233

Query: 239 TRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S VE +  +  D  A++I+N RTGTIV+G +V++    V++G +TV I EN QV Q
Sbjct: 234 VAFLSAVENVDFDPADGSAKIIVNSRTGTIVVGKHVKLKPAAVTHGGMTVAIKENLQVSQ 293

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P  F S+G TV   ++D++V++ +G  F       L+ L+  +N +G     +++ILQ +
Sbjct: 294 PGPF-SDGQTVVTPDSDIEVTEEQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQAL 352

Query: 357 KAAGALQSEIII 368
           K AGA++ ++II
Sbjct: 353 KQAGAIEGQLII 364


>gi|78221655|ref|YP_383402.1| flagellar basal body P-ring protein [Geobacter metallireducens
           GS-15]
 gi|115311522|sp|Q39YJ7|FLGI_GEOMG RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|78192910|gb|ABB30677.1| Flagellar P-ring protein [Geobacter metallireducens GS-15]
          Length = 365

 Score =  393 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 223/369 (60%), Gaps = 8/369 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
                +    + L      +  RIKD+ S    R+NQLIGYGLVVGL GTGDS   + F 
Sbjct: 1   MIKRIISIVFLLLTLPQLALAVRIKDIASFDGVRENQLIGYGLVVGLNGTGDSD-QTNFP 59

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
            QS+ ++L+ +G++     +  KNVAAVMVTANLPPFA  G+RID  ++S+GDA S+ GG
Sbjct: 60  VQSLANVLERMGVTVNRNDITVKNVAAVMVTANLPPFAKQGTRIDTLVSSMGDAKSIAGG 119

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L GADG +YAVAQG V+ +     GQ++S  +   T G++ NG +VE ELP   
Sbjct: 120 TLLMTPLKGADGRVYAVAQGGVLTNSFSYGGQAASAQKNHPTAGRVPNGGLVELELPNVL 179

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTR 240
            D   L L L  PDF+TA RIA  +N     RF   +A A D   V ++ P      +  
Sbjct: 180 SDRGQLRLNLHQPDFTTATRIAQAVNE----RFKGGVAAATDPGAVMMNLPEAYKGRVVE 235

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
            ++++E L V  D  A+V++NERTGTIVIGDNVRIS V VS+GNLT+ I E  +V QP  
Sbjct: 236 FVADMERLEVRPDAMAKVVLNERTGTIVIGDNVRISTVAVSHGNLTLYIKETPKVSQPAP 295

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           FS  G TV    T++KV++  G    + +   +  ++  +N++G+    +I ILQ IKAA
Sbjct: 296 FSKTGETVVVPRTEIKVNEGGGGLAVVKEGASIGEVVRALNALGVTPRDLIGILQAIKAA 355

Query: 360 GALQSEIII 368
           GA+Q+E+ +
Sbjct: 356 GAMQAEVEV 364


>gi|5361012|gb|AAD42919.1|U12817_13 polar flagellar FlgI homolog [Vibrio parahaemolyticus]
          Length = 363

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 154/371 (41%), Positives = 225/371 (60%), Gaps = 14/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +   L+   + L   +A   +RIKDV  +   R NQL+GYGLV GL GTG+   ++PFT
Sbjct: 1   MKRIVLLLMSVALF-STAAQAARIKDVAQVAGVRSNQLVGYGLVSGLPGTGE---ANPFT 56

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQS  ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRG
Sbjct: 57  EQSFAAMLQNFGIQLPPGTKPKIKNVAAVMVTAELPPFSKPGQQVDVTVSSIGSAKSLRG 116

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DG +YAVAQG++VVSG   +G   S  +    T G I +GA VERE+P 
Sbjct: 117 GTLLQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPN 176

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L   DF+TA R+AD +N++        +A A D+ +V+V  P ++    
Sbjct: 177 PFGRGDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDVSQRV 232

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QP
Sbjct: 233 AFLSAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQP 292

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N+F S G TV   ++D++V++ KG  F       L+  +  +N +G     +++ILQ +K
Sbjct: 293 NSF-SGGQTVVVPDSDIEVTEEKGKMFKFEPGLTLDDFVRAVNEVGAAPSDLMAILQALK 351

Query: 358 AAGALQSEIII 368
            AGA++ ++II
Sbjct: 352 QAGAIEGQLII 362


>gi|241203108|ref|YP_002974204.1| flagellar basal body P-ring protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856998|gb|ACS54665.1| flagellar P-ring protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 373

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 230/372 (61%), Positives = 291/372 (78%), Gaps = 5/372 (1%)

Query: 2   IFRIAFLIFSLIGLHEISAQVV----SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLR 57
           +F     + +++ +            SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  R
Sbjct: 3   LFFRFVTLVAVLAMSLADVVPAWALTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGFR 62

Query: 58  SSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           SSPFTEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSRIDV+++SLGDA+
Sbjct: 63  SSPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPFASPGSRIDVTVSSLGDAT 122

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SLRGG LVMTSL GADG IYAVAQG+ +VSG   +GQ+++  EG++T G++  GAI+ERE
Sbjct: 123 SLRGGTLVMTSLSGADGQIYAVAQGAAIVSGFQAQGQAATVTEGVTTAGRVPGGAIIERE 182

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           LP +FKDS +L+LQLRNPDFSTAIRIAD +N Y+  RF  P+AEA DS+ V + KP   D
Sbjct: 183 LPSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRTAD 242

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           LTRLM+++E L VETDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++Q
Sbjct: 243 LTRLMADIENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQIIQ 302

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           P  F S G T  Q  TD+      G  ++ID PDL +L++G+N+IG+K DGII+ILQGIK
Sbjct: 303 PEPF-SQGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGIK 361

Query: 358 AAGALQSEIIIQ 369
           +AGALQ+E+++Q
Sbjct: 362 SAGALQAELVLQ 373


>gi|209964695|ref|YP_002297610.1| flagellar P-ring protein FlgI [Rhodospirillum centenum SW]
 gi|209958161|gb|ACI98797.1| flagellar P-ring protein FlgI [Rhodospirillum centenum SW]
          Length = 395

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 171/354 (48%), Positives = 236/354 (66%), Gaps = 8/354 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
            A+  SRIKDV  ++  RDN L+GYGLVVGL GTGDS+ +SPFTEQS+  +L+ LG++  
Sbjct: 45  PARAQSRIKDVADVEGVRDNMLVGYGLVVGLNGTGDSINNSPFTEQSLIGMLERLGVNIR 104

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           G  + ++NVAAVMVTA LPPF++ G+RIDV++ +LGDA +L+GG L++T LLGADG +YA
Sbjct: 105 GETVRTRNVAAVMVTATLPPFSAQGTRIDVNVGTLGDAKNLQGGTLLVTPLLGADGEVYA 164

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           VAQG+V VSG   +G ++S   G+ T G+I  GAIVERE+     D   + L LRNPDF+
Sbjct: 165 VAQGAVAVSGFSAQGAAASVTRGVPTAGRIAGGAIVEREIAFDLTDLPYVRLSLRNPDFT 224

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN--IDLTRLMSEVEMLTVETDTPA 256
           TA RI++ IN+     F  P+A A D  +V V  P     D+   + ++E L V  D PA
Sbjct: 225 TAKRISESINA----SFGSPVAHATDPASVLVDVPPQRKADIVGFIRDMEQLRVTPDQPA 280

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV+I+E +G IV+G+NVRIS V ++ GNLT++ITE  QV QP   S  G T     TD++
Sbjct: 281 RVVIDEASGVIVMGENVRISTVAIAQGNLTIRITETPQVSQPGPLSQGGQTAVVPRTDIQ 340

Query: 317 VSD--NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           V +  ++    L     L  L+  +N++G+    +ISILQ IKAAGALQ+EI +
Sbjct: 341 VDEQSDRKLAVLRTGVSLQELVQSLNALGVGPRDMISILQSIKAAGALQAEIEV 394


>gi|82702457|ref|YP_412023.1| flagellar basal body P-ring protein [Nitrosospira multiformis ATCC
           25196]
 gi|115311524|sp|Q2Y9E0|FLGI_NITMU RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|82410522|gb|ABB74631.1| Flagellar P-ring protein [Nitrosospira multiformis ATCC 25196]
          Length = 377

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 146/367 (39%), Positives = 210/367 (57%), Gaps = 8/367 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
            AF                 RIKD+ S+Q  R NQLIGYGLVVGL GTGD    +PFT Q
Sbjct: 15  FAFFCAWAGLWTFSLPVQAERIKDLASIQGIRPNQLIGYGLVVGLDGTGDQTVQTPFTIQ 74

Query: 65  SMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           S+ ++L  LGI+ P G  +  +NVAAVMVTA LPP A PG  IDV+++S+G+A SLRGG 
Sbjct: 75  SLNNMLMQLGINVPPGTNMRLRNVAAVMVTAALPPLAQPGQAIDVTVSSMGNARSLRGGT 134

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L+MT L G DG +Y VAQG+++V G+      S         G+I  GA VER +P    
Sbjct: 135 LLMTPLKGIDGQVYGVAQGNLLVGGIGAAASGSKVQVNHLNAGRIPGGATVERAVPVALG 194

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
            +  + L+L   DFSTA RI D +N+    RF    A A D R ++V  P         +
Sbjct: 195 QNDMIRLELNTIDFSTAKRIVDAVNT----RFGMGTAAALDGRAIQVRTPPESDQRVAFL 250

Query: 243 SEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           +E+E L +     PARVI+N RTG++V+     + +  +++GNLTV I+    + QP  F
Sbjct: 251 AEMESLAINPAQMPARVIVNSRTGSVVMNQAATVDQCAIAHGNLTVVISTEPVISQPGPF 310

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           SS G TV    + +++    G  ++++   L  ++  +N+IG     +++ILQ +K+AGA
Sbjct: 311 SS-GRTVQAQRSTIEIKQESGMLTMVEGASLAEVVKALNAIGATPQDLLAILQAMKSAGA 369

Query: 362 LQSEIII 368
           L++E+ I
Sbjct: 370 LRAELEI 376


>gi|319781679|ref|YP_004141155.1| flagellar P-ring protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167567|gb|ADV11105.1| flagellar P-ring protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 413

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 200/354 (56%), Positives = 266/354 (75%), Gaps = 1/354 (0%)

Query: 16  HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI 75
                QV SRIKD+  LQS RDNQL+GYGLV+GL G+GDSLR+SPFTEQS+R++L+NLGI
Sbjct: 61  SLPPGQVASRIKDIAQLQSSRDNQLVGYGLVIGLAGSGDSLRNSPFTEQSIRAMLENLGI 120

Query: 76  STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
           +T GG   +KNVAAV+VTAN+PP+   G+RID+ ++S+GDA+SL GG L+MT L  ADG 
Sbjct: 121 ATEGGSARAKNVAAVIVTANMPPYVQSGARIDIDVSSMGDATSLSGGTLIMTPLKAADGE 180

Query: 136 IYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           IYAV QGSV+VSG   +GQ+    +G+ T G++ NGAIVER +  +F D A L LQLRNP
Sbjct: 181 IYAVGQGSVIVSGFTAQGQAEQLTQGVPTAGRVPNGAIVERAVQAEFDDQAILTLQLRNP 240

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTP 255
           DFSTAIRIAD IN Y+  RF   +A   DSRTV++ +P  +   R  +E+E L VE+DTP
Sbjct: 241 DFSTAIRIADAINDYTGQRFGMRVAAERDSRTVQIRRPKGVSAARFYAEIENLVVESDTP 300

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           ARV+I+ERTGTIVIG++V+IS+V +S+G LTV+ITE  +VVQP  FS  G T  +  T +
Sbjct: 301 ARVVIDERTGTIVIGNDVKISRVAISHGTLTVRITEAPRVVQPEPFSK-GETAIEPFTAI 359

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
             S      +++D PDL +L+SG+N +G+K DGII+ILQGIK+AGALQ+++++Q
Sbjct: 360 DASRPDARVAVLDGPDLQTLVSGLNRLGVKPDGIIAILQGIKSAGALQADLVLQ 413


>gi|209547930|ref|YP_002279847.1| flagellar basal body P-ring protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226701954|sp|B5ZQE0|FLGI_RHILW RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|209533686|gb|ACI53621.1| flagellar P-ring protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 373

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 228/372 (61%), Positives = 291/372 (78%), Gaps = 5/372 (1%)

Query: 2   IFRIAFLIFSLIGLHEISAQVV----SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLR 57
           +F     + +++ +            SRIKD+ SLQ+GRDNQLIGYGL+VGLQGTGD  R
Sbjct: 3   LFFRFLTLVAVLAMSLADVAPAWALTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDGFR 62

Query: 58  SSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           +SPFTEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSRIDV+++SLGDA+
Sbjct: 63  ASPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPFASPGSRIDVTVSSLGDAT 122

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SLRGG LVMTSL GADG IYAVAQG+ +V+G   +GQ+++  EG++T G++  GAI+ERE
Sbjct: 123 SLRGGTLVMTSLSGADGQIYAVAQGAAIVTGFQAQGQAATVTEGVTTAGRVPGGAIIERE 182

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           LP +FKDS +L+LQLRNPDFSTAIRIAD +N Y+  RF  P+AEA DS+ V + KP   D
Sbjct: 183 LPSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRTAD 242

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           LTRLM+++E L VETDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ+TE  Q++Q
Sbjct: 243 LTRLMADIENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQIIQ 302

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           P  F S G T  Q  TD+      G  ++ID PDL +L++G+N+IG+K DGII+ILQGIK
Sbjct: 303 PEPF-SQGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGIK 361

Query: 358 AAGALQSEIIIQ 369
           +AGALQ+E+++Q
Sbjct: 362 SAGALQAELVLQ 373


>gi|325291937|ref|YP_004277801.1| flagellar basal body P-ring protein [Agrobacterium sp. H13-3]
 gi|325059790|gb|ADY63481.1| flagellar basal body P-ring protein [Agrobacterium sp. H13-3]
          Length = 373

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 227/371 (61%), Positives = 293/371 (78%), Gaps = 3/371 (0%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVS--RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS 58
           +    A L+ S +             RIKD+ SLQ+GRDNQLIGYGLVVGLQGTGDSLRS
Sbjct: 4   LRILCAALVISALPFLSTPPAQADTSRIKDIASLQAGRDNQLIGYGLVVGLQGTGDSLRS 63

Query: 59  SPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           SPFTEQSMR++LQNLGI+T GG+  +KN+AAVMVTANLPPFASPGSR+DV+++SLGDASS
Sbjct: 64  SPFTEQSMRAMLQNLGITTQGGQSNAKNIAAVMVTANLPPFASPGSRVDVTVSSLGDASS 123

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           LRGG L+MTSL GADG IYAVAQG+++V+G   +G +++  +G++T  ++ NGAI+EREL
Sbjct: 124 LRGGNLIMTSLSGADGQIYAVAQGALIVNGFSAQGDAATLTQGVTTSARVPNGAIIEREL 183

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL 238
           P KFKDS +L+LQLRNPDFSTA+R+AD +N+++  R+   IAE  DS+ + V KP   DL
Sbjct: 184 PSKFKDSVNLVLQLRNPDFSTAVRVADVVNAFARARYGDGIAEPRDSQEISVQKPRTADL 243

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           TRLM+E+E LTV+TDTPA+V+INERTGTIVIG +VRIS+V VSYG LTVQ+TE+ QV+QP
Sbjct: 244 TRLMAEIENLTVQTDTPAKVVINERTGTIVIGADVRISRVAVSYGTLTVQVTESPQVIQP 303

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
             F S G T  Q  TD+         ++++ PDL +L++G+NSIGLK DGII+ILQGIK+
Sbjct: 304 APF-SRGETAVQPQTDIMALQEGSKVAIVEGPDLRTLVAGLNSIGLKADGIIAILQGIKS 362

Query: 359 AGALQSEIIIQ 369
           AGALQ+E+++Q
Sbjct: 363 AGALQAELVLQ 373


>gi|113969610|ref|YP_733403.1| flagellar basal body P-ring protein [Shewanella sp. MR-4]
 gi|123325186|sp|Q0HKS1|FLGI_SHESM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|113884294|gb|ABI38346.1| flagellar P-ring protein [Shewanella sp. MR-4]
          Length = 363

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 156/365 (42%), Positives = 216/365 (59%), Gaps = 11/365 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           LI ++  L         RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   +TEQ+  
Sbjct: 5   LILAVAMLAFSLPSQAERIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTR---YTEQTFT 61

Query: 68  SLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L+N GI+ P   R   KNVA V V A++P F  PG  +DV+++SLG+A SLRGG L+ 
Sbjct: 62  TMLKNFGINLPDNFRPKIKNVAVVAVHADMPAFIKPGQELDVTVSSLGEAKSLRGGTLLQ 121

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           T L G DGN+YA+AQGS+VVSG    G   S  ++   T G+I NGAIVER +   F   
Sbjct: 122 TFLKGVDGNVYAIAQGSLVVSGFSADGLDGSKVIQNTPTVGRIPNGAIVERSVATPFSTG 181

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSE 244
             L   LR  DFSTA R+AD IN          +A   D+ +V+VS P ++      ++ 
Sbjct: 182 DYLTFNLRRSDFSTAQRMADAINDL----LGPDMARPLDATSVQVSAPRDVSQRVSFLAT 237

Query: 245 VEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           +E + VE  D  A+VI+N RTGTIV+G NV++    V++G LTV I E  QV QPNA ++
Sbjct: 238 LENIEVEPADESAKVIVNSRTGTIVVGQNVKLLPAAVTHGGLTVTIAEATQVSQPNALAN 297

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
             +TVT N+T      N+  F       L+ L+  +N +G     +++IL+ +K AGAL 
Sbjct: 298 GQTTVTSNSTINASESNRRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEALKVAGALH 357

Query: 364 SEIII 368
            E+II
Sbjct: 358 GELII 362


>gi|91225877|ref|ZP_01260846.1| flagellar P-ring protein precursor I [Vibrio alginolyticus 12G01]
 gi|91189527|gb|EAS75803.1| flagellar P-ring protein precursor I [Vibrio alginolyticus 12G01]
          Length = 363

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 155/371 (41%), Positives = 224/371 (60%), Gaps = 14/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +   L+   + L   +    +RIKDV  +   R NQL+GYGLV GL GTG+   ++PFT
Sbjct: 1   MKKLLLVLMSVALF-STVAQAARIKDVAQVAGVRSNQLVGYGLVSGLPGTGE---ANPFT 56

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQS  ++LQN GI  P G +   KNVAAVMVTA LPPF+ PG ++DV+++S+G A SLRG
Sbjct: 57  EQSFAAMLQNFGIQMPPGTKPKIKNVAAVMVTAELPPFSKPGQQVDVTVSSIGSAKSLRG 116

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DG +YAVAQG++VVSG   +G   S  +    T G I +GA VERE+P 
Sbjct: 117 GTLLQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPN 176

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L   DF+TA R+AD +N++        +A A D+ +V+V  P ++    
Sbjct: 177 PFGRGDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSVRVRAPRDVSQRV 232

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QP
Sbjct: 233 AFLSAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQP 292

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N F S G TV   ++DL+VS+ +G  F       L+ L+  +N +G     +++ILQ +K
Sbjct: 293 NGF-SGGQTVVVPDSDLEVSEEQGKMFKFEPGLTLDDLVRAVNQVGAAPSDLMAILQALK 351

Query: 358 AAGALQSEIII 368
            AGA++ ++II
Sbjct: 352 QAGAIEGQLII 362


>gi|13472578|ref|NP_104145.1| flagellar basal body P-ring protein [Mesorhizobium loti MAFF303099]
 gi|14023324|dbj|BAB49931.1| flagellar P-ring protein; FlgI [Mesorhizobium loti MAFF303099]
          Length = 362

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 198/354 (55%), Positives = 266/354 (75%), Gaps = 1/354 (0%)

Query: 16  HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI 75
                QV SRIKD+  LQS RDNQL+GYGLV+GL G+GDSLR+SPFTEQS+R++L+NLGI
Sbjct: 10  SLPPGQVASRIKDIAQLQSSRDNQLVGYGLVIGLAGSGDSLRNSPFTEQSIRAMLENLGI 69

Query: 76  STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
           +T GG   +KNVAAV+VTAN+PP+   G+RID+ ++S+GDA+SL GG L+MT L  ADG 
Sbjct: 70  ATEGGSARAKNVAAVIVTANMPPYVQSGARIDIDVSSMGDATSLAGGTLIMTPLKAADGE 129

Query: 136 IYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           IYAV QG+V+VSG   KGQ+    +G+ T G++ NGAIVER +  +F D + L LQLRNP
Sbjct: 130 IYAVGQGAVIVSGFTAKGQAEQLTQGVPTAGRVPNGAIVERSVKAEFDDQSTLTLQLRNP 189

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTP 255
           DFSTAIRIAD IN Y+  RF   +A   DSRTV++ +P  +   R  +E+E L VE+DTP
Sbjct: 190 DFSTAIRIADAINDYTSQRFGMRVAGERDSRTVQIRRPKGVSAARFYAEIENLVVESDTP 249

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           ARV+I+ERTGTIVIG++V+IS+V +S+G LTV+ITE  +VVQP  FS  G T  +  T +
Sbjct: 250 ARVVIDERTGTIVIGNDVKISRVAISHGTLTVRITEAPRVVQPEPFSK-GETAVEPFTAI 308

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
             +      +++D PDL +L+SG+N +G+K DGII+ILQGIK+AGALQ+++++Q
Sbjct: 309 DATRPDARVAVLDGPDLQTLVSGLNRLGVKPDGIIAILQGIKSAGALQADLVLQ 362


>gi|294140189|ref|YP_003556167.1| flagellar P-ring protein FlgI [Shewanella violacea DSS12]
 gi|293326658|dbj|BAJ01389.1| flagellar P-ring protein FlgI [Shewanella violacea DSS12]
          Length = 363

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 152/366 (41%), Positives = 218/366 (59%), Gaps = 13/366 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
            I+ L+           RIKD+ ++Q  R NQLIGYG+VVGL GTG+  R   +TEQ+ +
Sbjct: 5   FIYLLLLFFVAGPSQAQRIKDIANVQGVRHNQLIGYGMVVGLPGTGEKTR---YTEQTFK 61

Query: 68  SLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L+N GI+ P   R   KN+A V V A++PPF  PG  +DV+++SLG+A SLRGG L+ 
Sbjct: 62  TMLKNFGINLPDNFRPKIKNIAVVAVHADMPPFIKPGQTLDVTVSSLGEAKSLRGGTLIQ 121

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           T L G DGN+YA+AQGS+VVSG   +G   S  +    T G+I NGAI+ER +   F   
Sbjct: 122 TFLKGVDGNVYAIAQGSMVVSGFSAEGLDGSKVIRNTPTVGRIPNGAIIERAVATPFSSG 181

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSE 244
             L   LR  DFSTA R+AD IN          +A   D+ +V+VS P ++      ++ 
Sbjct: 182 DYLTFNLRRADFSTAKRLADAINEL----LGPGMARPLDAASVQVSAPRDVSQRVSFLAT 237

Query: 245 VEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           +E + VE  D  A+VI+N RTGTIV+G NVR+    V++G LTV I E  QV QPNA  +
Sbjct: 238 LENIQVEPADESAKVIVNSRTGTIVVGKNVRLLAAAVTHGGLTVTIAEATQVSQPNAL-A 296

Query: 304 NGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G TV   ++ + V++ ++  F       L+ L+  +N +G     +++IL+ +K AGAL
Sbjct: 297 GGQTVVTTDSTIDVNESDRRMFLFSPGTTLDELVRAVNLVGAAPSDVLAILEALKVAGAL 356

Query: 363 QSEIII 368
             E+II
Sbjct: 357 HGELII 362


>gi|110632654|ref|YP_672862.1| flagellar basal body P-ring protein [Mesorhizobium sp. BNC1]
 gi|110283638|gb|ABG61697.1| flagellar P-ring protein [Chelativorans sp. BNC1]
          Length = 369

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 196/370 (52%), Positives = 265/370 (71%), Gaps = 2/370 (0%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVV-SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           MI R       L      +     ++IK +  LQ+ RDNQL+GYGLV+GL  TGDSLR++
Sbjct: 1   MILRAFLWGLMLFLAAAPAGAASKTQIKHIAQLQAARDNQLVGYGLVIGLNRTGDSLRNA 60

Query: 60  PFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           PFTEQSMR++LQNLGI++  GR  ++NVAAV+VTANLPPF   G+RIDV+++SLGDASSL
Sbjct: 61  PFTEQSMRAMLQNLGIASEDGRSRAENVAAVIVTANLPPFVQSGARIDVTVSSLGDASSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
            GG LVMT L  ADG IYAVAQGSV+VSG   +GQ+ +  +G+ T G++ NGAI+ER + 
Sbjct: 121 AGGTLVMTPLRAADGEIYAVAQGSVIVSGFNAQGQAETLTQGVPTSGRVPNGAIIERSVT 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT 239
             F +   L LQLRNPDFSTA+R+AD +N+Y+   F  P+A   DSRTV + KP  +   
Sbjct: 181 ASFDELLALTLQLRNPDFSTAVRVADVVNAYTSRHFGAPLASEQDSRTVIIKKPKGVSAA 240

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
           R  +++E L VE D PARV+++ERTGT+VIG +VRIS+V +S+G LTV++TE  +VVQP 
Sbjct: 241 RFYAQIENLPVEVDAPARVVVDERTGTVVIGSDVRISRVAISHGALTVRVTEMPRVVQPE 300

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
            F S G T  +  T +  +    S +++D PDL +L+SG+N +G+K DGII+ILQGIK+A
Sbjct: 301 PF-SRGETAVEPYTVIDATQPDASVAVLDGPDLQTLVSGLNRLGVKPDGIIAILQGIKSA 359

Query: 360 GALQSEIIIQ 369
           GALQ E+++Q
Sbjct: 360 GALQGELVLQ 369


>gi|258404730|ref|YP_003197472.1| flagellar P-ring protein [Desulfohalobium retbaense DSM 5692]
 gi|257796957|gb|ACV67894.1| flagellar P-ring protein [Desulfohalobium retbaense DSM 5692]
          Length = 369

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 143/364 (39%), Positives = 220/364 (60%), Gaps = 9/364 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           ++   + +        +RIKD+  L+  R NQ++GYGLVVGL  TGDS   + FT++++ 
Sbjct: 11  ILVLCLAMVWTLPATAARIKDIADLKGVRTNQILGYGLVVGLNDTGDSS-GTGFTKETLA 69

Query: 68  SLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           ++L+ L IS+    +   NVAAVMVTA LPPF   GS +DV ++S+GDA SL GG L+ T
Sbjct: 70  NMLERLNISSNREDINVGNVAAVMVTAELPPFVKTGSPVDVLVSSIGDAESLSGGTLLQT 129

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD 187
            L G DG +YAVAQG + V G+ V GQ+    +   T G++ +GA VERE+P  F     
Sbjct: 130 PLSGPDGKVYAVAQGPLSVGGISVSGQAGQVQKNHPTVGRVPDGATVEREVPYSFPQKGP 189

Query: 188 LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEV 245
           L   ++  DF+T  RI   IN      + +  A A DS + +V  P     +  + ++++
Sbjct: 190 LTYHIQESDFTTISRITSVINE----EYGQKTAHAMDSASFRVRIPDAFAENRVKFIADL 245

Query: 246 EMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
           E LTV+ D+ ARV++NERTGTIV+G +VR+ KV V++GNL + + E  QV QP  F S G
Sbjct: 246 ERLTVQPDSKARVVVNERTGTIVMGQDVRLDKVAVAHGNLKLMVREMPQVSQPQPF-SQG 304

Query: 306 STVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
            T T   T+++V + +    +++   ++  + + +N+IG     +I+I Q IKAAGAL +
Sbjct: 305 ETTTVPRTEVQVEEEEARLMVMNKGVNIGDVAAALNAIGATPRDLIAIFQAIKAAGALHA 364

Query: 365 EIII 368
           E+++
Sbjct: 365 ELVL 368


>gi|127512283|ref|YP_001093480.1| flagellar basal body P-ring protein [Shewanella loihica PV-4]
 gi|166214839|sp|A3QCM3|FLGI_SHELP RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|126637578|gb|ABO23221.1| flagellar P-ring protein [Shewanella loihica PV-4]
          Length = 363

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 152/371 (40%), Positives = 222/371 (59%), Gaps = 14/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +I  ++   + +   +A    RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   +T
Sbjct: 1   MKIKLILACALMVF-SAASSAQRIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTR---YT 56

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQ+ +++L+N GI+ P   R   KNVA V V+A++P F  PG  +DV+++SLG+A SLRG
Sbjct: 57  EQTFKTMLKNFGINLPDNFRPKIKNVAVVAVSADMPAFIKPGQTLDVTVSSLGEAKSLRG 116

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGAIVER +  
Sbjct: 117 GTLLQTFLKGVDGNVYAIAQGSMVVSGFSAEGLDGSKVIQNTPTVGRIPNGAIVERTVAT 176

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     L   LR  DFSTA R+AD IN          +A   D+ +V+VS P ++    
Sbjct: 177 PFSTGDHLTFNLRRADFSTAKRLADAINDL----LGPGMARPLDAASVQVSAPRDVSQRV 232

Query: 240 RLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++ +E + VE  +  A+VI+N RTGTIV+G +VR+    V++G LTV I E  QV QP
Sbjct: 233 SFLATLENIEVEPASESAKVIVNSRTGTIVVGKDVRLLPAAVTHGGLTVTIAEATQVSQP 292

Query: 299 NAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N   + G TV  +++ + VS+ +   F       L+ L+  +N +G     +++IL+ +K
Sbjct: 293 NPL-AGGDTVVTSDSTIDVSEADNRMFLFNPGTTLDELVRAVNLVGAAPSDVLAILEALK 351

Query: 358 AAGALQSEIII 368
            AGAL  E+II
Sbjct: 352 VAGALHGELII 362


>gi|323498416|ref|ZP_08103412.1| flagellar basal body P-ring protein [Vibrio sinaloensis DSM 21326]
 gi|323316489|gb|EGA69504.1| flagellar basal body P-ring protein [Vibrio sinaloensis DSM 21326]
          Length = 363

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 153/372 (41%), Positives = 223/372 (59%), Gaps = 15/372 (4%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++  LI S + L  ++    +RIKDV  +   R NQL+GYGLV GL GTG+S   +PF
Sbjct: 1   MKKLILLIASTLLL--VTQAHAARIKDVAQVAGVRSNQLVGYGLVTGLPGTGES---TPF 55

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T+QS  ++LQ+ GI  P G +  +KNVAAV+VTA LP F+  G  IDV+++S+G A SLR
Sbjct: 56  TDQSFNAMLQSFGIQLPPGTKPKTKNVAAVIVTAELPAFSKQGQTIDVTVSSIGSAKSLR 115

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+ T L G DG +YAVAQG++VVSG        S  +    T G I NGA+VERE+P
Sbjct: 116 GGTLMQTMLKGLDGQVYAVAQGNLVVSGFSATGADGSKIVGNNPTAGMISNGAMVEREIP 175

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     +   L   DF+TA R+AD +N++        +A A D+ ++KV  P +I   
Sbjct: 176 SPFGRGDYITFNLLESDFTTAQRMADAVNNF----LGPQMASAVDATSIKVRAPRDISQR 231

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S +E L        A++I+N RTGTIV+G +VR+    V++G +TV I EN  V Q
Sbjct: 232 VAFLSAIENLEFNPAEGSAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQ 291

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF   G TV   +TD++V++ +G  F       L+ L+  +N +G     +++ILQ +
Sbjct: 292 PNAF-GGGETVVVPDTDIQVTEEQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQAL 350

Query: 357 KAAGALQSEIII 368
           K AGA++ ++II
Sbjct: 351 KQAGAIEGQLII 362


>gi|317153841|ref|YP_004121889.1| flagellar P-ring protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316944092|gb|ADU63143.1| flagellar P-ring protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 383

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 149/367 (40%), Positives = 231/367 (62%), Gaps = 8/367 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
            +   + ++  +        +R+KD+ S    R N L+GYGLVVGL GTGD   SS FT 
Sbjct: 22  LVVAFVLAVSLVAAPGEASAARLKDIASFSGVRTNDLVGYGLVVGLSGTGDGT-SSTFTL 80

Query: 64  QSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           QSM ++LQ +G+     +L  KNVAA MVTA LP  A PGS IDV+++SLGDA SL GG+
Sbjct: 81  QSMSNMLQKMGVEADPSKLKPKNVAAAMVTARLPVSAKPGSTIDVTVSSLGDAKSLLGGV 140

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L++T L G DG +YAV+QG + + G  V G++++  + I T G+I NGA+VER++P KF 
Sbjct: 141 LLLTPLKGLDGQVYAVSQGPLTIGGFTVAGEAATAQKNIPTVGRIPNGAVVERDVPFKFN 200

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRL 241
           +   + L L   DFST +++ ++IN+     F    A A D  TV+++ P     ++  L
Sbjct: 201 NQDSMTLNLSVHDFSTTMQVVNKINATMGGSF----ASARDISTVELALPERYLGNMVPL 256

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           M+ +E L +  D  ARV+++E+TGT+V+G +VR+S+V V++GNL + I+E++ V QP  F
Sbjct: 257 MASLENLDISPDGRARVVVDEKTGTVVLGHDVRLSRVAVAHGNLQIVISESQDVSQPGPF 316

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
            S+G TV    TD+ + +      L++   L+ L+ G+NSIG     +ISI++ +KAAG+
Sbjct: 317 -SDGQTVVTPRTDMAIEEQNNPLMLMEGATLHELVDGLNSIGATPRDLISIIRALKAAGS 375

Query: 362 LQSEIII 368
           L +++ +
Sbjct: 376 LHADVEV 382


>gi|90579913|ref|ZP_01235721.1| flagellar P-ring protein precursor [Vibrio angustum S14]
 gi|90438798|gb|EAS63981.1| flagellar P-ring protein precursor [Vibrio angustum S14]
          Length = 363

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 151/372 (40%), Positives = 218/372 (58%), Gaps = 14/372 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M FR   +   ++     S    +RIKDV S+   R NQL+GYGLVVGL GTG+   ++P
Sbjct: 1   MNFRAIIITGLILL---SSTVDAARIKDVASVAGVRSNQLVGYGLVVGLPGTGE---TTP 54

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+QS  ++LQN GI  P G +   KNVAAV V A LPPF   G  IDV+++S+G A SL
Sbjct: 55  FTDQSFNAMLQNFGIQLPVGTKPKIKNVAAVAVNATLPPFTKQGQSIDVTVSSIGSAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T L G DG +YA+AQG++VV G   +G   S  +    T G+I NGA+VE+E+
Sbjct: 115 RGGTLLQTFLKGLDGKVYAIAQGTLVVGGFSAEGADGSKVIGNTPTVGRISNGAMVEQEV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L   L + DF+TA R+AD IN +        +A A D+ ++KV  P ++  
Sbjct: 175 PNPFGRGDYLTFNLYDSDFTTAQRMADSINQF----LGPQMASAVDATSIKVRAPRDVSQ 230

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S VE L  +     A++I+N RTGTIVIG +V++    +++G +TV I EN QV 
Sbjct: 231 RVAFLSTVENLEFDPAEGSAKIIVNSRTGTIVIGQHVKLKPAAITHGGMTVSIKENPQVS 290

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPNAF+   +TV +N+       +   F       L+ L+  +N +G     +++ILQ +
Sbjct: 291 QPNAFAGGETTVVENSNINVQESDARMFKFEPGVSLDELVRAVNQVGAAPSDLMAILQAL 350

Query: 357 KAAGALQSEIII 368
           K AGA++ ++II
Sbjct: 351 KQAGAIEGQLII 362


>gi|163850065|ref|YP_001638108.1| flagellar basal body P-ring protein [Methylobacterium extorquens
           PA1]
 gi|163661670|gb|ABY29037.1| flagellar P-ring protein [Methylobacterium extorquens PA1]
          Length = 375

 Score =  391 bits (1006), Expect = e-107,   Method: Composition-based stats.
 Identities = 181/358 (50%), Positives = 256/358 (71%), Gaps = 1/358 (0%)

Query: 12  LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
              +        +RIKD+ +L+  RDNQL GYGLV GLQGTGD+LR++ FTEQS++SLL 
Sbjct: 19  FAVMTGPVFAAGTRIKDIATLKGVRDNQLFGYGLVTGLQGTGDTLRNAQFTEQSLQSLLD 78

Query: 72  NLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
            LGI+    RL ++N+AAVMVTA+LPP+   GSRIDV++ S+GDA+SLRGG L+MTSL G
Sbjct: 79  RLGINVRDARLRTRNIAAVMVTADLPPYTGTGSRIDVTVTSMGDATSLRGGTLLMTSLTG 138

Query: 132 ADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQ 191
            DG +YA AQG + VSG  V+GQ+    +G+ T G+I NGA++ERE+P  F+D  +L+ +
Sbjct: 139 GDGLVYAAAQGPLAVSGFSVQGQAEQLTQGVPTAGRIPNGAMIEREVPGTFRDLPELVFE 198

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVE 251
           L+NPDF TA +I+D IN++SL  F R IA A D R V V +   +  TRL++++  LT++
Sbjct: 199 LKNPDFKTATQISDAINAWSLGAFGRRIASARDQRAVVVMRGRQMAQTRLVAQIGDLTIQ 258

Query: 252 TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
            DTPARV++++RTGT+VIG NV IS V V++GNLTV++TE  +V QP  F SNG TV   
Sbjct: 259 PDTPARVVVDQRTGTVVIGRNVTISTVAVTHGNLTVRVTEAPEVSQPEGF-SNGQTVVVP 317

Query: 312 NTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            T++   + +G  +++   DL +L+ G+N +GLK   II+ILQ +K AGALQ+E+++Q
Sbjct: 318 RTEVSAREERGKLAILGGSDLQTLVRGLNQVGLKPTDIIAILQAVKTAGALQAELVVQ 375


>gi|149188070|ref|ZP_01866365.1| flagellar P-ring protein precursor I [Vibrio shilonii AK1]
 gi|148838058|gb|EDL55000.1| flagellar P-ring protein precursor I [Vibrio shilonii AK1]
          Length = 363

 Score =  391 bits (1006), Expect = e-107,   Method: Composition-based stats.
 Identities = 150/368 (40%), Positives = 218/368 (59%), Gaps = 13/368 (3%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
            F    L      ++   +RIKDV  +   R NQL+GYGLV GL GTG+    +PFTEQS
Sbjct: 3   KFTFLLLGLCFAAASVQAARIKDVAEVAGVRSNQLVGYGLVTGLPGTGEK---TPFTEQS 59

Query: 66  MRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            RS+L+  GI  P G +   KNVAAV+VTA LP F+ PG R+DV+++S+G A SLRGG L
Sbjct: 60  FRSMLEKFGIQMPIGFKPKFKNVAAVIVTAELPAFSKPGQRVDVTVSSIGAAKSLRGGTL 119

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           + T L G DG +YAVAQG++VVSG   +G   S  +      G I +GA VERE+P  F 
Sbjct: 120 MQTFLQGLDGEVYAVAQGNLVVSGFSAEGLDGSKIVGNNPVVGMISSGATVEREIPSPFS 179

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLM 242
               +   L   DF+TA  +A+ IN +        +A   DS +V+V  P +       +
Sbjct: 180 RGDYITFNLLQSDFTTAQNMANAINDF----LGPQMASPLDSTSVRVRAPRDLSQRVAFL 235

Query: 243 SEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S VE +  +T D+ A++I+N RTGTIV+G +V++    V++G +TV I EN +V QPNAF
Sbjct: 236 SAVENVEFDTADSGAKIIVNSRTGTIVVGKHVKLKPAAVTHGGMTVAIKENLKVSQPNAF 295

Query: 302 SSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
              G TV   N+D++V++  G  F+      L+ L+  +N +G     +++ILQ +K AG
Sbjct: 296 -GGGDTVVVPNSDIQVTEGSGKMFNFQPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAG 354

Query: 361 ALQSEIII 368
           A++ ++I+
Sbjct: 355 AIEGQLIV 362


>gi|89075499|ref|ZP_01161910.1| flagellar P-ring protein precursor [Photobacterium sp. SKA34]
 gi|89048771|gb|EAR54342.1| flagellar P-ring protein precursor [Photobacterium sp. SKA34]
          Length = 363

 Score =  391 bits (1006), Expect = e-107,   Method: Composition-based stats.
 Identities = 150/372 (40%), Positives = 217/372 (58%), Gaps = 14/372 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M FR   +   ++          +RIKDV S+   R NQL+GYGLVVGL GTG+   ++P
Sbjct: 1   MNFRAIIITGLILL---SGTVDAARIKDVASVAGVRSNQLVGYGLVVGLPGTGE---TTP 54

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+QS  ++LQN GI  P G +   KNVAAV V A LPPF   G  IDV+++S+G A SL
Sbjct: 55  FTDQSFNAMLQNFGIQLPVGTKPKIKNVAAVAVNATLPPFTKQGQSIDVTVSSIGSAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T L G DG +YA+AQG++VV G   +G   S  +    T G+I NGA+VE+E+
Sbjct: 115 RGGTLLQTFLKGLDGKVYAIAQGTLVVGGFSAEGADGSKVIGNTPTVGRISNGAMVEQEV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L   L + DF+TA R+AD IN +        +A A D+ ++KV  P ++  
Sbjct: 175 PNPFGRGDYLTFNLHDSDFTTAQRMADSINQF----LGPQMASAVDATSIKVRAPRDVSQ 230

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S VE L  +     A++I+N RTGTIVIG +V++    +++G +TV I EN QV 
Sbjct: 231 RVAFLSTVENLEFDPAEGSAKIIVNSRTGTIVIGQHVKLKPAAITHGGMTVSIKENPQVS 290

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPNAF+   +TV +N+       +   F       L+ L+  +N +G     +++ILQ +
Sbjct: 291 QPNAFAGGETTVVENSNINVQQSDARMFKFEPGVSLDELVRAVNQVGAAPSDLMAILQAL 350

Query: 357 KAAGALQSEIII 368
           K AGA++ ++II
Sbjct: 351 KQAGAIEGQLII 362


>gi|114046842|ref|YP_737392.1| flagellar basal body P-ring protein [Shewanella sp. MR-7]
 gi|123030763|sp|Q0HX20|FLGI_SHESR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|113888284|gb|ABI42335.1| flagellar P-ring protein [Shewanella sp. MR-7]
          Length = 363

 Score =  391 bits (1006), Expect = e-107,   Method: Composition-based stats.
 Identities = 156/365 (42%), Positives = 217/365 (59%), Gaps = 11/365 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           LI ++  L         RIKD+ ++Q  R+NQLIGYGLVVGL GTG+  R   +TEQ+  
Sbjct: 5   LILAVAMLAFSLPSQAERIKDIANVQGVRNNQLIGYGLVVGLPGTGEKTR---YTEQTFT 61

Query: 68  SLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L+N GI+ P   R   KNVA V V A++P F  PG  +DV+++SLG+A SLRGG L+ 
Sbjct: 62  TMLKNFGINLPDNFRPKIKNVAVVAVHADMPAFIKPGQELDVTVSSLGEAKSLRGGTLLQ 121

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           T L G DGN+YA+AQGS+VVSG    G   S  ++   T G+I NGAIVER +   F   
Sbjct: 122 TFLKGVDGNVYAIAQGSLVVSGFSADGLDGSKVIQNTPTVGRIPNGAIVERSVATPFSTG 181

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSE 244
             L   LR  DFSTA R+AD IN          +A   D+ +V+VS P ++      ++ 
Sbjct: 182 DYLTFNLRRSDFSTAQRMADAINDL----LGPDMARPLDATSVQVSAPRDVSQRVSFLAT 237

Query: 245 VEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           +E + VE  D  A+VI+N RTGTIV+G NV++    V++G LTV I E  QV QPNA ++
Sbjct: 238 LENIEVEPADESAKVIVNSRTGTIVVGQNVKLLPAAVTHGGLTVTIAEATQVSQPNALAN 297

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
             +TVT N+T      N+  F       L+ L+  +N +G     +++IL+ +K AGAL 
Sbjct: 298 GQTTVTSNSTINASESNRRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEALKVAGALH 357

Query: 364 SEIII 368
            E+II
Sbjct: 358 GELII 362


>gi|182680546|ref|YP_001834692.1| flagellar basal body P-ring protein [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182636429|gb|ACB97203.1| flagellar P-ring protein [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 370

 Score =  391 bits (1005), Expect = e-107,   Method: Composition-based stats.
 Identities = 183/371 (49%), Positives = 263/371 (70%), Gaps = 3/371 (0%)

Query: 1   MIFRIAFLIFSLIG--LHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS 58
           M  RI  L+            A    RIKD+ +LQ  RDNQ++GYGLVVGLQGTGD++R+
Sbjct: 1   MTRRIFSLLACCCLACFSVAPAFASVRIKDIAALQGVRDNQIMGYGLVVGLQGTGDTMRN 60

Query: 59  SPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           S FTEQS++S+L  LG++  G  L ++NVAAV+VTA+LPPF  PGSRIDV+++SLGDASS
Sbjct: 61  SVFTEQSIQSMLDRLGVNVRGINLRTRNVAAVLVTADLPPFVQPGSRIDVTVSSLGDASS 120

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           L GG L++TSLLG DG  YA+AQG V V+G    G ++S ++ + T G+I NGA++ERE+
Sbjct: 121 LLGGTLILTSLLGVDGQTYAMAQGQVAVTGFAETGPAASVVQNVPTAGRIANGALIEREV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL 238
           P + +    L+LQLRNPDF TA++I D IN++ ++++   +A   D R+V ++KP N+  
Sbjct: 181 PGQLRSIGPLVLQLRNPDFGTAVKITDAINAFGVHKYGHELAHEIDQRSVALNKPANLGT 240

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           TR ++++  L++E DTPARV+I+ R+GT+VIG +V+IS V V+ GNLTV+I+    + QP
Sbjct: 241 TRFIAQIGDLSIEPDTPARVVIDSRSGTVVIGQDVQISTVAVTQGNLTVRISNAPVISQP 300

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
             F S G TV    T++  +   G  S++   +L SL++G+N IGLK DGIISILQ IK+
Sbjct: 301 APF-SQGKTVVAPITEIDANQGGGPISIVRGSNLRSLVAGLNQIGLKPDGIISILQAIKS 359

Query: 359 AGALQSEIIIQ 369
           AGALQ+++++Q
Sbjct: 360 AGALQADLVVQ 370


>gi|120554037|ref|YP_958388.1| flagellar basal body P-ring protein [Marinobacter aquaeolei VT8]
 gi|166988331|sp|A1TZN2|FLGI_MARAV RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|120323886|gb|ABM18201.1| flagellar P-ring protein [Marinobacter aquaeolei VT8]
          Length = 365

 Score =  391 bits (1005), Expect = e-107,   Method: Composition-based stats.
 Identities = 145/367 (39%), Positives = 220/367 (59%), Gaps = 13/367 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
           FL++ L      +  +  R+KD+  ++  R+NQL+GYGLVVGL GTGD    +PFT Q+ 
Sbjct: 6   FLVWILALTVGAAPVMADRLKDLSRIKGVRNNQLVGYGLVVGLDGTGDK---APFTNQTF 62

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           R+++   GI+ P G      NVAAV V+A LP FA  G  +D++++S+G+A SLRGG L+
Sbjct: 63  RNMMNQFGITLPDGVNPKLANVAAVTVSATLPAFAKAGQELDITVSSIGNADSLRGGTLL 122

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           MT L GADG +YA+AQGS+VV G   +G   S     + + G+I NGA +ERE+   F  
Sbjct: 123 MTPLKGADGQVYAMAQGSLVVGGFGAQGQDGSRITVNVPSVGRIPNGATIEREVESPFNR 182

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMS 243
              +   L   DF+TA R+ + IN     R    +A A+D+ ++ V  P +       +S
Sbjct: 183 GDTITFNLLRSDFTTARRVVEAIN----GRLGPDMAYAHDATSISVRAPRDPSQRVSFLS 238

Query: 244 EVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E + V+    A RV+IN RTGTIV+G NV++S   +++GNLTV I EN +VVQPN  +
Sbjct: 239 ILENIEVDPAQEAARVVINSRTGTIVVGQNVKVSPAAITHGNLTVTIQENPEVVQPNPLA 298

Query: 303 SNGSTVTQNNTDLKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
             G T  Q NT + V+++    F    A  LN ++  +N +G     ++++L+ +K AGA
Sbjct: 299 Q-GDTAVQQNTQIAVTEDPARMFQFGPATTLNEIVQAVNQVGAAPGDVMAVLEALKQAGA 357

Query: 362 LQSEIII 368
           L++E+I+
Sbjct: 358 LRAELIV 364


>gi|90021851|ref|YP_527678.1| flagellar basal body P-ring protein [Saccharophagus degradans 2-40]
 gi|89951451|gb|ABD81466.1| flagellar P-ring protein [Saccharophagus degradans 2-40]
          Length = 379

 Score =  391 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 149/369 (40%), Positives = 223/369 (60%), Gaps = 11/369 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           IA  + S + L    A    RIKD+ S++  R NQL+GYGLVVGL GTGD    +PFT Q
Sbjct: 16  IASTLLSALFLFGSHAS-AERIKDLTSVEGVRSNQLVGYGLVVGLDGTGDQTNQTPFTTQ 74

Query: 65  SMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           S +++L+  GI+ P G +   KNVAAV + A LP FA PG  ID++++S+ +A SLRGG 
Sbjct: 75  SFQAMLKQFGITIPPGAKFQLKNVAAVAIHAELPAFAKPGQTIDITVSSIANAKSLRGGS 134

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSS-FMEGISTGGKIVNGAIVERELPKKF 182
           L++  L G DGN+YAVAQG+++V G   +G+  S     + + G+I  GA+VER +  +F
Sbjct: 135 LLLAPLRGLDGNVYAVAQGNLIVGGFGGEGRDGSKITVNVPSVGRIPGGAMVERAVATRF 194

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRL 241
                ++  L  PDF+TA R+AD IN          +A   D+ ++ V  P N       
Sbjct: 195 GGDDRIVFNLHTPDFTTAKRLADTINDM----LGPEVAMPMDAASIAVRAPQNPAQRVEF 250

Query: 242 MSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           +S +E LT+    + A++IIN RTGTIV+G +VR+S V V++G+LTV + E+ +  QPNA
Sbjct: 251 LSLLENLTLTPGNSSAKIIINSRTGTIVVGQHVRVSPVAVTHGSLTVTVKEDVEASQPNA 310

Query: 301 FSSNGSTVTQNNTDLK-VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           F   G TV   N+ ++ V +N   F     P LN ++  +N +G     +++IL+ +K A
Sbjct: 311 F-GGGETVVVPNSRVEVVEENGPMFKFSPGPTLNDIVRAVNEVGAAPGDLMAILEALKQA 369

Query: 360 GALQSEIII 368
           GAL++EI++
Sbjct: 370 GALKAEIVV 378


>gi|117619793|ref|YP_857339.1| flagellar basal body P-ring protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|166214830|sp|A0KM38|FLGI_AERHH RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|117561200|gb|ABK38148.1| flagellar P-ring protein FlgI [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 365

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 150/370 (40%), Positives = 219/370 (59%), Gaps = 10/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +   L+     L  +     SRIKD+ S++  R NQLIGYGLVVGL GTG+  +S+ FT
Sbjct: 1   MKSLRLVALFCCLLPLGMAHASRIKDISSVEGVRSNQLIGYGLVVGLPGTGE--KSNAFT 58

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQ+ R++L N GI  P   +   K+VA V + A+LPPFA PG  IDV+++++G+A SLRG
Sbjct: 59  EQTFRTMLNNFGIKVPDNIKPKIKDVAPVAIHADLPPFAKPGQTIDVTVSAIGEAKSLRG 118

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ + L G DG +YAVAQGS+VV GL  +G   S  +    T G+I NGA VERE+P 
Sbjct: 119 GTLLQSFLKGLDGRVYAVAQGSLVVGGLGAEGADGSKVVINTPTVGRIANGATVEREVPN 178

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L  PDF+TA R+AD +N           A+A D+ +VKV  P +     
Sbjct: 179 SFSQGDTITFNLNRPDFTTARRLADVVNDLV----GPNTAQALDATSVKVYAPRDPGQRV 234

Query: 240 RLMSEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++ +E L V+  + A ++I+N RTGTIVIG  VR+    +S+G LTV I EN+QV QP
Sbjct: 235 SYLATIENLEVDPASEAAKIIVNSRTGTIVIGSQVRLKPAAISHGGLTVTIAENQQVSQP 294

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           N  S   + VT N+T     +    F L     L+ L+  +N +G+    +++IL+ ++ 
Sbjct: 295 NPLSGGQTAVTNNSTINVQQEQGRMFKLDTGATLDDLVRAVNQVGVAPGDLMAILEALQQ 354

Query: 359 AGALQSEIII 368
           AGA++ +++I
Sbjct: 355 AGAIEGQLVI 364


>gi|288940413|ref|YP_003442653.1| flagellar P-ring protein [Allochromatium vinosum DSM 180]
 gi|288895785|gb|ADC61621.1| flagellar P-ring protein [Allochromatium vinosum DSM 180]
          Length = 392

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 154/355 (43%), Positives = 223/355 (62%), Gaps = 10/355 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           +A    RIKD+ ++   RDNQLIGYGLVVGL GTGD    +PF+ QS++++L  LG++ P
Sbjct: 42  NAGGAERIKDLATIAGVRDNQLIGYGLVVGLDGTGDQTTQAPFSTQSLKNMLSQLGVTIP 101

Query: 79  GG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
            G    +KN+AAVM+TA+LPPFA PG R+D++++SLG+A SLRGG L+MT L GADG +Y
Sbjct: 102 EGVNPQTKNMAAVMITADLPPFAKPGQRMDITVSSLGNAKSLRGGTLLMTPLKGADGQVY 161

Query: 138 AVAQGSVVVSGLFVKGQSSS-FMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           A+AQG++ V G    G   S     + + G++ NGA VERE+P  F     L L LR PD
Sbjct: 162 AIAQGNLTVGGFGAGGADGSRITVNVPSVGRVPNGATVEREVPTSFSQGDHLTLNLRRPD 221

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVET-DT 254
           F+TA R+ D INS    RF   +A++ D  +V+V  P +       +S +E LT+E  + 
Sbjct: 222 FTTAYRMVDVINS----RFGDDVAQSIDGSSVQVRAPRDPNQRVAFVSMLENLTLEAAEP 277

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
           PARV+IN RTGTIV+G  V +    +S+GNLTV I+EN  V QP A  + G T     TD
Sbjct: 278 PARVVINARTGTIVMGAGVTVRPAAISHGNLTVTISENPAVSQPGAL-AGGQTAVVPQTD 336

Query: 315 LKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + +  +K   F       L  ++  +N +G     +++IL+ ++ AGAL++E+++
Sbjct: 337 VAIEQDKNRMFLFEPGTALGDIVEAVNEVGAAPGDLVAILEALREAGALRAELVV 391


>gi|254467240|ref|ZP_05080651.1| flagellar P-ring protein FlgI [Rhodobacterales bacterium Y4I]
 gi|206688148|gb|EDZ48630.1| flagellar P-ring protein FlgI [Rhodobacterales bacterium Y4I]
          Length = 368

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 156/373 (41%), Positives = 229/373 (61%), Gaps = 9/373 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+  +      L  L   +     R+KD+V     R N L+GYGLVVGL GTGD LR+SP
Sbjct: 1   MMAVLRLFFACLFLLPVAAQANTIRLKDLVEFDGVRGNDLVGYGLVVGLDGTGDGLRNSP 60

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTE+ M ++L+ LG++  G +   KNVAAV VTA LPPFA  GS IDV+++++GD+ SL 
Sbjct: 61  FTEEIMTNILERLGVNVTGEQFRPKNVAAVFVTATLPPFARVGSTIDVTVSAIGDSKSLL 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L  ADG IYAVAQG+++  G   +G++++  +G+ T G I +GA VERE+  
Sbjct: 121 GGTLIMTPLNAADGQIYAVAQGTILAGGAVAEGEAATVTQGVPTAGVIPSGARVEREIDF 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
                  + L LR PDF+TA RI   IN    N F R +A   DS TV+V        + 
Sbjct: 181 DLASLTSMRLALREPDFTTAGRIERAIN----NEFGRNVALMRDSGTVEVDIGRTNTRST 236

Query: 241 LMS--EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +   +E + VE    ARV++++R+GTIV+G +VRIS+V V+ GNLT++I E   VVQP
Sbjct: 237 AHAVGRIENILVEPQRKARVVVDQRSGTIVMGSDVRISRVAVAQGNLTLRIEETPLVVQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKG--SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           N F ++G TV    T   + + +G     + +   L+ ++SG+N++G+    +I IL+ +
Sbjct: 297 NPF-ADGETVVVPRTGAAIEEEEGIQLAEVPETTSLSEVVSGLNALGVSPRDMIDILKSL 355

Query: 357 KAAGALQSEIIIQ 369
           KAAGAL +E +++
Sbjct: 356 KAAGALHAEFVVR 368


>gi|307823535|ref|ZP_07653764.1| flagellar P-ring protein [Methylobacter tundripaludum SV96]
 gi|307735520|gb|EFO06368.1| flagellar P-ring protein [Methylobacter tundripaludum SV96]
          Length = 367

 Score =  390 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 225/367 (61%), Gaps = 13/367 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            ++  L+G+         RIKD+ S++  R NQL+GYGLVVGL  +GD      FT QS+
Sbjct: 8   VILLLLLGIAVSGPVCAERIKDIASIEGVRSNQLVGYGLVVGLDKSGDKTT---FTGQSL 64

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           RS+L  LGI+ P G    SKN+AAV V A LPPFA  G  IDV+++SLGDA SLRGG L+
Sbjct: 65  RSMLTRLGITLPPGLDPKSKNIAAVSVQAELPPFAKSGQAIDVTVSSLGDAKSLRGGSLL 124

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           M+ L GADG +YA+AQGS+VVSGL   G   SS        G+I NGAIVER +   F +
Sbjct: 125 MSPLKGADGQVYAIAQGSLVVSGLSASGQDGSSVTVNNPNVGRIPNGAIVERTVSTSFSE 184

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLMS 243
              L+  L +PDF+TA R+A+ IN           A+A D+ +V+V+ P + +      S
Sbjct: 185 GDALVFNLHSPDFTTANRMAESINRV----LGTNTAKAIDATSVRVNAPVDPNQKVTFAS 240

Query: 244 EVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            VE + V  D  PARVI+N RTGT+V+   VR+    VS+G+LTV ITEN QV QPNA  
Sbjct: 241 VVENMMVTPDDAPARVIVNSRTGTVVVNGKVRVQPAAVSHGSLTVTITENPQVSQPNAL- 299

Query: 303 SNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           SNG TV    +++KV + K   F       L+ ++  +N++G     +++IL+ +K+AG+
Sbjct: 300 SNGQTVVTPKSNIKVEEEKNHMFVFNPGVSLDEIVQAVNNVGAAPSDLVAILEALKSAGS 359

Query: 362 LQSEIII 368
           L +E+I+
Sbjct: 360 LHAELIV 366


>gi|15887896|ref|NP_353577.1| flagellar basal body P-ring protein [Agrobacterium tumefaciens str.
           C58]
 gi|2494539|sp|Q44340|FLGI_AGRT5 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|1086563|gb|AAB68970.1| FlgI [Agrobacterium tumefaciens]
 gi|2459716|gb|AAB71792.1| FlgI [Agrobacterium tumefaciens]
 gi|15155488|gb|AAK86362.1| flagellar P-ring protein precursor [Agrobacterium tumefaciens str.
           C58]
          Length = 373

 Score =  390 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 231/369 (62%), Positives = 297/369 (80%), Gaps = 2/369 (0%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVS-RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           I   A +  +L  L    AQ  + RIKD+ SLQ+GRDNQLIGYGLVVGLQGTGDSLRSSP
Sbjct: 6   IIAAALVFSALPFLSTPPAQADTSRIKDIASLQAGRDNQLIGYGLVVGLQGTGDSLRSSP 65

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTEQSMR++LQNLGI+T GG+  +KN+AAVMVTANLPPFASPGSR+DV+++SLGDA+SLR
Sbjct: 66  FTEQSMRAMLQNLGITTQGGQSNAKNIAAVMVTANLPPFASPGSRVDVTVSSLGDATSLR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MTSL GADG IYAVAQG+++V+G   +G +++  +G++T  ++ NGAI+ERELP 
Sbjct: 126 GGNLIMTSLSGADGQIYAVAQGALIVNGFSAQGDAATLTQGVTTSARVPNGAIIERELPS 185

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           KFKDS +L+LQLRNPDFSTA+R+AD +N+++  R+  PIAE  DS+ + V KP   DLTR
Sbjct: 186 KFKDSVNLVLQLRNPDFSTAVRVADVVNAFARARYGDPIAEPRDSQEIAVQKPRVADLTR 245

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           LM+E+E LTVETDTPA+V+INERTGTIVIG +VRIS+V VSYG LTVQ+TE+ QV+QP  
Sbjct: 246 LMAEIENLTVETDTPAKVVINERTGTIVIGADVRISRVAVSYGTLTVQVTESPQVIQPAP 305

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           F S G T  Q  TD+         ++++ PDL +L++G+NSIGLK DGII+ILQGIK+AG
Sbjct: 306 F-SRGQTAVQPQTDIMAMQEGSKVAIVEGPDLRTLVAGLNSIGLKADGIIAILQGIKSAG 364

Query: 361 ALQSEIIIQ 369
           ALQ+E+++Q
Sbjct: 365 ALQAELVLQ 373


>gi|117919776|ref|YP_868968.1| flagellar basal body P-ring protein [Shewanella sp. ANA-3]
 gi|166214840|sp|A0KUU3|FLGI_SHESA RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|117612108|gb|ABK47562.1| flagellar P-ring protein [Shewanella sp. ANA-3]
          Length = 363

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 155/366 (42%), Positives = 218/366 (59%), Gaps = 13/366 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           LI +L  L         RIKD+ ++Q  R NQLIGYGLVVGL GTG+      +TEQ+  
Sbjct: 5   LIVALAMLVLSLPSQAERIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTN---YTEQTFT 61

Query: 68  SLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L+N GI+ P   R   KNVA V V A++P F  PG ++DV+++SLG+A SLRGG L+ 
Sbjct: 62  TMLKNFGINLPDNFRPKIKNVAVVAVHADMPAFIKPGQQLDVTVSSLGEAKSLRGGTLLQ 121

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           T L G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGAIVER +   F   
Sbjct: 122 TFLKGVDGNVYAIAQGSLVVSGFSAEGLDGSKVIQNTPTVGRIPNGAIVERSVATPFSSG 181

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSE 244
             L   LR  DFSTA R+AD IN          +A   D+ +V+VS P ++      ++ 
Sbjct: 182 DYLTFNLRRADFSTAQRMADAINDL----LGPDMARPLDATSVQVSAPRDVSQRVSFLAT 237

Query: 245 VEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           +E L V   +  A+VI+N RTGTIV+G +V++    V++G LTV I E  QV QPNA  +
Sbjct: 238 LENLDVIPAEESAKVIVNSRTGTIVVGQHVKLLPAAVTHGGLTVTIAEATQVSQPNAL-A 296

Query: 304 NGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           NG TV   NT + V++ ++  F       L+ L+  +N +G     +++IL+ +K AGAL
Sbjct: 297 NGETVVTANTTIGVNESDRRMFMFSPGTTLDELVRAVNLVGAAPSDVLAILEALKVAGAL 356

Query: 363 QSEIII 368
             E+II
Sbjct: 357 HGELII 362


>gi|163852458|ref|YP_001640501.1| flagellar basal body P-ring protein [Methylobacterium extorquens
           PA1]
 gi|163664063|gb|ABY31430.1| flagellar P-ring protein [Methylobacterium extorquens PA1]
          Length = 380

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 174/369 (47%), Positives = 244/369 (66%), Gaps = 9/369 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
            +A L    + L    A  +SR+KD+ +++  R NQL+GYG+VVGL GTGD+L + PFT+
Sbjct: 16  LVAVLACLAVLLPPAPASALSRVKDLAAVEGVRSNQLVGYGIVVGLNGTGDTLNNIPFTK 75

Query: 64  QSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           QS++++L+ LGI+T G  + ++N+AAVMVTANLPPFA+ G+ IDV+++SLGDA SL+GG 
Sbjct: 76  QSLQAMLERLGINTRGATMRTQNLAAVMVTANLPPFATQGTHIDVTVSSLGDAKSLQGGT 135

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           LV TSLLGADG IYA+AQGSV ++G   +G++S    G+ T G+I NGA+VERE+  K  
Sbjct: 136 LVATSLLGADGEIYALAQGSVAIAGFSAEGEASKITRGVPTNGRISNGALVEREMAFKLN 195

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRL 241
           ++  L L LRNPDF+TA RIA  IN +         AE  D  T+ +  P     ++ RL
Sbjct: 196 EARSLRLSLRNPDFTTAKRIASAINDF----MGADTAEPTDPATITLQIPAKYRGNMIRL 251

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           ++EVE L VE D  ARV+++ER+G IV+G +VR+S V ++ GNLTV ITE   V QP   
Sbjct: 252 ITEVEQLKVEPDQTARVVVDERSGIIVMGRDVRVSTVAIAQGNLTVTITEQPMVSQPAPL 311

Query: 302 SSNGSTVTQNNTDLKVS--DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
            SNG T     T +KV   D      + +   L  L+ G+N++G+    +ISILQ IK A
Sbjct: 312 -SNGQTAVVPRTGVKVDTGDGNKLALVKEGVSLRELVDGLNALGVGPRDLISILQAIKTA 370

Query: 360 GALQSEIII 368
           GALQ++I +
Sbjct: 371 GALQADIEL 379


>gi|222084867|ref|YP_002543396.1| flagellar basal-body P-ring protein [Agrobacterium radiobacter K84]
 gi|221722315|gb|ACM25471.1| flagellar basal-body P-ring protein [Agrobacterium radiobacter K84]
          Length = 372

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 228/368 (61%), Positives = 298/368 (80%), Gaps = 1/368 (0%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F    +    + + + +  + SRIKD+ SLQ+GRDNQLIGYGL+VGLQG+GD LRSSPF
Sbjct: 6   LFLAVLMALPSLIVSDPALAMQSRIKDIASLQAGRDNQLIGYGLIVGLQGSGDGLRSSPF 65

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TEQSMR++LQNLGIST GG+  +KN AAVMVTANLPPFASPGSRIDV+++SLGDA+SLRG
Sbjct: 66  TEQSMRAMLQNLGISTQGGQSAAKNTAAVMVTANLPPFASPGSRIDVTVSSLGDATSLRG 125

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MTSL GADG IYAVAQGSV+VSG   +G ++S  EG +T G++  GAI+ERELP +
Sbjct: 126 GTLIMTSLSGADGQIYAVAQGSVIVSGFQAQGAAASVTEGTTTAGRVPGGAIIERELPSR 185

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL 241
           FKDS +L+LQLRNPDFST++RI D +N+++ +RF  PIAEA DS+ V +SKP   DLTRL
Sbjct: 186 FKDSVNLVLQLRNPDFSTSVRITDTVNAWATSRFGAPIAEAKDSQEVAISKPKMADLTRL 245

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           M+++E L V+TDTPA+V+INERTGTIVIG +VR+S V VSYG LTVQ++EN QV+QP  F
Sbjct: 246 MADIENLAVQTDTPAKVVINERTGTIVIGADVRVSPVAVSYGTLTVQVSENPQVIQPEPF 305

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
            S+G T  Q+ TD+  + + G  +++  PDL +L+SG+N+IG+K DGII+ILQGIK+AGA
Sbjct: 306 -SDGQTAIQDQTDITATKSGGGVAMLQGPDLKTLVSGLNNIGVKPDGIIAILQGIKSAGA 364

Query: 362 LQSEIIIQ 369
           LQ+E+++Q
Sbjct: 365 LQAELVLQ 372


>gi|110677960|ref|YP_680967.1| flagellar basal body P-ring protein [Roseobacter denitrificans OCh
           114]
 gi|109454076|gb|ABG30281.1| flagellar P-ring protein FlgI [Roseobacter denitrificans OCh 114]
          Length = 367

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 158/372 (42%), Positives = 229/372 (61%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R+   I     +   +     RIKD+V     R N L+GYGLVVGL GTGD LR++PF
Sbjct: 1   MKRLILFIALAFSMVSTAYAGPVRIKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNAPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE+ M ++L+ LG++  G +    NVAAV VTA LPPFA  GS+IDV+++++GDA+SL G
Sbjct: 61  TEEIMSNILERLGVNVSGEQFRPNNVAAVFVTATLPPFARGGSQIDVTVSAIGDANSLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT +  ADG IYAVAQG+++  G  V+G  ++   G+ T G I +GA VERE+   
Sbjct: 121 GTLIMTPMNAADGQIYAVAQGTIIAGGAAVEGDGANVTRGVPTSGVIPSGARVEREIEFD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTV--KVSKPTNIDLT 239
                +L L LR+ DF+TA RI   IN    N F RP+A   DS TV   V       + 
Sbjct: 181 LSSLNELRLALRDADFTTAARIEAAIN----NDFGRPVAVMLDSGTVRLNVDATEMASVA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             +  +E + VE +  ARV++++R+GTIV+G++VRIS+V VS GNLT++I E    +QPN
Sbjct: 237 HALGRIENIPVEPERKARVVVDQRSGTIVMGEDVRISRVAVSQGNLTLRIQEAPIAIQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F + G TV    T  ++ +    G   + D   L+ +I+G+N++G+    +I IL+ IK
Sbjct: 297 PF-AEGETVVVPRTRAELEEEPGIGLAEVPDGTSLSEVIAGLNALGVSPRDMIDILKSIK 355

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E I++
Sbjct: 356 AAGALHAEFIVR 367


>gi|240139795|ref|YP_002964272.1| flagella basal body protein [Methylobacterium extorquens AM1]
 gi|254562210|ref|YP_003069305.1| flagella basal body protein [Methylobacterium extorquens DM4]
 gi|240009769|gb|ACS40995.1| flagella basal body protein [Methylobacterium extorquens AM1]
 gi|254269488|emb|CAX25454.1| flagella basal body protein [Methylobacterium extorquens DM4]
          Length = 380

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 173/369 (46%), Positives = 244/369 (66%), Gaps = 9/369 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
            +A L    + L    A  +SR+KD+ +++  R NQL+GYG+VVGL GTGD+L + PFT+
Sbjct: 16  LVAVLACLAVLLPPAPASALSRVKDLAAVEGVRSNQLVGYGIVVGLNGTGDTLNNIPFTK 75

Query: 64  QSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           QS++++L+ LGI+T G  + ++N+AAVMVTANLPPFA+ G+ IDV+++SLGDA SL+GG 
Sbjct: 76  QSLQAMLERLGINTRGATMRTQNLAAVMVTANLPPFATQGTHIDVTVSSLGDAKSLQGGT 135

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           LV TSLLGADG IYA+AQGSV ++G   +G+++    G+ T G+I NGA+VERE+  K  
Sbjct: 136 LVATSLLGADGEIYALAQGSVAIAGFSAEGEAAKITRGVPTNGRISNGALVEREMAFKLN 195

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRL 241
           ++  L L LRNPDF+TA RIA  IN +         AE  D  T+ +  P     ++ RL
Sbjct: 196 EARSLRLSLRNPDFTTAKRIASAINDF----MGADTAEPTDPATITLQIPAKYRGNMIRL 251

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           ++EVE L VE D  ARV+++ER+G IV+G +VR+S V ++ GNLTV ITE   V QP   
Sbjct: 252 ITEVEQLKVEPDQTARVVVDERSGIIVMGRDVRVSTVAIAQGNLTVTITEQPMVSQPAPL 311

Query: 302 SSNGSTVTQNNTDLKVS--DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
            SNG T     T +KV   D      + +   L  L+ G+N++G+    +ISILQ IK A
Sbjct: 312 -SNGQTAVVPRTGVKVDTGDGNKLALVKEGVSLRELVDGLNALGVGPRDLISILQAIKTA 370

Query: 360 GALQSEIII 368
           GALQ++I +
Sbjct: 371 GALQADIEL 379


>gi|146281775|ref|YP_001171928.1| flagellar basal body P-ring protein [Pseudomonas stutzeri A1501]
 gi|145569980|gb|ABP79086.1| flagellar P-ring protein precursor FlgI [Pseudomonas stutzeri
           A1501]
          Length = 366

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 151/357 (42%), Positives = 207/357 (57%), Gaps = 10/357 (2%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
             +     R+KDV ++   R NQLIGYGLVVGL G+GD    +PFT Q+  ++L   GI 
Sbjct: 14  VCATAQAERLKDVATIHGVRANQLIGYGLVVGLNGSGDQTTQTPFTVQTFNNMLAQFGIK 73

Query: 77  TP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
            P GG +  KNVAAV + A LPPFA PG  ID++++S+G+A SLRGG L+M  L G DGN
Sbjct: 74  VPSGGNIQLKNVAAVSIHAELPPFAKPGQTIDITVSSIGNAKSLRGGSLLMAPLKGIDGN 133

Query: 136 IYAVAQGSVVVSGLFVKGQSSS-FMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRN 194
           +YAVAQG++VV G    G   S       + G+I  GA VER +P  F     L L L  
Sbjct: 134 VYAVAQGNLVVGGFDAGGADGSRVTVNSPSAGRIPGGATVERPVPSGFNQGNTLTLNLNR 193

Query: 195 PDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETD 253
           PDF+TA  I DQIN          +A+A D  ++ V+ P +       +S +E L VE  
Sbjct: 194 PDFTTAKNIVDQINEL----LGPGVAQALDGGSISVTAPLDPSQRVDYLSILENLEVEVG 249

Query: 254 -TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNN 312
              A+VIIN RTGTIVIG NVR+    V++G+LTV I+E+ QV QP  F S G TV   N
Sbjct: 250 QAVAKVIINSRTGTIVIGQNVRVQPAAVTHGSLTVTISEDPQVSQPGPF-SGGQTVVVPN 308

Query: 313 TDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + +      K  F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 309 SRVTAEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPSDLMAILEALKQAGALQADLIV 365


>gi|88704302|ref|ZP_01102016.1| flagellar P-ring protein FlgI [Congregibacter litoralis KT71]
 gi|88701353|gb|EAQ98458.1| flagellar P-ring protein FlgI [Congregibacter litoralis KT71]
          Length = 379

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 152/371 (40%), Positives = 224/371 (60%), Gaps = 9/371 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           F        L  L   S     RIKD+  +   R NQL+GYGLVVGL G+GD +  +PFT
Sbjct: 12  FLRRLTPAMLTLLLLASPVQAERIKDIAGIAGVRSNQLVGYGLVVGLDGSGDQVIQAPFT 71

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS++S+L  LG++ P       KN+A VMVTA LPPF  PG  IDV+++SL +A SLRG
Sbjct: 72  IQSLKSMLAQLGVNVPANVNPQLKNIATVMVTAELPPFTKPGQTIDVTVSSLANAKSLRG 131

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+MT L G DG  YA+AQGS++VSG   +G   SS    + + G+I NGAIVER +P 
Sbjct: 132 GQLLMTPLKGPDGQTYAIAQGSMIVSGFGAEGSDGSSVTVNVPSAGRIPNGAIVERGVPT 191

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +++ L +PDF+TA R+A  IN          IA+  D+ +++V  P +  D  
Sbjct: 192 PFGTEPVMVMNLNHPDFTTAQRVAMSINE----SMGEGIAKPLDAVSIEVRAPRDPGDKV 247

Query: 240 RLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L+V+     A+V++N R GTIVIGD+VR+ +  V++GNLTV I+EN  V QP
Sbjct: 248 AFVSLLENLSVDPGAAAAKVVVNSRNGTIVIGDSVRVERAAVAHGNLTVTISENINVSQP 307

Query: 299 NAFSSNGSTVTQNNTDLKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            AF+  G T    N+++ ++++    F L     L  L++ +N +G     +I+IL+ ++
Sbjct: 308 GAFAGGGQTAITPNSEVSLAEDNARMFLLEPGITLQELVTAVNKVGAAPGDLIAILEALQ 367

Query: 358 AAGALQSEIII 368
            AGAL++++I+
Sbjct: 368 QAGALRAQLIV 378


>gi|296447436|ref|ZP_06889361.1| flagellar P-ring protein [Methylosinus trichosporium OB3b]
 gi|296255056|gb|EFH02158.1| flagellar P-ring protein [Methylosinus trichosporium OB3b]
          Length = 366

 Score =  389 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 177/353 (50%), Positives = 252/353 (71%), Gaps = 1/353 (0%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
              A    RIKD+VS++  R+ QL+GYGLVVGLQGTGD+LR++PFTEQS+ S+L  +G++
Sbjct: 15  CAPALASVRIKDIVSVRGLREYQLVGYGLVVGLQGTGDTLRNTPFTEQSVASMLSRMGVN 74

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
            P  +L ++N+AAVMVTA+LPPF   GS ID++++++GDASSL GG L++T+L G DGN+
Sbjct: 75  VPNTQLRTRNLAAVMVTASLPPFVGWGSSIDITVSAMGDASSLMGGTLILTTLTGVDGNV 134

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YA+AQG + VSG  V GQ+ S   G++T G++ NGA +ERE P+   DS  L+L+LRNPD
Sbjct: 135 YALAQGPIAVSGFAVSGQNESLTHGVATVGRVPNGATIEREAPRPSGDSGALVLELRNPD 194

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPA 256
           F TA+R+AD IN+++  R+ + +A   D+R+V V    N+  TRL++E+  L V+  TPA
Sbjct: 195 FQTAVRVADAINAFTRERYGQRLARERDNRSVAVRGAPNMGATRLLAEIGELRVDPTTPA 254

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV+I+ERTGT+VIG +V+I  V V+ G LTV+I E  +V QP  F SNG T   + T + 
Sbjct: 255 RVVIDERTGTVVIGQDVQILPVAVTQGGLTVRINETPEVSQPGPF-SNGQTTVTSQTRIT 313

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            ++  G    ++   L +L+ G+N IGLK  GIISILQ IK AGALQ++++IQ
Sbjct: 314 ATEQVGQVGTLEGATLKTLVRGLNQIGLKPTGIISILQAIKTAGALQADLVIQ 366


>gi|218531214|ref|YP_002422030.1| flagellar basal body P-ring protein [Methylobacterium
           chloromethanicum CM4]
 gi|218523517|gb|ACK84102.1| flagellar P-ring protein [Methylobacterium chloromethanicum CM4]
          Length = 380

 Score =  389 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 173/369 (46%), Positives = 244/369 (66%), Gaps = 9/369 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
            +A L    + L    A  +SR+KD+ +++  R NQL+GYG+VVGL GTGD+L + PFT+
Sbjct: 16  LVAVLACLAVLLPPAPASALSRVKDLAAVEGVRSNQLVGYGIVVGLNGTGDTLNNIPFTK 75

Query: 64  QSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           QS++++L+ LGI+T G  + ++N+AAVMVTANLPPFA+ G+ IDV+++SLGDA SL+GG 
Sbjct: 76  QSLQAMLERLGINTRGATMRTQNLAAVMVTANLPPFATQGTHIDVTVSSLGDAKSLQGGT 135

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           LV TSLLGADG IYA+AQGSV ++G   +G+++    G+ T G+I NGA+VERE+  K  
Sbjct: 136 LVATSLLGADGEIYALAQGSVAIAGFSAEGEAAKITRGVPTNGRISNGALVEREMAFKLN 195

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRL 241
           ++  L L LRNPDF+TA RIA  IN +         AE  D  T+ +  P     ++ RL
Sbjct: 196 EARSLRLSLRNPDFTTAKRIASAINDF----MGADTAEPTDPATITLQIPAKYRGNMIRL 251

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           ++EVE L VE D  ARV+++ER+G IV+G +VR+S V ++ GNLTV ITE   V QP   
Sbjct: 252 ITEVEQLKVEPDQTARVVVDERSGIIVMGRDVRVSTVAIAQGNLTVTITEQPMVSQPAPL 311

Query: 302 SSNGSTVTQNNTDLKVS--DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
            SNG T     T +KV   D      + +   L  L+ G+N++G+    +ISILQ IK A
Sbjct: 312 -SNGQTAVVPRTGVKVDTGDGNKLALVKEGVSLRELVDGLNALGVGPRDLISILQAIKTA 370

Query: 360 GALQSEIII 368
           GALQ++I +
Sbjct: 371 GALQADIEL 379


>gi|332994158|gb|AEF04213.1| flagellar basal body P-ring protein [Alteromonas sp. SN2]
          Length = 370

 Score =  389 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 159/373 (42%), Positives = 220/373 (58%), Gaps = 11/373 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R+  ++   + L   S     RIKD+ S+Q  R NQL+GYGLVVGL GTG+    SPFT
Sbjct: 1   MRLFSVVLIALTLVLSSNVNAQRIKDLASIQGVRSNQLVGYGLVVGLPGTGE---QSPFT 57

Query: 63  EQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQS R++L N GIS     +   KNVAAV V A LP F  PG  ID++++S+G+ASSL+G
Sbjct: 58  EQSFRTMLSNFGISLDSNTKPKIKNVAAVAVHAELPAFTKPGQTIDITVSSVGEASSLQG 117

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DG +YAVAQGS+VVSG     G  S  +    T G+I NGA+VE+ +P 
Sbjct: 118 GTLLQTFLRGVDGKVYAVAQGSLVVSGFGAQGGDGSRIVVNTPTVGRIPNGAMVEQTVPS 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSL--NRFSRPIAEAYDSRTVKVSKPTNI-D 237
            F +   L L L  PDFSTA  +AD IN            IA   D+ +V+VS P ++  
Sbjct: 178 GFANGDSLTLNLHYPDFSTAKALADVINERLGAQPEKGYSIATPIDAASVRVSAPRDVGQ 237

Query: 238 LTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E       D PARV+IN RTGTIVIG +VR+    +++G LTV I+EN+QV 
Sbjct: 238 RVGFLATLENFEFTPADAPARVVINSRTGTIVIGRDVRLLPAAITHGGLTVTISENQQVT 297

Query: 297 QPNAFSSNGSTVTQNNTDLKVS-DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPNAF ++G TV    + + V   +   FS      L+ L+  +N +G     +++IL+ 
Sbjct: 298 QPNAF-ADGETVVTTQSIVDVDLSDSRMFSFEPGVTLDQLVRAVNEVGAAPGDLMAILEA 356

Query: 356 IKAAGALQSEIII 368
           ++ AGAL  E++I
Sbjct: 357 LRQAGALHGELVI 369


>gi|311992303|gb|ADQ26725.1| flagellar P-ring protein [Aeromonas hydrophila]
          Length = 364

 Score =  389 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 150/369 (40%), Positives = 219/369 (59%), Gaps = 10/369 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           +   L+     L  +     SRIKD+ S++  R NQLIGYGLVVGL GTG+  +S+ FTE
Sbjct: 1   KSLRLVALFCCLLPLGMAHASRIKDISSVEGVRSNQLIGYGLVVGLPGTGE--KSNAFTE 58

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           Q+ R++L N GI  P   +   K+VA V + A+LPPFA PG  IDV+++++G+A SLRGG
Sbjct: 59  QTFRTMLNNFGIKVPDNIKPKIKDVAPVAIHADLPPFAKPGQTIDVTVSAIGEAKSLRGG 118

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKK 181
            L+ + L G DG +YAVAQGS+VV GL  +G   S  +    T G+I NGA VERE+P  
Sbjct: 119 TLLQSFLKGLDGRVYAVAQGSLVVGGLGAEGADGSKVVINTPTVGRIANGATVEREVPNS 178

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F     +   L  PDF+TA R+AD +N           A+A D+ +VKV  P +      
Sbjct: 179 FSQGDTITFNLNRPDFTTARRLADVVNDLV----GPNTAQALDATSVKVYAPRDPGQRVS 234

Query: 241 LMSEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            ++ +E L V+  + A ++I+N RTGTIVIG  VR+    +S+G LTV I EN+QV QPN
Sbjct: 235 YLATIENLEVDPASEAAKIIVNSRTGTIVIGSQVRLKPAAISHGGLTVTIAENQQVSQPN 294

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
             S   + VT N+T     +    F L     L+ L+  +N +G+    +++IL+ ++ A
Sbjct: 295 PLSGGQTAVTNNSTINVQQEQGRMFKLDTGATLDDLVRAVNQVGVAPGDLMAILEALQQA 354

Query: 360 GALQSEIII 368
           GA++ +++I
Sbjct: 355 GAIEGQLVI 363


>gi|150395487|ref|YP_001325954.1| flagellar basal body P-ring protein [Sinorhizobium medicae WSM419]
 gi|166214841|sp|A6U639|FLGI_SINMW RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|150027002|gb|ABR59119.1| flagellar P-ring protein [Sinorhizobium medicae WSM419]
          Length = 371

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 224/372 (60%), Positives = 285/372 (76%), Gaps = 4/372 (1%)

Query: 1   MIFRI---AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLR 57
           M  R       +         SA   SRIKDV SLQ+GRDNQLIGYGLVVGLQGTGDSLR
Sbjct: 1   MKMRACKWLLTLAVAFAATLSSAYAASRIKDVASLQAGRDNQLIGYGLVVGLQGTGDSLR 60

Query: 58  SSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           SSPFT+QS+R++LQNLGIST GG   ++NVAAV+VTA LPPFASPGSR+DV++ SLGDA+
Sbjct: 61  SSPFTDQSIRAMLQNLGISTQGGDSRTRNVAAVLVTATLPPFASPGSRLDVTVGSLGDAT 120

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SLRGG LVMTSL GADG IYAVAQGSVVVSG   +G+++   +G++T G++ NGAI+ERE
Sbjct: 121 SLRGGTLVMTSLSGADGQIYAVAQGSVVVSGFNAQGEAAQLNQGVTTAGRVPNGAIIERE 180

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           LP KFKD  +L+LQLRNPDFSTA+ +A  IN Y+  +F   IAEA DS++V V KP   D
Sbjct: 181 LPSKFKDGFNLVLQLRNPDFSTAVGMAAAINRYAAAQFGGRIAEALDSQSVLVQKPKMAD 240

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           L RLM++VE L +ETD PARV+INERTGTIVIG +VR+++V VSYG LTVQ++E   +VQ
Sbjct: 241 LARLMADVENLVIETDAPARVVINERTGTIVIGQDVRVAQVAVSYGTLTVQVSETPTIVQ 300

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           P  F S G T  + NT ++   + G+ ++++   L SL++G+NSIG+K DGII+ILQ IK
Sbjct: 301 PEPF-SRGQTAYEPNTTIEAQSDGGTVAILNGSSLRSLVAGLNSIGVKPDGIIAILQSIK 359

Query: 358 AAGALQSEIIIQ 369
           +AGALQ+E+++Q
Sbjct: 360 SAGALQAELVLQ 371


>gi|120598236|ref|YP_962810.1| flagellar basal body P-ring protein [Shewanella sp. W3-18-1]
 gi|146293686|ref|YP_001184110.1| flagellar basal body P-ring protein [Shewanella putrefaciens CN-32]
 gi|120558329|gb|ABM24256.1| flagellar P-ring protein [Shewanella sp. W3-18-1]
 gi|145565376|gb|ABP76311.1| flagellar P-ring protein [Shewanella putrefaciens CN-32]
 gi|319427085|gb|ADV55159.1| flagellar P-ring protein [Shewanella putrefaciens 200]
          Length = 363

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 155/373 (41%), Positives = 218/373 (58%), Gaps = 16/373 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M F+    +  LI           RIKD+ ++Q  R NQLIGYGLVVGL GTG+      
Sbjct: 1   MRFKRIIALAILIFSLPSQ---AERIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTN--- 54

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+  ++L+N GI+ P   R   KNVA V V A++P F  PG  +DV+++SLG+A SL
Sbjct: 55  YTEQTFTTMLKNFGINLPDNFRPKIKNVAVVAVHADMPAFIKPGQELDVTVSSLGEAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T L G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGAIVER +
Sbjct: 115 RGGTLLQTFLKGVDGNVYAIAQGSLVVSGFSAEGLDGSKVIQNTPTVGRIPNGAIVERSV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R+AD IN          +A   D+ +V+VS P ++  
Sbjct: 175 ATPFSSGDYLTFNLRRADFSTAQRMADAINDL----LGPDMARPLDATSVQVSAPRDVSQ 230

Query: 238 LTRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E L V   +  A+VI+N RTGTIV+G NV++    +++G LTV I E  QV 
Sbjct: 231 RVSFLATLENLDVIPAEESAKVIVNSRTGTIVVGQNVKLLPAAITHGGLTVTIAEATQVS 290

Query: 297 QPNAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPNA  +NG TV   +T + VS+ ++  F       L+ L+  +N +G     +++IL+ 
Sbjct: 291 QPNAL-ANGETVVTADTTIGVSESDRRMFMFSPGTTLDELVRAVNLVGAAPSDVLAILEA 349

Query: 356 IKAAGALQSEIII 368
           +K AGAL  E+II
Sbjct: 350 LKVAGALHGELII 362


>gi|91792668|ref|YP_562319.1| flagellar basal body P-ring protein [Shewanella denitrificans
           OS217]
 gi|91714670|gb|ABE54596.1| flagellar P-ring protein [Shewanella denitrificans OS217]
          Length = 366

 Score =  388 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 150/372 (40%), Positives = 217/372 (58%), Gaps = 11/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M  +  F + ++  +         RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   
Sbjct: 1   MKIKSIFFLAAVTSMMLSMPIQAQRIKDMANVQGVRSNQLIGYGLVVGLPGTGEKTR--- 57

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+ R++L+N GI+ P   R  SKNVA V V A +P F  PG  +DV+++SLG+A SL
Sbjct: 58  YTEQTFRTMLKNFGINLPDSVRPNSKNVAVVAVHAEMPAFIKPGQNLDVTVSSLGEAKSL 117

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T + G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGAI+ER +
Sbjct: 118 RGGTLLQTFMKGVDGNVYAIAQGSLVVSGFSAEGLDGSRVIQNTPTVGRIPNGAIIERSV 177

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L   L   DFSTA  + D IN          +A+A D+ +++VS P +   
Sbjct: 178 PSPFASGDHLTFNLHRADFSTAKNMVDAINDL----LGPGMAKAIDASSIQVSAPRDASQ 233

Query: 238 LTRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E + V   D  A+VI+N RTGTIV+G NV++    V++G LTV I E+ QV 
Sbjct: 234 RVSYLATLENIEVTIADESAKVIVNSRTGTIVVGQNVQLLPAAVTHGGLTVTIAESTQVT 293

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPNA +   + VT N+T      ++  F       L+ L+  +N +G     +++IL+ +
Sbjct: 294 QPNALAGGETAVTANSTIDVAEQDRRMFMFSPGTTLDELVRAVNLVGAAPSDVLAILEAL 353

Query: 357 KAAGALQSEIII 368
           K AGAL  E+II
Sbjct: 354 KMAGALHGELII 365


>gi|88858139|ref|ZP_01132781.1| flagellar P-ring protein precursor [Pseudoalteromonas tunicata D2]
 gi|88819756|gb|EAR29569.1| flagellar P-ring protein precursor [Pseudoalteromonas tunicata D2]
          Length = 364

 Score =  388 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 147/370 (39%), Positives = 216/370 (58%), Gaps = 11/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +      +L  L   +A V  RIKDV  ++  RDNQL+GYGLVVGL GTG+    S FT
Sbjct: 1   MKNFLCSIALFLLLFSTASVAERIKDVSMVEGVRDNQLVGYGLVVGLPGTGE---QSRFT 57

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQ+ +++L   GI+ P   +   KNVAAV V A LPPF  PG  IDV+++S+G A SLRG
Sbjct: 58  EQTFKAMLSGFGIALPDNLKPKIKNVAAVAVHAKLPPFIKPGQTIDVTVSSIGSAGSLRG 117

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DGN+YA+AQGS++VSGL    G  S  +    T G++ NGA VER +P 
Sbjct: 118 GTLLQTFLKGIDGNVYAIAQGSLIVSGLGAEGGDGSRILVNTPTVGRVPNGATVERAVPN 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L  PDF+TA R+A+ IN+          A A D+ +V+V  P ++    
Sbjct: 178 PFSQGDFITFNLHRPDFTTAKRLAETINNLV----GPNSASAQDAASVRVIAPRDVSQRV 233

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L  +  DT A++++N RTGTIVIG +V++    +++G LTV I EN+ V QP
Sbjct: 234 AYLSTLENLEFKPADTSAKILVNSRTGTIVIGKDVKLQPAAITHGGLTVTIAENQDVSQP 293

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           N  ++  +TVT  +      D+  +F       L+ L+  +N +G     +++IL+ +K 
Sbjct: 294 NPLATGDTTVTTQSIIDVSRDDSRAFVFNPGVSLDDLVRAINEVGAAPGDLMAILEALKE 353

Query: 359 AGALQSEIII 368
           AGA+  ++I+
Sbjct: 354 AGAISGQLIV 363


>gi|92114094|ref|YP_574022.1| flagellar basal body P-ring protein [Chromohalobacter salexigens
           DSM 3043]
 gi|123084032|sp|Q1QW35|FLGI_CHRSD RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|91797184|gb|ABE59323.1| flagellar P-ring protein [Chromohalobacter salexigens DSM 3043]
          Length = 369

 Score =  388 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 142/373 (38%), Positives = 225/373 (60%), Gaps = 10/373 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M   + ++   L+     +     RI+D+ S    R+NQL+GYGLVVGL GTGD    +P
Sbjct: 1   MRSLLRWMGVLLLCGLCAAPAQAERIRDLASFAGVRENQLVGYGLVVGLDGTGDQTTQTP 60

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT Q++ ++L  LG+S P G  +  +NVAAVMVTA LPPFA  G  +DV+++S+G+A SL
Sbjct: 61  FTGQTLINMLSQLGVSIPEGTNMQLRNVAAVMVTAQLPPFARQGQEMDVTVSSMGNADSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G DGN+YA+AQG++++ G+  +   SS     +  G+I  GA VE+E+ 
Sbjct: 121 RGGTLLMTPLRGVDGNVYAMAQGNLLIGGVGAQQAGSSVQVNHTAAGRIPGGATVEQEVA 180

Query: 180 KKFKDSA-DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID- 237
            +   +   L L L   DF+TA R+ + IN      F  P+A A D R ++++ P++ + 
Sbjct: 181 LQLGRADGTLDLYLNESDFTTAQRVVEAIN----RDFGSPVAAAMDGRLIRLNAPSDSNS 236

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               M+ ++ L V  +  PA+VI+N RTG++V+   V + +  V++GNL+V I  N QV 
Sbjct: 237 RVNFMARIQNLDVTPNQGPAKVIVNSRTGSVVLNREVTLDRAAVAHGNLSVTIDSNPQVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQG 355
           QPN     G TV   + D+ +    G+  +++ + DL  +++ +N++G     ++SILQ 
Sbjct: 297 QPNPL-GEGETVVVPDADISIQQEGGALQMVNTSADLMDVVNALNALGASPQDLMSILQA 355

Query: 356 IKAAGALQSEIII 368
           +K+AGAL +E+ I
Sbjct: 356 LKSAGALNAELEI 368


>gi|94987186|ref|YP_595119.1| flagellar basal body P-ring protein [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731435|emb|CAJ54798.1| Flagellar basal-body P-ring protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 379

 Score =  388 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 149/369 (40%), Positives = 234/369 (63%), Gaps = 9/369 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           I R ++L    I +    AQ   RIKD+ +    R+NQLIGYGLV+GL GTGD  R SPF
Sbjct: 17  IIRSSYLTLLFIAVFHNPAQ-SVRIKDIATFSGVRNNQLIGYGLVIGLAGTGDK-RDSPF 74

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T  SM ++L+ +G++    ++  KNVAAVMVTAN+P  A PG+ +DV+++S+GDA SL+G
Sbjct: 75  TASSMTNMLERMGVAVDANKIKPKNVAAVMVTANMPVSARPGTELDVTVSSVGDAKSLQG 134

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G+L+ T L G DG +YA+AQGS+++ G   +G ++S  +  +T G I  G IVE+ +P  
Sbjct: 135 GVLLQTPLKGVDGKVYALAQGSLIIGGYSAEGTAASVQKNSTTVGSIPGGGIVEKGIPFD 194

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLT 239
           F    +L L + + DFST +++ +++N+     F    A A D+ TV++  P     +L 
Sbjct: 195 FNTQQNLTLNMNSNDFSTTMQVVNRLNATMGGNF----ASAIDAGTVRIDIPPAYKGNLV 250

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            L++ +E L +  ++ A+V+++E+TGTIV+G  VR+S+V V++GNL V I E+ QV QP 
Sbjct: 251 PLIASIENLEINPESVAKVVVDEKTGTIVLGREVRLSRVAVAHGNLQVVIQESAQVSQPG 310

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
            F S G TV    T+L + +     +L++   L  L+ G+N+IG     +ISIL+ +KAA
Sbjct: 311 PF-SQGQTVITPETNLTLQEETKRLNLLEGASLQELVDGLNAIGATPRDMISILRALKAA 369

Query: 360 GALQSEIII 368
           G+L +++ +
Sbjct: 370 GSLHAQLEV 378


>gi|119477949|ref|ZP_01618049.1| flagellar P-ring protein precursor I [marine gamma proteobacterium
           HTCC2143]
 gi|119448862|gb|EAW30104.1| flagellar P-ring protein precursor I [marine gamma proteobacterium
           HTCC2143]
          Length = 403

 Score =  388 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 151/369 (40%), Positives = 221/369 (59%), Gaps = 10/369 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
            A  I  ++     S    +R+KD+ S+   RDN LIGYGLVVGL GTGD    +PFT Q
Sbjct: 39  CAVCILLIVVSITSSTVFAARLKDIASVAGVRDNPLIGYGLVVGLDGTGDQTTQTPFTTQ 98

Query: 65  SMRSLLQNLGISTPGGR-LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           S RS+++ LG++ P G+    KNVAAV + A LPPF+ PG  IDV+++S+G++ SLRGG 
Sbjct: 99  SFRSMMKQLGVAIPDGQKFQLKNVAAVTIHAVLPPFSKPGQPIDVTVSSIGNSKSLRGGS 158

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKF 182
           L+M+ L GADG +YA+AQG +VV G  V+G   S     I + G+I NGAIVER++   F
Sbjct: 159 LLMSPLKGADGQVYAIAQGELVVGGFGVEGSDGSKVTVNIPSAGRIPNGAIVERKISNSF 218

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRL 241
                L   L+  DF+TA R+A+ IN          +A+A D+ ++ V+ P +       
Sbjct: 219 SQGTSLTFNLKRSDFTTARRVAESINEL----LGPDVAKAADATSINVTAPIDPDQRVSY 274

Query: 242 MSEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           MS +E + VE    A R++IN RTGTIV+G+NV +    V++G+LTV I    +V QPN 
Sbjct: 275 MSLLENIEVEPGREAARIVINSRTGTIVVGENVVVRAGAVTHGSLTVTIKNASEVSQPNP 334

Query: 301 FSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           F  +G TV    T++ V+      F    +  L+ ++  +N IG     +++IL+ +K A
Sbjct: 335 F-GDGETVVLPQTEVSVTQEANRMFVFEASTTLDEIVRAVNQIGAAPGDLMAILEALKQA 393

Query: 360 GALQSEIII 368
           GALQ+E+I+
Sbjct: 394 GALQAELIV 402


>gi|163750566|ref|ZP_02157804.1| flagellar P-ring protein precursor [Shewanella benthica KT99]
 gi|161329721|gb|EDQ00710.1| flagellar P-ring protein precursor [Shewanella benthica KT99]
          Length = 363

 Score =  388 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 153/371 (41%), Positives = 225/371 (60%), Gaps = 14/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +  F+ F L+ +   +     RIKD+ ++Q  R NQLIGYG+VVGL GTG+  R   +T
Sbjct: 1   MKYKFITFLLL-VFVAAPSQAQRIKDMANVQGVRHNQLIGYGMVVGLPGTGEKTR---YT 56

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQ+ +++L+N G++ P   R   KNVA V+V A++PPF  PG  IDV+++S+G+A SLRG
Sbjct: 57  EQTFKTMLKNFGVNLPDNFRPKIKNVAVVVVHADMPPFIKPGQTIDVTVSSMGEAKSLRG 116

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DG++YA+AQGS+VVSG   +G   S  M+   T G+I NGAIVER +  
Sbjct: 117 GTLIQTFLKGVDGHVYAIAQGSMVVSGFSAEGLDGSKVMQNTPTVGRIPNGAIVERAVAT 176

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     L   LR  DFSTA R+AD IN          IA   D+ +++VS P ++    
Sbjct: 177 PFSSGDYLTFNLRRADFSTAKRLADAINDL----LGPGIARPLDAASIQVSAPRDVSQRV 232

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++ +E + VE  +  A++I+N RTGTIV+G NVR+    V++G LTV I E  QV QP
Sbjct: 233 SFLATLENIQVEPAEESAKIIVNSRTGTIVVGKNVRLLPAAVTHGGLTVTIAEATQVSQP 292

Query: 299 NAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           NA  + G TV  +++ L V++ ++  F       L+ L+  +N +G     +++IL+ + 
Sbjct: 293 NAL-AGGQTVVTSDSTLDVNESDRRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEALN 351

Query: 358 AAGALQSEIII 368
            AGALQ E+II
Sbjct: 352 VAGALQGELII 362


>gi|260774942|ref|ZP_05883843.1| flagellar P-ring protein FlgI [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609197|gb|EEX35355.1| flagellar P-ring protein FlgI [Vibrio coralliilyticus ATCC BAA-450]
          Length = 363

 Score =  388 bits (997), Expect = e-106,   Method: Composition-based stats.
 Identities = 150/357 (42%), Positives = 215/357 (60%), Gaps = 13/357 (3%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
             +    +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+QS  ++L+N GI 
Sbjct: 14  ASTPAYAARIKDVSQVAGVRSNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLENFGIQ 70

Query: 77  TPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
            P G +  SKNVAAV+VTA+L  F+  G  IDV+++S+G A SLRGG L+ T L G DG 
Sbjct: 71  LPPGTKPKSKNVAAVIVTADLAAFSKQGQTIDVTVSSIGSAKSLRGGTLMQTMLKGLDGQ 130

Query: 136 IYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRN 194
           IYAVAQG++VVSG        S  +    T G I NGAIVERE+P  F     +   L  
Sbjct: 131 IYAVAQGNLVVSGFSATGADGSKIVGNNPTAGMISNGAIVEREIPSPFGRGDYITFNLLE 190

Query: 195 PDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETD 253
            DF+TA R+AD +N++        +A+A D+ +VKV  P +I      +S +E L     
Sbjct: 191 SDFTTAQRMADAVNNF----LGPQMAQAIDATSVKVRAPRDISQRVSFLSAIENLEFNPA 246

Query: 254 T-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNN 312
              A++I+N RTGTIV+G +VR+    +++G +TV I EN  V QPNAF   G TV   +
Sbjct: 247 EGSAKIIVNSRTGTIVVGKHVRLKPAAITHGGMTVAIKENLNVSQPNAF-GGGETVVTPD 305

Query: 313 TDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           TD++V++ +G  F       L+ L+  +N +G     +++ILQ +K AGA++ ++I+
Sbjct: 306 TDIEVTEEQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLIV 362


>gi|260431759|ref|ZP_05785730.1| flagellar P-ring protein FlgI [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415587|gb|EEX08846.1| flagellar P-ring protein FlgI [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 364

 Score =  388 bits (997), Expect = e-106,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 236/369 (63%), Gaps = 9/369 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +  L F L+ L  ++     R+KD+V     R N L+GYGLVVGL GTGD LR+SPFTE+
Sbjct: 1   MRLLAFVLMLLPTVAFSGAVRLKDLVDFDGVRGNDLVGYGLVVGLNGTGDGLRNSPFTEE 60

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            M ++L+ LG++  G     KNVAAV+VTA LPPF+  GS+IDV+++++GD+ SL GG L
Sbjct: 61  IMSNILERLGVNVNGEDFRPKNVAAVLVTATLPPFSRVGSQIDVTVSAIGDSKSLLGGTL 120

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           VMT L  ADG IYAVAQG+V+  G   +G+++    G+ T G I +GA VERE+  +F  
Sbjct: 121 VMTPLNAADGQIYAVAQGTVLAGGAVAEGEAAKVTRGVPTSGVIPSGARVEREIDFEFSG 180

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP--TNIDLTRLM 242
              L L LR PDF+TA RI   IN      F+RP+A   DS TV++S P          +
Sbjct: 181 LTQLRLALREPDFTTAGRIEAAIN----REFNRPVAIMRDSGTVELSIPETRAASTAHAV 236

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
             +E + +E ++ ARV++++R+GTIV+G +VRIS+V VS GNLT+++ E    VQPN F 
Sbjct: 237 GRIENILIEPESKARVVVDQRSGTIVMGQDVRISRVAVSQGNLTLRVEEAPIAVQPNPF- 295

Query: 303 SNGSTVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           + G +V    T   + + +G+    + +A  L+ +++G+N++G+    +I IL+ IKAAG
Sbjct: 296 AEGESVVVPRTVAGIEEEEGTGLAEIPEATTLSEVVAGLNALGVSPRDMIDILKTIKAAG 355

Query: 361 ALQSEIIIQ 369
           AL +E I++
Sbjct: 356 ALHAEFIVR 364


>gi|332140550|ref|YP_004426288.1| flagellar basal body P-ring protein [Alteromonas macleodii str.
           'Deep ecotype']
 gi|226701941|sp|B4RV29|FLGI_ALTMD RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|327550572|gb|AEA97290.1| flagellar basal body P-ring protein [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 370

 Score =  388 bits (997), Expect = e-106,   Method: Composition-based stats.
 Identities = 155/372 (41%), Positives = 222/372 (59%), Gaps = 9/372 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R+  ++ ++  L   S     RIKDV S+Q  R NQL+GYGLVVGL GTG+    SPFT
Sbjct: 1   MRLFSVVLAVFTLLLPSQAFAQRIKDVASIQGVRSNQLVGYGLVVGLPGTGE---QSPFT 57

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQS R++L+N GIS     +   +NVAAV V A+LP FA PG  ID++++S+G+A+SL+G
Sbjct: 58  EQSFRTMLRNFGISLDANTKPKIRNVAAVAVHADLPAFAKPGQTIDITVSSVGEAASLQG 117

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DG +YAVAQGS+VVSG     G  S  +    T G+I NGA+VE+ +P 
Sbjct: 118 GTLLQTFLRGVDGKVYAVAQGSLVVSGFGAQGGDGSRIVVNTPTVGRIPNGAMVEQSVPT 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSL--NRFSRPIAEAYDSRTVKVSKPTNI-D 237
            F +   L L L  PDFSTA  +AD IN            IA+  D+ +V+VS P ++  
Sbjct: 178 GFANGDTLTLNLHYPDFSTAKSLADTINERLGAQPENGYVIAKPIDAASVRVSAPRDVGQ 237

Query: 238 LTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E       D PARV+IN RTGTIVIG +VR+    +++G LTV I+EN+QV 
Sbjct: 238 RVGFLATLENFEFTPADAPARVVINSRTGTIVIGSDVRLLPAAITHGGLTVTISENQQVT 297

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPNAF+   + +T  +       +   F       L+ L+  +N +G     +++IL+ +
Sbjct: 298 QPNAFADGQTAITTQSIVDVDLADSRMFKFEPGVTLDQLVRAVNEVGAAPGDLMAILEAL 357

Query: 357 KAAGALQSEIII 368
           + AGAL+ E++I
Sbjct: 358 RHAGALRGELVI 369


>gi|83647169|ref|YP_435604.1| flagellar basal body P-ring protein [Hahella chejuensis KCTC 2396]
 gi|115311517|sp|Q2SDU5|FLGI2_HAHCH RecName: Full=Flagellar P-ring protein 2; AltName: Full=Basal body
           P-ring protein 2; Flags: Precursor
 gi|83635212|gb|ABC31179.1| Flagellar basal-body P-ring protein [Hahella chejuensis KCTC 2396]
          Length = 378

 Score =  388 bits (997), Expect = e-106,   Method: Composition-based stats.
 Identities = 153/370 (41%), Positives = 225/370 (60%), Gaps = 13/370 (3%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           R++  +F+L  L   +     RIKD+ +++  R NQ++GYGLVVGL GTGD    +PFT+
Sbjct: 16  RVSRALFALGLLCFAAMAGAERIKDIATVEGVRSNQIVGYGLVVGLDGTGDK---APFTD 72

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           Q+ R+++   GI+ P G     KNVAAV V A+LP F+ PG +ID++++S+G+A SLRGG
Sbjct: 73  QTFRNMMNRFGITIPAGTDPKLKNVAAVSVHADLPAFSKPGQKIDITVSSVGNAKSLRGG 132

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVERELPKK 181
            L+MT+L GADG  YAVAQG++VV G    G   SS    + + G+I NGA VER +P  
Sbjct: 133 SLLMTNLKGADGKTYAVAQGNLVVGGFGAGGADGSSITVNVPSVGRIPNGATVERAVPSS 192

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F     L L L +PDF+TA R+ D+IN          +A+A D+ +++V  P        
Sbjct: 193 FSHGDTLTLNLSSPDFTTAKRVQDRINDL----LGPGLAQAVDAASIRVMAPREASQRVG 248

Query: 241 LMSEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +S +E L VE    A +++IN RTGTIV+G NV++    V++GNLTV ITE+  V QPN
Sbjct: 249 FLSILENLEVEPGQEAAKIVINSRTGTIVVGQNVKVLPAAVTHGNLTVTITEDFGVSQPN 308

Query: 300 AFSSNGSTVTQNNTDLKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           A  + G TV    TD+ V       F    A  LN ++  +N +G     ++++L+ +K 
Sbjct: 309 AL-AGGDTVVVPQTDVNVEQEPSRMFKFGPAATLNDIVRAVNQVGAAPGDVMAVLEALKQ 367

Query: 359 AGALQSEIII 368
           AGAL++E+I+
Sbjct: 368 AGALKAELIV 377


>gi|83858813|ref|ZP_00952335.1| Flagellar P-ring protein [Oceanicaulis alexandrii HTCC2633]
 gi|83853636|gb|EAP91488.1| Flagellar P-ring protein [Oceanicaulis alexandrii HTCC2633]
          Length = 367

 Score =  388 bits (997), Expect = e-106,   Method: Composition-based stats.
 Identities = 161/370 (43%), Positives = 240/370 (64%), Gaps = 7/370 (1%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R+   +  L  L    A+   RIKD+  ++  RDNQL+GYGLVVGL G+GD+LR++ F
Sbjct: 1   MTRLFVTLALLFCLAAPVAEANPRIKDIADVEGVRDNQLVGYGLVVGLDGSGDTLRNAVF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T Q++ S+L+   I+     L + NVAAV+VTA LPPFA  GSR+DV++++LGDA SL+G
Sbjct: 61  TRQALNSMLERFNINVREADLRTGNVAAVIVTAELPPFAMQGSRVDVTVSALGDADSLQG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G+L+ T L+ A+G++YAVAQGS+ V G   +G  +S   G+ T G+I NG ++EREL   
Sbjct: 121 GVLIATPLMAANGDVYAVAQGSLAVGGFSAEGDGASITRGVPTNGRIANGGVIERELEWD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP--TNIDLT 239
               A + L LRNPDF+TA R+A  IN+Y         A A +  TV +++P   + D+ 
Sbjct: 181 LAGQAQIRLALRNPDFTTARRMAQTINAY----LGADAAAAQNPSTVALTRPLYFDGDMV 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            L++EVE L VETD  ARV+I+E TGTIV+G++VR+S V ++ G LT+ +TE+ +V Q  
Sbjct: 237 ALLAEVEQLRVETDMRARVVIDESTGTIVMGEDVRVSTVAIAQGGLTITVTESPEVSQAL 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKA 358
            F+  G T+    T++   +    F +++    L  L+ G+N++G+    +I+ILQ IKA
Sbjct: 297 PFADGGQTIEVPRTNVTAEEELREFGVLNGTVSLRELVDGLNALGVSPRDMITILQSIKA 356

Query: 359 AGALQSEIII 368
           AGALQ+EI +
Sbjct: 357 AGALQAEIEV 366


>gi|330830299|ref|YP_004393251.1| flagellar P-ring protein FlgI [Aeromonas veronii B565]
 gi|328805435|gb|AEB50634.1| Flagellar P-ring protein FlgI [Aeromonas veronii B565]
          Length = 365

 Score =  388 bits (996), Expect = e-106,   Method: Composition-based stats.
 Identities = 146/370 (39%), Positives = 220/370 (59%), Gaps = 10/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +   L+  L  L  +     +RIKD+ S++  R+NQLIGYGLVVGL GTG+  +++ FT
Sbjct: 1   MKSLRLVTLLCCLLPLGVANAARIKDISSVEGVRNNQLIGYGLVVGLPGTGE--KNNAFT 58

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQ+ R++L N GI  P   +   K+VA V + A+LPPF+ PG  IDV+++++G+A SLRG
Sbjct: 59  EQTFRTMLNNFGIKVPDNIKPKIKDVAPVAIHADLPPFSKPGQTIDVTVSAIGEAKSLRG 118

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ + L G DG +YAVAQGS+VV GL  +G   S  +    T G+I NGA VERE+P 
Sbjct: 119 GTLLQSFLKGLDGRVYAVAQGSLVVGGLGAEGADGSKVVINTPTVGRIANGATVEREVPN 178

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L  PDF+TA R+AD +N           A+A D+ +VKV  P +     
Sbjct: 179 SFSQGDTITFNLNRPDFTTARRLADVVNDLV----GPNTAQALDATSVKVYAPRDPGQRV 234

Query: 240 RLMSEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++ +E L V+    A ++I+N RTGTIVIG  V++    +S+G LTV I EN+QV QP
Sbjct: 235 SYLATIENLEVDPANEAAKIIVNSRTGTIVIGSQVKLKPAAISHGGLTVTIAENQQVSQP 294

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           N  +   +TVT N+T     +    F       L+ L+  +N +G+    +++IL+ ++ 
Sbjct: 295 NPLAGGETTVTNNSTINVQQEPGRMFKFDTGATLDDLVRAVNQVGVAPGDLMAILEALQQ 354

Query: 359 AGALQSEIII 368
           AGA++ +++I
Sbjct: 355 AGAIEGQLVI 364


>gi|189426327|ref|YP_001953504.1| flagellar basal body P-ring protein [Geobacter lovleyi SZ]
 gi|189422586|gb|ACD96984.1| flagellar P-ring protein [Geobacter lovleyi SZ]
          Length = 363

 Score =  388 bits (996), Expect = e-106,   Method: Composition-based stats.
 Identities = 158/369 (42%), Positives = 217/369 (58%), Gaps = 10/369 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +       L  +        SRIKD+ +    RDNQL+GYGLVVGL G+GDS   + F 
Sbjct: 1   MKRIVASILLFIVTLPLTAHASRIKDIAAFDGVRDNQLVGYGLVVGLNGSGDSD-QTKFP 59

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
            QS+ S+L+ +G++     +  KNVAAVMVTA LPPFA  G+++DV ++SLGDA ++ GG
Sbjct: 60  VQSLVSMLERMGVTINRSDVKVKNVAAVMVTATLPPFAKQGTKLDVLVSSLGDAKTIAGG 119

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L GAD  +YAVAQGS++ +     GQ +S  +   T G+I  GA+VERELP   
Sbjct: 120 TLIMTPLKGADNQVYAVAQGSILTNSFAFAGQGASATKNHPTAGRIPAGALVERELPNVL 179

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTR 240
                L L L   DF+TA RI   IN           A + D  +V V  P +       
Sbjct: 180 AGKRSLRLNLAQSDFTTASRIVAAINKNFKEA-----ASSSDGGSVTVQIPDDFANRPVE 234

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
            ++++E L V  D PARV++NERTGTIV+GD V+IS V VS+GNLT+ + E  +VVQP  
Sbjct: 235 FIAQLENLEVTQDQPARVVVNERTGTIVMGDKVKISSVAVSHGNLTLTVKETPKVVQPK- 293

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
             + G T     T+LKV + K     L D   +  ++ G+N +G+    +ISILQ IKAA
Sbjct: 294 LLAKGETKEVPRTELKVQEEKNRLSVLPDGNTIGDVVRGLNLLGVTPRDLISILQSIKAA 353

Query: 360 GALQSEIII 368
           GALQ+E++I
Sbjct: 354 GALQAELVI 362


>gi|2494541|sp|Q52082|FLGI_PSEPU RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|405550|gb|AAA62846.1| flagellar P-ring protein [Pseudomonas putida]
          Length = 367

 Score =  388 bits (996), Expect = e-106,   Method: Composition-based stats.
 Identities = 148/372 (39%), Positives = 216/372 (58%), Gaps = 11/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F +  LI + + L    A    R+KD+ S+   R NQLIGYGLVVGL GTGD    +PF
Sbjct: 1   MFNVRQLIATTLLLSCAFAAQAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPG--GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T Q+  ++L   GI  P   G +  KNVAAV V A+LPPFA PG  +D++++S+G++ SL
Sbjct: 61  TLQTFNNMLSQFGIKVPAGSGNVQLKNVAAVSVHADLPPFAKPGQVVDITVSSIGNSKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT L G DGN+YA+AQG++VV G   +G   S     + + G+I  GA VER +
Sbjct: 121 RGGSLLMTPLKGIDGNVYAIAQGNLVVGGFDAQGRDGSKITVNVPSAGRIPGGASVERAV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     L L L  PDF+TA RI D++N          +A+A    +V+VS P +   
Sbjct: 181 PSGFNQGNTLTLNLNRPDFTTAKRIVDKVNDL----LGPGVAQAVHGGSVRVSAPMDPSQ 236

Query: 238 LTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L ++     A+VIIN RTGTIVIG NV++S   V++G+LTV ITE+  V 
Sbjct: 237 RVDYLSILENLEIDPGQAVAKVIINSRTGTIVIGQNVKVSP-AVTHGSLTVTITEDPIVS 295

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QP AFS+  + V   +      + K  F       L+ ++  +N +G     +++IL+ +
Sbjct: 296 QPGAFSNGQTAVVPRSRVNAEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGNLMAILEAL 355

Query: 357 KAAGALQSEIII 368
           K    LQ+++I+
Sbjct: 356 KH-RPLQADLIV 366


>gi|163742562|ref|ZP_02149948.1| flagellar P-ring protein precursor I [Phaeobacter gallaeciensis
           2.10]
 gi|161384147|gb|EDQ08530.1| flagellar P-ring protein precursor I [Phaeobacter gallaeciensis
           2.10]
          Length = 367

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 154/372 (41%), Positives = 231/372 (62%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R   ++F+++ L  ++     R+KD+V     R N L+GYGLVVGL GTGD LR+SPF
Sbjct: 1   MMRFIRILFAVMLLPAMAQANAIRLKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNSPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE+ M ++L+ LG++  G +   KNVAAV VTA LPPFA  G  +DV+++++GD+ SL G
Sbjct: 61  TEEIMSNILERLGVNVTGEQFRPKNVAAVFVTATLPPFARVGGTVDVTVSAIGDSKSLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G LVMT L  ADG IYAVAQG+++  G   +G+ +S  +G+ T G I +GA VERE+   
Sbjct: 121 GTLVMTPLNAADGQIYAVAQGTILAGGAVAEGEGASVTQGVPTAGVIPSGARVEREIDFD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNIDLT 239
                 + L LR PDF+TA RI   IN+     F R +A   DS TV+V           
Sbjct: 181 LSSLTSMRLALREPDFTTAGRIERAINA----EFGRNVALMQDSGTVEVDVQRTNTRSTA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             +  +E + VE    ARV++++R+GTIV+G +VRIS+V V+ GNLT++I E   VVQPN
Sbjct: 237 HAVGRIENILVEPQRKARVVVDQRSGTIVMGSDVRISRVAVAQGNLTLRIEETPLVVQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKG--SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F ++G TV    T   + + +G     + +   L+ +++G+N++G+    +I IL+ +K
Sbjct: 297 PF-ADGETVIVPRTGAAIEEEEGIQLAEVPETTSLSEVVAGLNALGVSPRDMIDILKSLK 355

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E +++
Sbjct: 356 AAGALHAEFVVR 367


>gi|15964417|ref|NP_384770.1| flagellar basal body P-ring protein [Sinorhizobium meliloti 1021]
 gi|307311559|ref|ZP_07591200.1| flagellar P-ring protein [Sinorhizobium meliloti BL225C]
 gi|307318914|ref|ZP_07598345.1| flagellar P-ring protein [Sinorhizobium meliloti AK83]
 gi|17380482|sp|Q52948|FLGI_RHIME RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|15073594|emb|CAC45236.1| Flagellar P-ring precursor transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|306895328|gb|EFN26083.1| flagellar P-ring protein [Sinorhizobium meliloti AK83]
 gi|306899576|gb|EFN30205.1| flagellar P-ring protein [Sinorhizobium meliloti BL225C]
          Length = 371

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 223/364 (61%), Positives = 284/364 (78%), Gaps = 1/364 (0%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
              +  +      SA   SRIKDV SLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT+QS
Sbjct: 9   LLTLAVVFAATLTSAYAASRIKDVASLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTDQS 68

Query: 66  MRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           +R++LQNLGIST GG   ++NVAAV+VTA LPPFASPGSR+DV++ SLGDA+SLRGG LV
Sbjct: 69  IRAMLQNLGISTQGGDSRTRNVAAVLVTATLPPFASPGSRLDVTVGSLGDATSLRGGTLV 128

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MTSL GADG IYAVAQGSVVVSG   +G+++   +G++T G++ NGAI+ERELP KFKD 
Sbjct: 129 MTSLSGADGQIYAVAQGSVVVSGFNAQGEAAQLSQGVTTAGRVPNGAIIERELPSKFKDG 188

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEV 245
            +L+LQLRNPDFSTA+ +A  IN Y+  +F   IAEA DS++V V KP   DL RLM++V
Sbjct: 189 FNLVLQLRNPDFSTAVGMAAAINRYAAAQFGGRIAEALDSQSVLVQKPKMADLARLMADV 248

Query: 246 EMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
           E L +ETD PARV+INERTGTIVIG +VR+++V VSYG LTVQ++E   +VQP  F S G
Sbjct: 249 ENLVIETDAPARVVINERTGTIVIGQDVRVAEVAVSYGTLTVQVSETPTIVQPEPF-SRG 307

Query: 306 STVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSE 365
            T  + NT ++   + G+ ++++   L SL++G+NSIG+K DGII+ILQ IK+AGALQ+E
Sbjct: 308 ETAYEPNTTIEAQADGGTVAILNGSSLRSLVAGLNSIGVKPDGIIAILQSIKSAGALQAE 367

Query: 366 IIIQ 369
           +++Q
Sbjct: 368 LVLQ 371


>gi|312115247|ref|YP_004012843.1| flagellar P-ring protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311220376|gb|ADP71744.1| flagellar P-ring protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 367

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 170/365 (46%), Positives = 247/365 (67%), Gaps = 6/365 (1%)

Query: 10  FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSL 69
             +  L    A   +RIKD+  +Q+ R NQL+GYG+VVGL GTGD+LRSSPFT QS++S+
Sbjct: 4   LLIALLLIQPAHATTRIKDIAVIQNVRPNQLVGYGIVVGLNGTGDNLRSSPFTSQSIQSM 63

Query: 70  LQNLGISTPGG-----RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           L  +G++         ++ +KN AAV+VT  LP FA  G RIDV+++SLG+A+SL GG L
Sbjct: 64  LDRMGVNIRNNLMNNSQVQTKNAAAVIVTGELPAFAREGGRIDVTVSSLGNATSLEGGTL 123

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           +MT L  AD  IYA AQG V VSG    G++    +G+ T G+I NGA+VER LP + + 
Sbjct: 124 LMTPLSAADSVIYAAAQGQVSVSGFTAGGRAEKLTQGVPTAGRIANGALVERRLPIELER 183

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSE 244
                L+L NPDFSTA R AD INSY+ + +    A A D R++++ +P  +D  R +SE
Sbjct: 184 FKSFTLELLNPDFSTATRAADVINSYTTSTYGGRSARAKDLRSIELLRPPRLDAARFISE 243

Query: 245 VEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           +  L ++ DTPAR++I+ERTGT+VIG +V++S V V++GN+TV++TE  +VVQP  F S 
Sbjct: 244 ISELPIQPDTPARIVIDERTGTVVIGRDVKVSTVAVAHGNITVRVTEMPKVVQPAPF-SR 302

Query: 305 GSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
           G T  ++ T +      G+  +++  +L SL++G+N +GLK  GII+ILQ IK+AGALQ+
Sbjct: 303 GETAIEDRTAVNAEQPDGTLFVLNGANLQSLVTGLNRMGLKPQGIIAILQAIKSAGALQA 362

Query: 365 EIIIQ 369
           E+++Q
Sbjct: 363 ELVVQ 367


>gi|308050368|ref|YP_003913934.1| flagellar P-ring protein [Ferrimonas balearica DSM 9799]
 gi|307632558|gb|ADN76860.1| flagellar P-ring protein [Ferrimonas balearica DSM 9799]
          Length = 361

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 150/365 (41%), Positives = 214/365 (58%), Gaps = 13/365 (3%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
             SL+ L    +    R+KD+  +Q  R NQL+GYGLVVGL GTG+    S +TEQS  +
Sbjct: 4   FISLLLLLLPLSAQAMRLKDISDVQGVRSNQLVGYGLVVGLPGTGE---QSRYTEQSFTT 60

Query: 69  LLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +L N GI+ P   R   KNVAAV V A LPPF  PG  ID++++S+G A SLRGG L+ T
Sbjct: 61  MLSNFGINLPANARPKLKNVAAVAVHAELPPFIKPGQSIDITVSSVGSAKSLRGGTLLQT 120

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
            L GADG +YA+AQGS+VVSG   +G   S  ++   T G+I  GA VER +P  F +  
Sbjct: 121 FLKGADGKVYALAQGSLVVSGFSAEGLDGSKVLQNTPTVGRIPGGATVERSVPTPFANGD 180

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEV 245
            L   L  PDFSTA R+ + +N          +A A D+ +V+VS P +       ++ +
Sbjct: 181 FLTFNLHRPDFSTAKRVVEAVNGL----LGPGVARALDATSVQVSAPRDPSQRVSYLATL 236

Query: 246 EMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           E L V+  D  A+VI+N RTGTIV+G +VR+    +++G LTV I+EN  V QPNAF   
Sbjct: 237 ENLQVQPADESAKVIVNSRTGTIVVGKDVRLMPTAITHGGLTVTISENINVSQPNAF-GG 295

Query: 305 GSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G+TV    + + V+ +    F       L+ L+  +N +G     +++IL+ +  AGAL+
Sbjct: 296 GNTVVTPESQIGVTQDDSRMFKFDTGTTLDELVRAVNEVGAAPSDLMAILEALSQAGALR 355

Query: 364 SEIII 368
            E++I
Sbjct: 356 GELVI 360


>gi|170748105|ref|YP_001754365.1| flagellar basal body P-ring protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654627|gb|ACB23682.1| flagellar P-ring protein [Methylobacterium radiotolerans JCM 2831]
          Length = 366

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 178/353 (50%), Positives = 257/353 (72%), Gaps = 1/353 (0%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
             ++   +RIKD+ +LQ  RDNQ++GYGLV GLQ TGD+LR++ FTEQS++S+L  LG++
Sbjct: 15  WPASASATRIKDIATLQGVRDNQIVGYGLVTGLQSTGDTLRNAQFTEQSLQSMLDRLGVN 74

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
               RL ++NVAAVMVTANLP +  PGSR+DVS+NS+GDA+SLRGG L+MT L G DG +
Sbjct: 75  VRDQRLRTRNVAAVMVTANLPAYVEPGSRVDVSVNSMGDATSLRGGTLLMTPLSGGDGQV 134

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAVAQG++VVSG  V GQ+ S + G++T  +I NGA+VER +   F +   + L+L+NPD
Sbjct: 135 YAVAQGALVVSGFSVTGQAESLVSGVATAARIPNGALVERAVAGTFSELPGMALELKNPD 194

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPA 256
           F TA+ I+D IN+Y+L ++ R  A   D RTV +S+P ++  TR M+E+  L V+ D PA
Sbjct: 195 FHTAVLISDAINAYTLQKYGRRAASPRDYRTVVLSRPGHVGRTRFMAEIGELQVQPDIPA 254

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +V+I++RTGT+VIG NV++S V V++G+LTV+ITE  QV QP  F S+G T     TD++
Sbjct: 255 KVVIDQRTGTVVIGRNVQVSTVAVTHGDLTVRITETPQVSQPAPF-SDGQTTVVPRTDIE 313

Query: 317 VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
             +     +++  PDL +LI G+N++G+K   +I+ILQ +K AGALQ+E++IQ
Sbjct: 314 AGERTARLAIVAGPDLQTLIRGLNNVGMKPTDVIAILQAVKTAGALQAELVIQ 366


>gi|89092140|ref|ZP_01165095.1| flagellar P-ring protein precursor [Oceanospirillum sp. MED92]
 gi|89083875|gb|EAR63092.1| flagellar P-ring protein precursor [Oceanospirillum sp. MED92]
          Length = 362

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 144/371 (38%), Positives = 224/371 (60%), Gaps = 15/371 (4%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            + A ++ + + +  +      R+KD+VS+   R NQL+GYGLVVGL GTGD    + FT
Sbjct: 1   MKKALVLVACMLVTVV--AEAGRLKDMVSISGVRSNQLVGYGLVVGLDGTGDK---TAFT 55

Query: 63  EQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            Q+ R++L N G++ P      SKN+AAV + A+LP F+ PG +ID++++++GDA SLRG
Sbjct: 56  SQTFRNMLNNFGVAIPSTTNPSSKNIAAVAIHADLPAFSKPGQKIDITVSAIGDAKSLRG 115

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+M+ + GADG +YAVAQG++VVSG  V+G   S     + + G+I NGA VER +P 
Sbjct: 116 GSLLMSPMKGADGQVYAVAQGNLVVSGFGVQGADGSRLSLNVPSVGRIPNGATVERAVPS 175

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     L+L L +PDF+T+ R+A+QIN          +A + D+ +++V  P +     
Sbjct: 176 GFTQGDSLVLNLHSPDFTTSRRVAEQINHL----LGPDMAASMDATSIRVRAPRDPNQRV 231

Query: 240 RLMSEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L VE    A +V+IN RTGTI+IG NV ++ V +++G LTV I E   V QP
Sbjct: 232 SFLSVLENLNVEPAKDAAKVVINSRTGTIIIGQNVSVAPVAITHGGLTVAIAEELNVDQP 291

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N     G TV    T ++V +  G  F      +L  ++  +N +G     +++IL+ +K
Sbjct: 292 NPL-GQGQTVVTPRTGIEVDEGSGHMFEFAPGANLQDIVEAVNQVGAAPGDLMAILEALK 350

Query: 358 AAGALQSEIII 368
            AGAL++E+++
Sbjct: 351 QAGALKAELVV 361


>gi|126175142|ref|YP_001051291.1| flagellar basal body P-ring protein [Shewanella baltica OS155]
 gi|153001468|ref|YP_001367149.1| flagellar basal body P-ring protein [Shewanella baltica OS185]
 gi|160876199|ref|YP_001555515.1| flagellar basal body P-ring protein [Shewanella baltica OS195]
 gi|217972602|ref|YP_002357353.1| flagellar basal body P-ring protein [Shewanella baltica OS223]
 gi|304409974|ref|ZP_07391593.1| flagellar P-ring protein [Shewanella baltica OS183]
 gi|307302313|ref|ZP_07582071.1| flagellar P-ring protein [Shewanella baltica BA175]
 gi|166214838|sp|A6WQJ7|FLGI_SHEB8 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|189044488|sp|A9KWR8|FLGI_SHEB9 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|254789297|sp|B8E9X6|FLGI_SHEB2 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|125998347|gb|ABN62422.1| flagellar P-ring protein [Shewanella baltica OS155]
 gi|151366086|gb|ABS09086.1| flagellar P-ring protein [Shewanella baltica OS185]
 gi|160861721|gb|ABX50255.1| flagellar P-ring protein [Shewanella baltica OS195]
 gi|217497737|gb|ACK45930.1| flagellar P-ring protein [Shewanella baltica OS223]
 gi|304351383|gb|EFM15782.1| flagellar P-ring protein [Shewanella baltica OS183]
 gi|306914351|gb|EFN44772.1| flagellar P-ring protein [Shewanella baltica BA175]
 gi|315268389|gb|ADT95242.1| flagellar P-ring protein [Shewanella baltica OS678]
          Length = 363

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 150/372 (40%), Positives = 216/372 (58%), Gaps = 14/372 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M +++   +  L+           RIKD+ ++Q  R NQLIGYGLVVGL GTG+      
Sbjct: 1   MKYKLVLAVAVLVFSLPSQ---AERIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTS--- 54

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+  ++L+N GI+ P   +   KNVA V V A++P F  PG  +DV+++SLG+A SL
Sbjct: 55  YTEQTFMTMLKNFGINLPDNVKPKIKNVAVVAVHADMPAFIKPGQDLDVTVSSLGEAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+ T L G DGN+YA+AQGS+VVSG    G   S  ++   T G+I NGAIVER +
Sbjct: 115 RGGTLLQTFLKGVDGNVYAIAQGSLVVSGFSADGLDGSKVIQNTPTVGRIPNGAIVERSV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R+AD IN          +A   D+ +V+VS P ++  
Sbjct: 175 ATPFSTGDYLTFNLRRSDFSTAQRMADAINEL----LGPDMARPLDATSVQVSAPRDVSQ 230

Query: 238 LTRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E L V   +  A+VI+N RTGTIV+G NVR+    +++G +TV I E  QV 
Sbjct: 231 RVSFLATLENLDVIPAEESAKVIVNSRTGTIVVGQNVRLLPAAITHGGMTVTIAEATQVS 290

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPNA ++  +TVT N+T      ++  F       L+ L+  +N +G     +++IL+ +
Sbjct: 291 QPNALANGQTTVTSNSTITATESDRRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEAL 350

Query: 357 KAAGALQSEIII 368
           K AGAL  E+II
Sbjct: 351 KVAGALHGELII 362


>gi|254477264|ref|ZP_05090650.1| flagellar P-ring protein FlgI [Ruegeria sp. R11]
 gi|214031507|gb|EEB72342.1| flagellar P-ring protein FlgI [Ruegeria sp. R11]
          Length = 367

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 155/372 (41%), Positives = 230/372 (61%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + RI   + +L+ L  ++     R+KD+V     R N L+GYGLVVGL GTGD LR+SPF
Sbjct: 1   MMRIVRFLLALVLLPAMAQANAIRLKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNSPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE+ M ++L+ LG++  G +   KNVAAV VTA LPPFA  G  +DV+++++GD+ SL G
Sbjct: 61  TEEIMSNILERLGVNVTGEQFRPKNVAAVFVTATLPPFARVGGTVDVTVSAIGDSKSLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L  ADG IYAVAQG+++  G   +G+ +S  +G+ T G I +GA VERE+   
Sbjct: 121 GTLIMTPLNAADGQIYAVAQGTILAGGAVAEGEGASVTQGVPTAGVIPSGARVEREIDFD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNIDLT 239
                 + L LR PDF+TA RI   IN+     F R +A   DS TV+V           
Sbjct: 181 LASLTSMRLALREPDFTTAGRIERAINA----EFGRSVALMRDSGTVEVDVQRTNARSTA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             +  +E + VE    ARV++++R+GTIV+G +VRIS+V V+ GNLT++I E   VVQPN
Sbjct: 237 HAVGRIENILVEPQRKARVVVDQRSGTIVMGSDVRISRVAVAQGNLTLRIEETPLVVQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKG--SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F S+G TV    T   + + +G     + +   L+ +++G+N++G+    +I IL+ +K
Sbjct: 297 PF-SDGETVVVPRTGAAIDEEEGIQLAEVPETTTLSEVVAGLNALGVSPRDMIDILKSLK 355

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E +++
Sbjct: 356 AAGALHAEFVVR 367


>gi|15606794|ref|NP_214174.1| flagellar basal body P-ring protein [Aquifex aeolicus VF5]
 gi|6225346|sp|O67608|FLGI_AQUAE RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|2984028|gb|AAC07571.1| flagellar P-ring protein FlgI [Aquifex aeolicus VF5]
          Length = 360

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 148/366 (40%), Positives = 225/366 (61%), Gaps = 7/366 (1%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
                + + +  L  +S    +RIKD+ +++  R N LIGYGLVVGL+GTGD  +++ FT
Sbjct: 1   MACKNIRYIVSLLILVSLTFGARIKDIATIEGNRYNYLIGYGLVVGLKGTGDG-KATQFT 59

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
            QS+ ++L+ +GI     R+  KNVAAVMVTA +PP+A  G R DV ++S+GDA SL GG
Sbjct: 60  VQSLANMLRRMGIPVDPRRITVKNVAAVMVTAKVPPYAKAGMRFDVEVSSIGDAKSLEGG 119

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L G DG +YA+AQG V+V G   +G+ ++ ++ + T G+I NGAI+E++LP   
Sbjct: 120 TLLMTPLRGPDGKVYAIAQGQVIVGGYEARGRGAAQVKNVPTVGRIPNGAILEKDLPFS- 178

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLM 242
            D  ++ + L  PDF+TA  + D IN      F + IA+A DS T++V  P        +
Sbjct: 179 ADFKEVNIYLDEPDFTTAKNVQDVINRA----FGKNIAKAVDSATIRVKIPEGYSPVDFL 234

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           ++VE L V T + A+V+I+ R+G +++G NV I  V V+ G+L V+I E  +VVQP    
Sbjct: 235 AKVENLEVSTSSVAKVVIDGRSGIVLLGGNVSIEPVAVAVGSLVVEIKERPEVVQPPPL- 293

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           S G T     T++KV + K     I    ++ L+  +NSIG     II +LQ IK+AGAL
Sbjct: 294 SPGETKVVPRTEVKVKEEKKRLVQIKGTTVSELVDALNSIGATPREIIQVLQAIKSAGAL 353

Query: 363 QSEIII 368
           ++++ +
Sbjct: 354 KAKLEV 359


>gi|298529923|ref|ZP_07017325.1| flagellar P-ring protein [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509297|gb|EFI33201.1| flagellar P-ring protein [Desulfonatronospira thiodismutans ASO3-1]
          Length = 370

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 150/351 (42%), Positives = 227/351 (64%), Gaps = 8/351 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           +    R+KDV +    R+NQL+GYGLVVGL G+GDS ++SPFT +SM ++L+ +G+S   
Sbjct: 25  SAQAVRLKDVATFSGVRENQLVGYGLVVGLDGSGDS-QASPFTLRSMSNMLEGMGVSVNP 83

Query: 80  GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
             L   NVAAVMVTAN+P  A PGS++DV+++S+GDA SL GG+L+ T L G DGN YA+
Sbjct: 84  ADLQPDNVAAVMVTANMPSSARPGSKMDVTVSSMGDADSLMGGVLIQTPLSGIDGNTYAL 143

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQG + V G  V+G ++    G+ TG +I  GA VERE+P +F    D+++ L   DFST
Sbjct: 144 AQGQLTVGGYSVEGDAAEITTGVPTGARIPGGATVEREVPYRFNTQDDIVVNLNMQDFST 203

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTPAR 257
             ++ + IN      F + +A A D+ T++V  P      L   M+ +E L V  D+PAR
Sbjct: 204 TSQVTESINE----HFGQNLAHAKDNSTIRVDIPDGFQGNLVPFMAALENLQVSPDSPAR 259

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           V+++E+TGT+VIG+NVR+SKV VS+G+LTV + E   V  P  F ++   V    T++ +
Sbjct: 260 VVVDEKTGTVVIGENVRLSKVAVSHGSLTVMVREMPDVFMPLPF-TDAPPVIAPETEIDI 318

Query: 318 SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + +   ++I+   +N L+ G+N+IG     +ISIL+ +KA+GAL +E+ +
Sbjct: 319 VEEEQHLTIIEGATINELVEGLNAIGATPRDLISILRTLKASGALHAELEV 369


>gi|146341915|ref|YP_001206963.1| flagellar basal body P-ring protein [Bradyrhizobium sp. ORS278]
 gi|146194721|emb|CAL78746.1| Flagellar P-ring protein (basal body P-ring protein)
           [Bradyrhizobium sp. ORS278]
          Length = 385

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 161/356 (45%), Positives = 240/356 (67%), Gaps = 8/356 (2%)

Query: 16  HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI 75
             + A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G+
Sbjct: 34  TAMPAHATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGV 93

Query: 76  STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
           +  G  + + NVAAVMVT NLPPFA+ G+R+DV++++LGDA +L+GG L++T LLGADGN
Sbjct: 94  NIRGATIRTGNVAAVMVTGNLPPFATQGTRMDVTVSALGDAKNLQGGTLLVTPLLGADGN 153

Query: 136 IYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           +YAVAQGS+ +SG   +G+++  + G+ T G+I NGAI+ERE+        ++ L LRN 
Sbjct: 154 VYAVAQGSLAISGFQAEGEAAKIVRGVPTVGRIANGAIIEREIEFALNRLPNVRLALRNA 213

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETD 253
           DF+TA RIA  IN +         AE  D  TV++S P     ++   ++E+E L V+ D
Sbjct: 214 DFTTAKRIAAAINDF----LGVKTAEPIDPSTVQLSVPPEFKGNVVAFLTEIEQLQVDPD 269

Query: 254 TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
             A+++I+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   S G TV    T
Sbjct: 270 LAAKIVIDERSGIIVMGRDVRVATVAVAQGNLTVTISESPQVSQPNPL-SQGRTVVTPRT 328

Query: 314 DLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + V ++   F  + D   L  L+ G+N +G+    +ISILQ IKAAGA++++I +
Sbjct: 329 SVGVQEDGKKFAVVKDGVSLQQLVDGLNGLGIGPRDLISILQAIKAAGAIEADIEV 384


>gi|148256802|ref|YP_001241387.1| flagellar basal body P-ring protein [Bradyrhizobium sp. BTAi1]
 gi|166214831|sp|A5EMT7|FLGI_BRASB RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|146408975|gb|ABQ37481.1| Flagellar P-ring protein (basal body P-ring protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 374

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 164/370 (44%), Positives = 248/370 (67%), Gaps = 8/370 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F++A      +    +SA   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PF
Sbjct: 9   LFQVACAAIVALASSAMSAHATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPF 68

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T+QS++++L+ +G++  G  + + NVAAVMVT NLPPFA+ G+R+DV++++LGDA +L+G
Sbjct: 69  TKQSLQAMLERMGVNIRGATIRTGNVAAVMVTGNLPPFATQGTRMDVTVSALGDAKNLQG 128

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L++T LLGADGN+YAVAQGS+ +SG   +G+++  + G+ T G+I NGAI+ERE+   
Sbjct: 129 GTLLVTPLLGADGNVYAVAQGSLAISGFQAEGEAAKIVRGVPTVGRIANGAIIEREIEFA 188

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLT 239
                ++ L LRN DF+TA RIA  IN +         AE  D  TV++S P     ++ 
Sbjct: 189 LNRLPNVRLALRNADFTTAKRIAAAINDF----LGVKTAEPIDPSTVQLSIPPEFKGNVV 244

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             ++E+E L V+ D  A+++I+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN
Sbjct: 245 AFLTEIEQLQVDPDLAAKIVIDERSGIIVMGRDVRVATVAVAQGNLTVTISESPQVSQPN 304

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
              S G TV    T + V+++   F  + D   L  L+ G+N +G+    +ISILQ IKA
Sbjct: 305 PL-SQGRTVVTPRTSVGVTEDGKKFAVVKDGVSLQQLVDGLNGLGIGPRDLISILQAIKA 363

Query: 359 AGALQSEIII 368
           AGA++++I +
Sbjct: 364 AGAIEADIEV 373


>gi|145298495|ref|YP_001141336.1| flagellar basal body P-ring protein [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851267|gb|ABO89588.1| flagellar P-ring protein FlgI [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 375

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 148/363 (40%), Positives = 219/363 (60%), Gaps = 12/363 (3%)

Query: 11  SLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLL 70
            +  L  +     SRIKD+ S++  R+NQLIGYGLVVGL GTG+  +++ FTEQ+ R++L
Sbjct: 19  LICCLMPLGMAHASRIKDISSVEGVRNNQLIGYGLVVGLPGTGE--KNNAFTEQTFRTML 76

Query: 71  QNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSL 129
            N GI  P   +   K+VA V + A+LPPF+ PG  IDV+++++G+A SLRGG L+ + L
Sbjct: 77  NNFGIKVPDNIKPKIKDVAPVAIHADLPPFSKPGQTIDVTVSAIGEAKSLRGGTLLQSFL 136

Query: 130 LGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADL 188
            G DG +YAVAQGS+VV GL  +G   S  +    T G+I NGA VERE+P  F     +
Sbjct: 137 KGLDGRVYAVAQGSLVVGGLGAEGADGSKVVINTPTVGRIANGATVEREVPNSFGQGDTI 196

Query: 189 ILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEM 247
              L  PDF+TA  +AD +N           A+A D+ +VKV  P +       ++ +E 
Sbjct: 197 TFNLNRPDFTTARGLADVVNDLV----GPNTAQALDATSVKVYAPRDPGQRVSYLATIEN 252

Query: 248 LTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
           L V+  +  A++I+N RTGTIVIG NVR+    +S+G LTV I EN+QV QPN   + G 
Sbjct: 253 LEVDPASESAKIIVNSRTGTIVIGSNVRLKPAAISHGGLTVTIAENQQVSQPNPL-AGGE 311

Query: 307 TVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSE 365
           T   NN+ + V    G  F L     L+ L+  +N +G+    +++IL+ ++ AGA++ +
Sbjct: 312 TAVTNNSTINVQQEPGRMFKLDTGATLDDLVRAVNQVGVAPGDLMAILEALQQAGAIEGQ 371

Query: 366 III 368
           ++I
Sbjct: 372 LVI 374


>gi|217976227|ref|YP_002360374.1| flagellar basal body P-ring protein [Methylocella silvestris BL2]
 gi|217501603|gb|ACK49012.1| flagellar P-ring protein [Methylocella silvestris BL2]
          Length = 367

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 180/368 (48%), Positives = 254/368 (69%), Gaps = 1/368 (0%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +   A LI     +   +A    RIKD+ SLQ  RDNQL+GYGLVVGLQG+GD+LR+S F
Sbjct: 1   MMLRAGLIVVFSAIFCCAATASVRIKDITSLQDVRDNQLVGYGLVVGLQGSGDTLRNSTF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TEQ+M+S+L  +GI+     L ++NVAAV+VTA+LPPF  PG+R+DV+++SLGDA+SL G
Sbjct: 61  TEQTMQSMLDRMGINVRSFALRTRNVAAVLVTADLPPFIQPGTRMDVTVSSLGDATSLYG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L++TSL G DG  YA+AQG V V+G  V+GQ+ +  + ++T G+I NGA+VERE P  
Sbjct: 121 GTLILTSLTGVDGQTYAIAQGQVAVAGFAVQGQAETITQNVATAGRIANGALVEREAPGH 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL 241
            +D   L L L+NPDF+TA++IA+ IN +S+ RF   +A+  D  +V + +P  I   R 
Sbjct: 181 LRDIGPLALVLKNPDFNTAVQIAEVINKFSMRRFRLRVAQDRDLNSVALVRPPGISTARF 240

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           M+E+  L V+ D PARV+I+ R+GTIVIG +V+IS V V++GNL V+I E  +V QP  F
Sbjct: 241 MAEIGDLMVDPDAPARVVIDARSGTIVIGQDVQISTVAVTHGNLNVRIVETPEVSQPAPF 300

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
            SNG TV    T++  +   G   ++    L  L++G+N IGLK  G+I+ILQ IK+AGA
Sbjct: 301 -SNGRTVVVPRTEIDTNQQGGHIGIVKGASLRELVAGLNRIGLKPMGVIAILQAIKSAGA 359

Query: 362 LQSEIIIQ 369
           L ++I+IQ
Sbjct: 360 LHADIVIQ 367


>gi|118581852|ref|YP_903102.1| flagellar basal body P-ring protein [Pelobacter propionicus DSM
           2379]
 gi|118504562|gb|ABL01045.1| flagellar P-ring protein [Pelobacter propionicus DSM 2379]
          Length = 364

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 155/366 (42%), Positives = 222/366 (60%), Gaps = 8/366 (2%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           +F+    + L   +A    RIKD+ S +  R+NQL+GYGLVVGL GTGDS   +    QS
Sbjct: 3   SFIAACCMLLLLTTAAHAVRIKDLASFEGVRENQLVGYGLVVGLNGTGDSD-QARLQLQS 61

Query: 66  MRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           + ++L+ +G +    ++  KNVAAVMVTA LPPFA  G+++DV+++SLGD+ S+ GG L+
Sbjct: 62  VATMLERMGSTISASQIKLKNVAAVMVTATLPPFAKQGNQMDVTVSSLGDSKSIAGGTLI 121

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MT L GAD  +YAVAQGSV+ +     GQ+++  +   T G+I +GA+VERELP      
Sbjct: 122 MTPLKGADNQVYAVAQGSVLTNSFAFGGQAATAQKNHPTAGRIPSGALVERELPNTLAGK 181

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMS 243
           + L L L   DF+TA R+A  +N     +F   +A   D   V +  P N    +   ++
Sbjct: 182 SQLRLNLAQADFTTASRVASAVN----GKFGAGVATTGDPGAVIIQIPGNYTSRVIDFVA 237

Query: 244 EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
            VE L V  DT A+V++NERTGTIV+G+ VRIS V VS+GNL++ I E  QV QP   SS
Sbjct: 238 AVETLDVLPDTVAKVVLNERTGTIVMGERVRISTVAVSHGNLSLVIKETLQVSQPAPLSS 297

Query: 304 NGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G T     T +KV +       L     +  ++  +N++G+    +I ILQ IKAAGAL
Sbjct: 298 RGETQVVPRTQVKVEEEARRLMLLQQGATIGDVVRALNTLGVTPRDLIGILQAIKAAGAL 357

Query: 363 QSEIII 368
           Q+E++I
Sbjct: 358 QAELVI 363


>gi|261211318|ref|ZP_05925606.1| flagellar P-ring protein FlgI [Vibrio sp. RC341]
 gi|260839273|gb|EEX65899.1| flagellar P-ring protein FlgI [Vibrio sp. RC341]
          Length = 361

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 148/365 (40%), Positives = 217/365 (59%), Gaps = 13/365 (3%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
              L+ +   S+   +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+QS  +
Sbjct: 4   FTILLMMLLASSAQAARIKDVAQVAGVRSNQLVGYGLVTGLPGTGES---TPFTDQSFNA 60

Query: 69  LLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +LQ+ GI  P G +  +KNVAAV+VTA+LP F+  G  ID++++S+G A SLRGG L+ T
Sbjct: 61  MLQSFGIQLPPGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQT 120

Query: 128 SLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
            L G DG +YAVAQG++VVSG        S  +    T G I +GAIVERE+P  F    
Sbjct: 121 FLKGLDGQVYAVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGD 180

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEV 245
            +   L   DF+TA R+AD +N +        +A   D+ ++KV  P +       +S +
Sbjct: 181 YITFNLFESDFTTAQRLADAVNQF----LGPQMASPVDAASIKVRAPRDLSQRVAFLSAI 236

Query: 246 EMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           E L     ++ A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA    
Sbjct: 237 ENLEFNTAESSAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNAL-GG 295

Query: 305 GSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G TV   N+ ++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++
Sbjct: 296 GQTVVTPNSSIEVTEKQGKMFKLEPGVTLDDLVRAINEVGAAPSDLMAILQALKQAGAIE 355

Query: 364 SEIII 368
            ++II
Sbjct: 356 GQLII 360


>gi|88813658|ref|ZP_01128887.1| flagellar P-ring protein precursor [Nitrococcus mobilis Nb-231]
 gi|88789076|gb|EAR20214.1| flagellar P-ring protein precursor [Nitrococcus mobilis Nb-231]
          Length = 371

 Score =  386 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 153/352 (43%), Positives = 221/352 (62%), Gaps = 11/352 (3%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
            RIKD+ ++   R NQL+GYGLV GL GTGD    +PFT QS+R++L + GI  P  +L 
Sbjct: 23  ERIKDLATVAGVRPNQLVGYGLVAGLDGTGDRTTQTPFTVQSIRAMLASQGIQLPVAQLR 82

Query: 84  S---KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
           S   KNVAAVMVTA LP FA PG +IDV+++SLG+A SLRGG L+MT L G DG++YA+A
Sbjct: 83  SMQLKNVAAVMVTAELPAFAKPGQQIDVTVSSLGNAKSLRGGNLLMTPLKGVDGSVYAMA 142

Query: 141 QGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           QG+++VSG    G   S  +  + + G+I +GA VER +   F     ++L L  PDF+T
Sbjct: 143 QGNLLVSGFGASGRDGSKIVVNVLSTGRIPDGATVERSVASPFALGESVVLNLHTPDFTT 202

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVET-DTPAR 257
           A R+A QIN           A A D+ +VKV  P +       ++ +E L V   + PAR
Sbjct: 203 AKRVAKQIND----TLGAASATALDAVSVKVRAPRDANQRVSFVAFLENLEVAPGEAPAR 258

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           VI+N RTGTIVIG +VR+    +++G+LTV I+E  QV QP  F+  G TV    +D+++
Sbjct: 259 VIVNARTGTIVIGSHVRVQPAAITHGSLTVTISERTQVSQPAPFARRGQTVVNPQSDVQI 318

Query: 318 SDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++ K   F      +L++++  +N +G     +++ILQ +K AGAL++E+II
Sbjct: 319 TEEKRPMFLFAPGTELSAIVEAVNRVGASPSDLVAILQALKQAGALRAELII 370


>gi|209695758|ref|YP_002263688.1| flagellar basal body P-ring protein [Aliivibrio salmonicida
           LFI1238]
 gi|226701940|sp|B6EJG1|FLGI_ALISL RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|208009711|emb|CAQ80015.1| flagellar P-ring protein 2 precursor (basal body P-ring protein 2)
           [Aliivibrio salmonicida LFI1238]
          Length = 373

 Score =  386 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 149/372 (40%), Positives = 220/372 (59%), Gaps = 13/372 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + +    +        IS    +RIKDV  +   R NQLIGYGLV GL GTG+S   +PF
Sbjct: 9   VKKNLVTLILTWLCLSISTAQAARIKDVSEVAGVRSNQLIGYGLVSGLPGTGES---TPF 65

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T+QS  ++LQN GI  P G +  +KNVAAVMVT  LP FA  G  +D++++S+G A SLR
Sbjct: 66  TDQSFNAMLQNFGIQLPPGTKPKTKNVAAVMVTTTLPAFAKQGQVVDITVSSVGSAKSLR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+ T L G DG  YA+AQG+++VSG        S  +    T G+I  GA+VERE+P
Sbjct: 126 GGTLLQTFLKGLDGKTYAIAQGNLIVSGFSATGADGSKIVGNNPTVGRISGGAMVEREVP 185

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     +   L + DF+TA R+AD +N++        +A A D+ +V+V  P +I   
Sbjct: 186 SPFGRGDFITFNLLDSDFTTAQRMADAVNNF----LGPNMASAVDATSVRVRAPRDISQR 241

Query: 239 TRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S VE +  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN+QV Q
Sbjct: 242 VAFLSAVENVNFDPADGSAKIIVNSRTGTIVVGKHVRLRAAAVTHGGMTVAIKENQQVSQ 301

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P  F  NG TV   ++D++V++ +G  F       L+ L+  +N +G     +++ILQ +
Sbjct: 302 PGPF-GNGKTVVTQDSDIEVTEKQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQAL 360

Query: 357 KAAGALQSEIII 368
           K AGA++ ++II
Sbjct: 361 KQAGAIEGQLII 372


>gi|83595979|gb|ABC25339.1| flagellar P-ring protein [uncultured marine bacterium Ant24C4]
          Length = 369

 Score =  386 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 154/371 (41%), Positives = 234/371 (63%), Gaps = 9/371 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +  F+I     +   ++    R+KD+V     R N L+GYGLVVGL GTGD LR++PFT
Sbjct: 4   LKCVFIILLCWAIPVTASSTPIRLKDLVEFDGVRPNNLLGYGLVVGLNGTGDGLRNAPFT 63

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           E+ M ++L+ LG++  G +   KNVAAV+VTA+LPPFA  GS +DV+++++GDA+SL GG
Sbjct: 64  EEIMTNILERLGVNVTGEQFRPKNVAAVLVTASLPPFARAGSPMDVTVSAIGDATSLLGG 123

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L  ADG IYAVAQGS++  G+  +GQ +   +G+ T G + +GAI+ERE+   F
Sbjct: 124 TLIMTPLNAADGEIYAVAQGSIIAGGVTAEGQGARVTQGVPTAGVVPSGAIIEREVDFDF 183

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNIDLTR 240
                L L LR PDF+TA RI   IN+     F   +A   D+ TV++            
Sbjct: 184 TGLTSLRLALRTPDFTTAARIEQAINA----TFGNQVALMLDAGTVQIDIVGTQARSPAH 239

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
            + ++E + VE +  ARV+I++R+GTIV+GD+VRIS+V VS G LT++I E   V QPN 
Sbjct: 240 ALGQIENILVEPERRARVVIDQRSGTIVMGDDVRISRVAVSQGGLTLRIEEAPLVSQPNP 299

Query: 301 FSSNGSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           F S G T+    T++ + + +  G   + +   L+ +++G+N++G+    +I IL+ IKA
Sbjct: 300 F-SPGETLIVPRTNVGIEEEQGIGLAEIREGTSLSEVVAGLNALGVAPRDMIDILKSIKA 358

Query: 359 AGALQSEIIIQ 369
           +GAL +E I++
Sbjct: 359 SGALHAEFIVR 369


>gi|157376212|ref|YP_001474812.1| flagellar basal body P-ring protein [Shewanella sediminis HAW-EB3]
 gi|157318586|gb|ABV37684.1| flagellar P-ring protein [Shewanella sediminis HAW-EB3]
          Length = 363

 Score =  386 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/372 (40%), Positives = 219/372 (58%), Gaps = 14/372 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M  ++  +   L+      AQ   RIKD+ ++Q  R NQLIGYGLVVGL GTG+  R   
Sbjct: 1   MKIKLFSIFLLLLVCGTSQAQ---RIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTR--- 54

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +TEQ+ +++L+N GI+ P   R   KNVA V V+A +P F  PG  +DV+++SLG+A SL
Sbjct: 55  YTEQTFKTMLKNFGINLPDNFRPKIKNVAVVAVSAVMPAFIKPGQTLDVTVSSLGEAKSL 114

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG+L+ T + G DGN+YA+AQGS+VVSG   +G   S  ++   T G+I NGA+VER +
Sbjct: 115 RGGMLLQTFMKGVDGNVYAIAQGSMVVSGFSAEGLDGSKVIQNTPTVGRIPNGAMVERTV 174

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   LR  DFSTA R+AD IN          +A   D+ +V+VS P ++  
Sbjct: 175 TTPFSTGDHLTFNLRRADFSTAKRLADAINEL----LGPGMARPLDAASVQVSAPRDVSQ 230

Query: 238 LTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E + VE  +  A+VI+N RTGTIV+G +VR+    V++G LTV I E  QV 
Sbjct: 231 RVSFLATLENIQVEPASESAKVIVNSRTGTIVVGKDVRLLPAAVTHGGLTVTIAEATQVS 290

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPN  +   + VT N+T     ++   F       L+ L+  +N +G     +++IL+ +
Sbjct: 291 QPNPLAGGQTVVTSNSTIDASEEDSRMFMFNPGTSLDELVRAVNLVGAAPSDVLAILEAL 350

Query: 357 KAAGALQSEIII 368
           K AGAL  E+II
Sbjct: 351 KVAGALHGELII 362


>gi|332704820|ref|ZP_08424908.1| Flagellar P-ring protein [Desulfovibrio africanus str. Walvis Bay]
 gi|332554969|gb|EGJ52013.1| Flagellar P-ring protein [Desulfovibrio africanus str. Walvis Bay]
          Length = 369

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 148/354 (41%), Positives = 222/354 (62%), Gaps = 8/354 (2%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
             ++   +RIKD+ + +  R NQL+GYGLVVGL GTGD  R S FT QSM ++L+ +G+ 
Sbjct: 21  FATSAQATRIKDIATFKGVRSNQLVGYGLVVGLAGTGD-NRGSAFTIQSMVNMLERMGVR 79

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
                L  KNVAAVMVTANLP  + PG+R+D +I+SLGDA SL GG+L++T + G DGN+
Sbjct: 80  VEQENLKPKNVAAVMVTANLPSSSRPGARLDATISSLGDAKSLLGGVLMLTPMRGVDGNV 139

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YA+AQG + V G    G+++S    I T G I +GA VER++P +F +   + + L   D
Sbjct: 140 YALAQGPLTVGGYSAGGEAASATSNIPTVGIIPHGATVERQVPFEFNNQDIMTINLNIAD 199

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT--NIDLTRLMSEVEMLTVETDT 254
           FST  ++ D IN         P A A D  T+ ++ P     +L  LM+ +E L V  D 
Sbjct: 200 FSTTQQVVDSIN----RTLGGPYARAADISTIDMTVPERFQGNLVPLMASLENLQVTPDA 255

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A+V+++E+TGT+++G NVR+S+V +S+G+L + I+E+  V QP  F S G TV    T+
Sbjct: 256 RAKVVVDEKTGTVIVGQNVRLSRVAISHGSLQIIISESANVSQPQPF-SQGQTVVVPETE 314

Query: 315 LKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++V +      L++   L  L+ G+NSIG     +ISIL+ +++AGAL +E+ +
Sbjct: 315 IQVREENNRLVLMEGATLQELVDGLNSIGATPRDLISILRALRSAGALMAELEV 368


>gi|209884520|ref|YP_002288377.1| flagellar P-ring protein FlgI [Oligotropha carboxidovorans OM5]
 gi|209872716|gb|ACI92512.1| flagellar P-ring protein FlgI [Oligotropha carboxidovorans OM5]
          Length = 369

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 164/370 (44%), Positives = 241/370 (65%), Gaps = 8/370 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F+        I +    A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PF
Sbjct: 4   LFQALCGAAVAIWIAGAPAHATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPF 63

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T+QS++++L+ +G++  G  + + NVAAVMVT NLP FA+ G+R+DV+++++GDA SL+G
Sbjct: 64  TKQSLQAMLERMGVNIRGATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSAMGDAKSLQG 123

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L++T LLGADGN+YAVAQGS+ + G   +G ++    G+ T G+I NGA+VERE+   
Sbjct: 124 GTLLVTPLLGADGNVYAVAQGSLAIGGFQAEGDAAKITRGVPTNGRIANGALVEREIEFA 183

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLT 239
                ++ L LRN DF+TA RIA  +N Y        +AE  D  TV++S P     +  
Sbjct: 184 LNRLPNVRLALRNSDFTTAKRIAAAVNDY----LGTKVAEPVDPSTVQLSIPPEFKGNAV 239

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            L++E+E L VE D  A+++I+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QP 
Sbjct: 240 ALLTEIEQLQVEPDAGAKIVIDERSGIIVMGRDVRVNTVAVAQGNLTVTISESPQVSQPA 299

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSL-IDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
            F  NG TV   NT + V ++    +L  D   L  L+ G+N +G+    +I ILQ IKA
Sbjct: 300 PF-GNGQTVVTPNTRVGVQEDGKKLALVKDGVSLQQLVDGLNGLGIGPRDMIGILQAIKA 358

Query: 359 AGALQSEIII 368
           AGA+Q++I +
Sbjct: 359 AGAIQADIEV 368


>gi|163738042|ref|ZP_02145458.1| flagellar P-ring protein [Phaeobacter gallaeciensis BS107]
 gi|161388658|gb|EDQ13011.1| flagellar P-ring protein [Phaeobacter gallaeciensis BS107]
          Length = 367

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 153/372 (41%), Positives = 230/372 (61%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R   ++ +++ L  ++     R+KD+V     R N L+GYGLVVGL GTGD LR+SPF
Sbjct: 1   MMRFIRILLAVMLLPAMAQANAIRLKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNSPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE+ M ++L+ LG++  G +   KNVAAV VTA LPPFA  G  +DV+++++GD+ SL G
Sbjct: 61  TEEIMSNILERLGVNVTGEQFRPKNVAAVFVTATLPPFARVGGTVDVTVSAIGDSKSLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G LVMT L  ADG IYAVAQG+++  G   +G+ +S  +G+ T G I +GA VERE+   
Sbjct: 121 GTLVMTPLNAADGQIYAVAQGTILAGGAVAEGEGASVTQGVPTAGVIPSGARVEREIDFD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNIDLT 239
                 + L LR PDF+TA RI   IN+     F R +A   DS TV+V           
Sbjct: 181 LSSLTSMRLALREPDFTTAGRIERAINA----EFGRNVALMQDSGTVEVDVQRTNTRSTA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             +  +E + VE    ARV++++R+GTIV+G +VRIS+V V+ GNLT++I E   VVQPN
Sbjct: 237 HAVGRIENILVEPQRKARVVVDQRSGTIVMGSDVRISRVAVAQGNLTLRIEETPLVVQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKG--SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F ++G TV    T   + + +G     + +   L+ +++G+N++G+    +I IL+ +K
Sbjct: 297 PF-ADGETVIVPRTGAAIEEEEGIQLAEVPETTSLSEVVAGLNALGVSPRDMIDILKSLK 355

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E +++
Sbjct: 356 AAGALHAEFVVR 367


>gi|262404536|ref|ZP_06081091.1| flagellar P-ring protein FlgI [Vibrio sp. RC586]
 gi|262349568|gb|EEY98706.1| flagellar P-ring protein FlgI [Vibrio sp. RC586]
          Length = 361

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 150/365 (41%), Positives = 219/365 (60%), Gaps = 13/365 (3%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
              L+ +   S+   +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+QS  +
Sbjct: 4   FTILLMMLLASSAQAARIKDVAQVAGVRSNQLVGYGLVTGLPGTGES---TPFTDQSFNA 60

Query: 69  LLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +LQN GI  P G +  +KNVAAV+VTA+LP F+  G  ID++++S+G A SLRGG L+ T
Sbjct: 61  MLQNFGIQLPPGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQT 120

Query: 128 SLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
            L G DG +YAVAQG++VVSG        S  +    T G I +GAIVERE+P  F    
Sbjct: 121 FLKGLDGEVYAVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGD 180

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEV 245
            +   L   DF+TA R+AD +N +        +A A D+ ++KV  P +       +S +
Sbjct: 181 YITFNLFESDFTTAQRLADAVNQF----LGPQMASAVDAASIKVRAPRDLSQRVAFLSAI 236

Query: 246 EMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           E L     ++ A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA  + 
Sbjct: 237 ENLEFNTAESAAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNAL-AG 295

Query: 305 GSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G TV   N+ ++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++
Sbjct: 296 GQTVVTPNSSIEVTEKQGKMFKLEPGVTLDELVRAVNEVGAAPSDLMAILQALKQAGAIE 355

Query: 364 SEIII 368
            ++II
Sbjct: 356 GQLII 360


>gi|254508445|ref|ZP_05120565.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus 16]
 gi|219548655|gb|EED25660.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus 16]
          Length = 363

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 148/353 (41%), Positives = 212/353 (60%), Gaps = 13/353 (3%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
              +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+QS  ++LQ+ GI  P G
Sbjct: 18  AYAARIKDVAQVAGVRSNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQSFGIQLPPG 74

Query: 81  -RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
            +  +KNVAAV+VTA LP F+  G  IDV+++S+G A SLRGG L+ T + G DG +YAV
Sbjct: 75  TKPKTKNVAAVIVTAELPAFSKQGQTIDVTVSSIGSAKSLRGGTLMQTMMKGLDGQVYAV 134

Query: 140 AQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           AQG++VVSG        S  +    T G I NGA+VERE+P  F     +   L   DF+
Sbjct: 135 AQGNLVVSGFSATGADGSKIVGNNPTAGMISNGAMVEREIPTPFGRGDYITFNLLESDFT 194

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDT-PA 256
           TA R+AD +N++        +A   D+ +VKV  P +I      +S +E L        A
Sbjct: 195 TAQRMADAVNNF----LGPQMASPVDATSVKVRAPRDISQRVAFLSAIENLEFNPAEGSA 250

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           ++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPNAF   G TV   +TD++
Sbjct: 251 KIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPNAF-GGGETVVVPDTDIQ 309

Query: 317 VSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           V++ +G  F       L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 310 VTEEQGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLII 362


>gi|330719499|gb|EGG98115.1| Flagellar P-ring protein FlgI [gamma proteobacterium IMCC2047]
          Length = 370

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 147/377 (38%), Positives = 220/377 (58%), Gaps = 17/377 (4%)

Query: 1   MIFRIAFL----IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSL 56
           MI  +  +     + L  L      +  R+KD+ S+   R NQL+GYGLVVGL GTGD  
Sbjct: 1   MIKLLKLMHKKAFWVLAVLVVCQPVMADRLKDLASVAGVRTNQLLGYGLVVGLDGTGDKT 60

Query: 57  RSSPFTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGD 115
               FT+QS ++LL   GI+ P G     KNVAAV V A+L  FA PG +IDV+++SLGD
Sbjct: 61  T---FTQQSFKNLLTQFGIALPAGVTPNPKNVAAVAVHADLQSFAKPGQQIDVTVSSLGD 117

Query: 116 ASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIV 174
           + SLRGG L++T L G D  IYA+AQG++VV G   +G   S     + + G++ NGA V
Sbjct: 118 SKSLRGGTLLITPLKGLDDQIYAIAQGNLVVGGFGAQGADGSRITVNVPSVGRVPNGATV 177

Query: 175 ERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT 234
           ER +P  F     L   L  PDF+TA R+AD+IN+          A A DS +++V+ P 
Sbjct: 178 ERSVPNSFALGDTLTFNLNAPDFTTAKRVADKINNL----LGANTAFAMDSTSIQVTAPR 233

Query: 235 NI-DLTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
           N       +S +E L ++  +  A+VIIN RTGTIVIG +VR++   +++GNL V I+E+
Sbjct: 234 NASQRVTYLSVLENLEIDPAEATAKVIINSRTGTIVIGKHVRVAPAAITHGNLAVTISES 293

Query: 293 EQVVQPNAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIIS 351
            QV QP  F S G TV   ++ + + + +  +F       L+ ++  +N +G     +++
Sbjct: 294 PQVSQPAPF-SEGDTVITPSSQIGIDEGDSRAFVFNPGVSLDEIVQAVNQVGAAPGDLMA 352

Query: 352 ILQGIKAAGALQSEIII 368
           IL+ +K AGAL++ +++
Sbjct: 353 ILEALKQAGALRASLVV 369


>gi|269103186|ref|ZP_06155883.1| flagellar P-ring protein FlgI [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163084|gb|EEZ41580.1| flagellar P-ring protein FlgI [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 377

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/373 (40%), Positives = 224/373 (60%), Gaps = 16/373 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++ R+     SL+          +RIKDV  +   R NQLIGYGLVVGL G+G+   ++P
Sbjct: 15  VLMRLFVFTLSLLLALPT---FAARIKDVSEVAGVRSNQLIGYGLVVGLAGSGE---TTP 68

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+QS  ++L+N GI  P G +  +KNVAAV+V A LP FA  G  +D++++S+G A SL
Sbjct: 69  FTDQSFNTMLKNFGIQLPPGTKPKTKNVAAVVVNATLPAFAKQGQHVDITVSSIGSAKSL 128

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
            GG L+ T L G DG IYAVAQG++VV G  ++G   S  +    T G+I NGA VE+E+
Sbjct: 129 HGGTLLQTFLKGLDGKIYAVAQGTLVVGGFSIEGADGSKIVSNTPTVGRISNGATVEQEI 188

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   L + DF+TA R+AD +N +        +A A D+ +++V  P ++  
Sbjct: 189 ASPFGRGDYLTFNLFDSDFTTAQRMADAVNQF----LGPDMASAIDATSIRVRAPRDVSQ 244

Query: 238 LTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L  ET D+ A++I+N RTGTIV+G +VR+    +++G +TV I EN QV 
Sbjct: 245 RVAFLSTIENLEFETADSAAKIIVNSRTGTIVVGQHVRLKPAAITHGGMTVTIKENAQVS 304

Query: 297 QPNAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPNAF S G TV   N+D+ V++ N   F       L+ L+  +N +G     +++ILQ 
Sbjct: 305 QPNAF-SQGQTVVTPNSDINVTEKNARMFVFQPGVTLDDLVRAVNQVGAGPSDVMAILQA 363

Query: 356 IKAAGALQSEIII 368
           +K AGA++ ++II
Sbjct: 364 LKQAGAIEGQLII 376


>gi|99082782|ref|YP_614936.1| flagellar basal body P-ring protein [Ruegeria sp. TM1040]
 gi|99039062|gb|ABF65674.1| Flagellar P-ring protein precursor [Ruegeria sp. TM1040]
          Length = 367

 Score =  385 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/372 (40%), Positives = 227/372 (61%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + +   ++ + + L  ++     R+KD+V     R N L+GYGLVVGL GTGD LR+SPF
Sbjct: 1   MRKFLHILITCLVLPTLAQANAIRLKDLVEFDGVRGNDLVGYGLVVGLDGTGDGLRNSPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE+ M ++L+ LG++  G +   KNVAAV VTA LPPFA  G  ID +++++GD+SSL G
Sbjct: 61  TEEIMTNILERLGVNVSGEQFRPKNVAAVFVTATLPPFARVGGTIDATVSAIGDSSSLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L  ADG IYAVAQG+++  G   +G +++  +G+ T G I +GA VERE+   
Sbjct: 121 GTLIMTPLNAADGQIYAVAQGTILAGGAVAEGDAATVTQGVPTSGVIPSGARVEREIEFD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNIDLT 239
                 + L LR PDF+TA RI   IN    N F R +A   DS TV+V+          
Sbjct: 181 LSSLNSMRLALREPDFTTAGRIERAIN----NEFGRNVAVMRDSGTVEVNIQRTNARSTA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             +  +E + VE    ARV++++R+GTIV+G +VRIS V V+ GNLT+++ E   V QPN
Sbjct: 237 HAVGRMENVLVEPQRKARVVVDQRSGTIVMGSDVRISNVAVAQGNLTLRVEEAPLVSQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKG--SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F ++G TV    T   + +  G     + +   L+ ++SG+N++G+    +I IL+ +K
Sbjct: 297 PF-ADGETVVVPRTGAAIEEEDGIQLAEVPETTSLSEVVSGLNALGVSPRDMIDILKSLK 355

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E +++
Sbjct: 356 AAGALHAEFVVR 367


>gi|90422612|ref|YP_530982.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           BisB18]
 gi|90104626|gb|ABD86663.1| flagellar P-ring protein [Rhodopseudomonas palustris BisB18]
          Length = 367

 Score =  385 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 189/367 (51%), Positives = 263/367 (71%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
                L   +I L   +A    RIKD+ +L+  R+NQ++GYGLV+GL+GTGD+LR+SPFT
Sbjct: 1   MIARLLWGVIIALSITAADAAVRIKDIANLKGVRENQILGYGLVIGLKGTGDTLRNSPFT 60

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           EQS++S+L N+GI+  G  L ++NVAAV+VTA+LPPF + GSRIDV+I+SLGD+SSL GG
Sbjct: 61  EQSLQSMLDNMGINIRGTSLRTRNVAAVVVTADLPPFIAGGSRIDVAISSLGDSSSLLGG 120

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            LVMT L GADG +YAVAQG++ V G  V+G + S  +G++TGG+I NGA++ERE+  +F
Sbjct: 121 TLVMTQLRGADGEVYAVAQGAIAVGGYAVEGAAQSLSQGVATGGRIPNGALIEREVRGRF 180

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLM 242
            D   L+L+L+NPDF TA R+ D IN +S  R+   +A   D RT+ +S+P ++   R +
Sbjct: 181 SDMETLLLELKNPDFVTATRVLDTINQHSRGRYQAGVASERDYRTIILSRPRSVSPVRFI 240

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +E+E L VE DTPARV+I+ER GT+VIG NV+IS V V++GNLTV+ITE   V QP+ FS
Sbjct: 241 AEIEELLVEPDTPARVVIDERNGTVVIGRNVQISTVAVTHGNLTVRITEAPIVSQPSPFS 300

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
             G TV    T +  ++     +++   DL  L+ G+N IGLK  GII+ILQ IKAAGAL
Sbjct: 301 PRGETVVVPQTFIDANEPGAKIAILRGTDLQRLVRGLNQIGLKPSGIIAILQAIKAAGAL 360

Query: 363 QSEIIIQ 369
           Q++++IQ
Sbjct: 361 QADLVIQ 367


>gi|254516993|ref|ZP_05129051.1| flagellar P-ring protein FlgI [gamma proteobacterium NOR5-3]
 gi|219674498|gb|EED30866.1| flagellar P-ring protein FlgI [gamma proteobacterium NOR5-3]
          Length = 370

 Score =  385 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 152/373 (40%), Positives = 223/373 (59%), Gaps = 9/373 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M      L   L  L   S     RIKD+  +   R NQL+GYGLVVGL G+GD +  +P
Sbjct: 1   MTLIQRILPALLTLLVMASPVQAERIKDIAGIAGVRANQLVGYGLVVGLDGSGDQVIQAP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS++S+L  LG++ P       KN+A VMVTA LPPF  PG  IDV+++SL +A SL
Sbjct: 61  FTIQSLKSMLAQLGVNVPANVNPQLKNIATVMVTAELPPFTKPGQTIDVTVSSLANAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+MT L G DG  YA+AQGS++VSG   +G   SS    + + G+I NGAIVER +
Sbjct: 121 RGGQLLMTPLKGPDGETYAIAQGSMIVSGFGAEGSDGSSVTVNVPSAGRIPNGAIVERGV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
           P  F     +++ L +PDF+TA R+A  IN+         IA   D+ +++V  P +  D
Sbjct: 181 PSPFGTEPVMVMNLNSPDFTTAQRVAMSINA----SMGEGIARPMDAVSIEVQAPRDPGD 236

Query: 238 LTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +S +E L V+     A+V++N R GTIVIGD+VR+ +  V++GNLTV I+E+  V 
Sbjct: 237 KVAFVSILENLQVDPGAAAAKVVVNSRNGTIVIGDSVRVERAAVAHGNLTVTISESINVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP AF+  G T    ++++ +++     F L     L  L+S +N +G     +I+IL+ 
Sbjct: 297 QPGAFAGGGQTAITPDSEVSLTEENSRMFLLEPGITLQELVSAVNKVGAAPGDLIAILEA 356

Query: 356 IKAAGALQSEIII 368
           ++ AGAL++++I+
Sbjct: 357 LQQAGALRAQLIV 369


>gi|320354345|ref|YP_004195684.1| flagellar P-ring protein [Desulfobulbus propionicus DSM 2032]
 gi|320122847|gb|ADW18393.1| flagellar P-ring protein [Desulfobulbus propionicus DSM 2032]
          Length = 372

 Score =  385 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 158/366 (43%), Positives = 230/366 (62%), Gaps = 9/366 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L   L      +    +RIKD+  ++  RDNQL+GYGLV+GL GTGD ++ S FT+Q+M 
Sbjct: 10  LSVLLTVFCIAADASATRIKDLADIEGVRDNQLMGYGLVIGLNGTGDDIKKSVFTKQAMI 69

Query: 68  SLLQNLGISTPGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           ++++ +G++ P     ++ + NVAAVMVTA LPPFA PGS ID+ ++S+GDASSL GG L
Sbjct: 70  NMIKRMGMAIPEDVFKQMKTDNVAAVMVTAQLPPFARPGSAIDIQVSSIGDASSLSGGTL 129

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           +MT L G DGN YAVAQG + V G+   G+++   +   T G +  GAIVER +      
Sbjct: 130 LMTPLKGPDGNTYAVAQGPLAVGGIAFGGKAAKAQKNFPTSGHLTGGAIVERAVNYALPP 189

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLM 242
           S DL+ QLR+ DF+TA R+A+ IN+     F    A+  DSRTVKV+KP+ +  D+   +
Sbjct: 190 SGDLLYQLRDTDFTTASRMAEAINA----HFGSGTAKPMDSRTVKVTKPSRVKGDVVSFI 245

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           S++E + +E D PA++++NERTGTIV+G +VRIS V VS+GNL + I+E  +V QPN  +
Sbjct: 246 SDLESIEIEPDRPAKIVVNERTGTIVMGQDVRISTVAVSHGNLNLVISEATEVSQPNPLA 305

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           +  +      T     +      L    +L  +   +N+IG     +I+I Q IKAAGAL
Sbjct: 306 AGTTVAAPATTITATEEAGNLVVLPMGVNLGEIARALNAIGATPRDLIAIFQAIKAAGAL 365

Query: 363 QSEIII 368
           Q E++I
Sbjct: 366 QGELVI 371


>gi|259417993|ref|ZP_05741912.1| flagellar P-ring protein FlgI [Silicibacter sp. TrichCH4B]
 gi|259346899|gb|EEW58713.1| flagellar P-ring protein FlgI [Silicibacter sp. TrichCH4B]
          Length = 367

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 149/372 (40%), Positives = 228/372 (61%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + +   ++ + + L  ++     R+KD+V     R N L+GYGLVVGL GTGD LR+SPF
Sbjct: 1   MRKFLHILMTCLLLPTLAQANAIRLKDLVEFDGVRGNDLVGYGLVVGLDGTGDGLRNSPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE+ M ++L+ LG++  G +   KNVAAV VTA LPPFA  G  +D +++++GD+SSL G
Sbjct: 61  TEEIMANILERLGVNVSGEQFRPKNVAAVFVTATLPPFARVGGTLDATVSAIGDSSSLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L  ADG IYAVAQG+++  G   +G++++  +G+ T G I +GA VERE+   
Sbjct: 121 GTLIMTPLNAADGQIYAVAQGTILAGGAVAEGEAATVTQGVPTSGVIPSGARVEREIDFD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNIDLT 239
                 + L LR PDF+TA RI   INS     F R +A   DS TV+V+          
Sbjct: 181 LSSLNSMRLALREPDFTTAGRIEQAINS----EFGRNVAVMRDSGTVEVNIQRTNARSTA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             +  +E + VE    ARV++++R+GTIV+G +VRIS V V+ GNLT+++ E   V QPN
Sbjct: 237 HAVGRMENVLVEPQRKARVVVDQRSGTIVMGSDVRISNVAVAQGNLTLRVEEAPLVSQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKG--SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F + G TV    T   + + +G     + +   L+ +++G+N++G+    +I IL+ +K
Sbjct: 297 PF-AEGETVVVPRTGAAIEEEEGVQLAEVPETTSLSEVVAGLNALGVSPRDMIDILKSLK 355

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E +++
Sbjct: 356 AAGALHAEFVVR 367


>gi|285018205|ref|YP_003375916.1| flagellar p-ring protein precursor (basal body p-ring protein
           [Xanthomonas albilineans GPE PC73]
 gi|283473423|emb|CBA15928.1| probable flagellar p-ring protein precursor (basal body p-ring
           protein [Xanthomonas albilineans]
          Length = 372

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 142/368 (38%), Positives = 210/368 (57%), Gaps = 8/368 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
              L    +    ++     RIKD+  +   R N L+GYGLVVGL G+GD    +PFT Q
Sbjct: 8   CRLLAAFALCTSLVAPAAAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQ 67

Query: 65  SMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           S++++L  LG++ P       KNVAAV ++A LPPFA PG  IDV+++S+G+A SLRGG 
Sbjct: 68  SLKNMLGELGVNVPANVNPQLKNVAAVAISAQLPPFAKPGQPIDVTVSSIGNAISLRGGS 127

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKF 182
           L+MT L GADG +YA+AQG++VV G   +G   S     + + G I NGA VER LP  F
Sbjct: 128 LLMTPLKGADGQVYAIAQGNLVVGGFGAQGKDGSRISVNVPSVGLIPNGATVERALPDVF 187

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRL 241
             S+++ L L   DF+T  R+   +     N F    A A D  TV V  P++      L
Sbjct: 188 GSSSEITLNLHQADFTTVSRMVAALE----NTFGPGSAHAVDGSTVAVRSPSDQSARIGL 243

Query: 242 MSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           ++ +E + +     PA+V++N RTGT+VIG  VR+S   +S+G+LTV I+E   V QPNA
Sbjct: 244 LARIENVELSPGAAPAKVVVNARTGTVVIGAQVRVSPAAISHGSLTVTISEGTDVSQPNA 303

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            S+  +  T  +T    ++    F       L+ ++  +N +G     +I+IL+ +K AG
Sbjct: 304 LSNGQTVATPKSTITATNEGSRMFKFEGGTSLDQIVRAVNEVGAAPGDLIAILEALKQAG 363

Query: 361 ALQSEIII 368
           AL +E+ +
Sbjct: 364 ALSAELEV 371


>gi|119469954|ref|ZP_01612759.1| flagellar P-ring protein precursor I [Alteromonadales bacterium
           TW-7]
 gi|119446664|gb|EAW27937.1| flagellar P-ring protein precursor I [Alteromonadales bacterium
           TW-7]
          Length = 364

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 145/371 (39%), Positives = 211/371 (56%), Gaps = 13/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             +  LI  +  +    +    RIKD+  ++  R NQL+GYGLVVGL GTG+    S FT
Sbjct: 1   MNVLKLICLITLIGCQFSAHAERIKDISMVEGVRSNQLVGYGLVVGLPGTGE---QSRFT 57

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           +QS + +L N GIS P       KNVAAV V A LP F  PG  ID++++S+G A SLRG
Sbjct: 58  QQSFKGMLSNFGISLPANLSPKIKNVAAVAVHAELPAFRKPGQTIDITVSSIGSAGSLRG 117

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L GADGN+YAVAQGS++V GL  +G   S  +    T G+I NGA VERE+  
Sbjct: 118 GTLLQTFLKGADGNVYAVAQGSLIVGGLGAQGADGSRVVINTPTVGRIPNGATVEREVKS 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L  PDF+TA R+   IN           A+A DS +V+V  P +     
Sbjct: 178 PFMQGDFITFNLNRPDFTTAKRLEKTINDLV----GPNSAKAIDSVSVRVIAPRDASQRV 233

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L  +  D  A++I+N RTGTIVIG NV++    +++G LTV I+E + V QP
Sbjct: 234 SYLSTLENLEFKPADMSAKIIVNSRTGTIVIGKNVKLQPAAITHGGLTVTISEQQNVAQP 293

Query: 299 NAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           NA  + G TV    + + V+++   +F       L+ L+  +N +G     +++IL+ +K
Sbjct: 294 NAL-AEGETVVTQQSIIDVNEDDSRAFVFNPGVSLDDLVRAINEVGAAPGDLMAILEALK 352

Query: 358 AAGALQSEIII 368
            AGA+  ++++
Sbjct: 353 EAGAINGQLVV 363


>gi|86146151|ref|ZP_01064477.1| flagellar P-ring protein precursor [Vibrio sp. MED222]
 gi|218708808|ref|YP_002416429.1| flagellar basal body P-ring protein [Vibrio splendidus LGP32]
 gi|254789300|sp|B7VKM6|FLGI_VIBSL RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|85836098|gb|EAQ54230.1| flagellar P-ring protein precursor [Vibrio sp. MED222]
 gi|218321827|emb|CAV17798.1| Flagellar P-ring protein precursor [Vibrio splendidus LGP32]
          Length = 363

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 147/372 (39%), Positives = 224/372 (60%), Gaps = 15/372 (4%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++  ++F ++ L   S+   +RIKDV  +   R NQL+GYGLV GL GTG+   ++PF
Sbjct: 1   MKKLTLVLFGMLFL--ASSAHAARIKDVAKVAGVRSNQLVGYGLVTGLPGTGE---TTPF 55

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T+Q+  ++LQN GI  P G +  +KNVAAV+VTA LP F+  G  +DV+++S+G A SLR
Sbjct: 56  TDQTFNAMLQNFGIQLPPGTKPKTKNVAAVIVTAELPAFSKQGQEVDVTVSSIGSAKSLR 115

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+ T L G DG +YAVAQG++VVSG   +G   S  +      G I +GA VE+E+P
Sbjct: 116 GGTLLQTFLKGLDGQVYAVAQGNLVVSGFSAQGNDGSKLVGNNPNVGIISSGATVEQEIP 175

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     +   L   DF+TA R+AD +N++        +A A D+ +VKV  P  I   
Sbjct: 176 TPFGRGDYITFNLIQSDFTTAQRLADAVNNF----LGPQMASAVDATSVKVRAPREISQR 231

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S +E +  +     A++I+N RTGTIV+G +VR+    V++G +TV I EN  V Q
Sbjct: 232 VAFLSAIENIEFDPAEGSAKIIVNSRTGTIVVGKHVRLKAAAVTHGGMTVAIKENLNVSQ 291

Query: 298 PNAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF S G TV   ++D++V++ +   F       L+ L+  +N +G     +++ILQ +
Sbjct: 292 PNAF-SGGQTVVVPDSDIEVTEADGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQAL 350

Query: 357 KAAGALQSEIII 368
           K AGA++ ++II
Sbjct: 351 KQAGAIEGQLII 362


>gi|254292900|ref|YP_003058923.1| flagellar P-ring protein [Hirschia baltica ATCC 49814]
 gi|254041431|gb|ACT58226.1| flagellar P-ring protein [Hirschia baltica ATCC 49814]
          Length = 369

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 174/370 (47%), Positives = 251/370 (67%), Gaps = 9/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
              AF +  L+ L+ + A   SR+KD+V ++  RDNQLIGYG+VVGL G+GDSLR+SP T
Sbjct: 4   ILCAFFLTLLLSLNSLGAAAGSRLKDIVDIEGVRDNQLIGYGIVVGLNGSGDSLRNSPMT 63

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
            QS+ ++L+ LG++T    L +KNVAAVMVTA+LP F++ GSRID++++++GDA SL GG
Sbjct: 64  RQSLEAMLERLGVNTREETLNTKNVAAVMVTASLPAFSTAGSRIDITVSAMGDAKSLEGG 123

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKK 181
            L++T L+GA+G +YAV QGSV V G    G   S+ +  + T G+I NGA+VE E+P  
Sbjct: 124 TLLVTPLMGANGEVYAVGQGSVAVGGFAAGGDSGSALVRNVPTNGRIPNGALVELEVPYA 183

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LT 239
             +   L L LRNPDF+TA RI+  INSY        +A A D  TV +++P N    ++
Sbjct: 184 LNNQNKLRLSLRNPDFTTATRISSVINSY----MGTTVAFAMDPATVALNRPPNFQGGMS 239

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            L++E+E L VE D PAR++INE TG IV+G+NVR+S+V ++ GNLT+ ++E   V QPN
Sbjct: 240 MLLAEIERLEVEPDQPARIVINETTGIIVMGENVRVSQVAIAQGNLTISVSEQPAVSQPN 299

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKA 358
           AF   G TV    TD+  +++    +LI     LN L++G+N++G+    +ISILQ +KA
Sbjct: 300 AF-GAGETVVVPQTDIAANEDVADLALIGGSVPLNDLVNGLNALGVSPRDMISILQALKA 358

Query: 359 AGALQSEIII 368
           +GALQ++I I
Sbjct: 359 SGALQADIEI 368


>gi|54308101|ref|YP_129121.1| flagellar basal body P-ring protein [Photobacterium profundum SS9]
 gi|81615375|sp|Q6LTQ6|FLGI2_PHOPR RecName: Full=Flagellar P-ring protein 2; AltName: Full=Basal body
           P-ring protein 2; Flags: Precursor
 gi|46912527|emb|CAG19319.1| Putative flagellar P-ring protein FlgI [Photobacterium profundum
           SS9]
          Length = 363

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 147/349 (42%), Positives = 212/349 (60%), Gaps = 13/349 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKDV  +   R NQL+GYGLVVGL GTG+   ++PFT+QS  ++LQN GI  P G +  
Sbjct: 22  RIKDVSEVAGVRSNQLVGYGLVVGLPGTGE---TTPFTDQSFNAMLQNFGIQLPAGTKPK 78

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KNVAAV V A LP F   G +ID++++S+G A SLRGG L+ T L G DG +YAVAQGS
Sbjct: 79  TKNVAAVAVNATLPAFTKQGQKIDITVSSIGSAKSLRGGTLLQTFLKGLDGKVYAVAQGS 138

Query: 144 VVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G  V     S  +  I T G+I NGA+VE+E+P  F     L   L   DFSTA R
Sbjct: 139 LVVGGFSVTGADGSKLVGNIPTVGRISNGAMVEQEVPNPFGRGDFLTFNLFESDFSTAQR 198

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDT-PARVII 260
           +AD +N +        +A A D+ +V+V  P ++      ++ VE +  +     A++I+
Sbjct: 199 LADAVNEF----LGPEMAAAIDATSVRVRAPRDVSQRVAFLATVENIEFDPAVGAAKIIV 254

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD- 319
           N RTGTIVIG NV++    +++G +TV I EN QV QP  F S G TV   N++++V++ 
Sbjct: 255 NSRTGTIVIGQNVKLKPAAITHGGMTVSIKENYQVSQPAPF-SGGETVVVPNSEIEVTEK 313

Query: 320 NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +   F       L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 314 DSRMFKFEPGVTLDELVRAVNQVGAAPSDLMAILQALKQAGAIEGQLII 362


>gi|2275163|gb|AAB81415.1| FlgI [Sinorhizobium meliloti]
          Length = 372

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 224/367 (61%), Positives = 285/367 (77%), Gaps = 2/367 (0%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           +    +         SA   SRIKDV SLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT+
Sbjct: 7   KWLLTLAVAFAATLTSAYAASRIKDVASLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTD 66

Query: 64  QSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           QS+R++LQNLGIST GG   ++NVAAV+VTA LPPFASPGSR+DV++ SLGDA+SLRGG 
Sbjct: 67  QSIRAMLQNLGISTQGGDSRTRNVAAVLVTATLPPFASPGSRLDVTVGSLGDATSLRGGT 126

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           LVMTSL GADG IYAVAQGSVVVSG   +G+++   +G++T G++ NGAI+ERELP KFK
Sbjct: 127 LVMTSLSGADGQIYAVAQGSVVVSGFNAQGEAAQLSQGVTTAGRVPNGAIIERELPSKFK 186

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMS 243
           D  +L+LQLRNPDFSTA+ +A  IN Y+  +F   IAEA DS++V V KP   DL RLM+
Sbjct: 187 DGFNLVLQLRNPDFSTAVGMAAAINRYAAAQFGGRIAEALDSQSVLVQKPKMADLARLMA 246

Query: 244 EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           +VE L +ETD PARV+INERTGTIVIG +VR+++V VSYG LTVQ++E   +VQP  F S
Sbjct: 247 DVENLVIETDAPARVVINERTGTIVIGQDVRVAEVAVSYGTLTVQVSETPTIVQPEPF-S 305

Query: 304 NGSTVTQNNTDLKVS-DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G T  + NT ++   D +G+ ++++   L SL++G+NSIG+K DGII+ILQ IK+AGAL
Sbjct: 306 RGETAYEPNTTIEAQADGRGTVAILNGSSLRSLVAGLNSIGVKPDGIIAILQSIKSAGAL 365

Query: 363 QSEIIIQ 369
           Q+E+++Q
Sbjct: 366 QAELVLQ 372


>gi|163735546|ref|ZP_02142978.1| flagellar P-ring protein precursor I [Roseobacter litoralis Och
           149]
 gi|161391166|gb|EDQ15503.1| flagellar P-ring protein precursor I [Roseobacter litoralis Och
           149]
          Length = 367

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 160/372 (43%), Positives = 233/372 (62%), Gaps = 10/372 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVV-SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            +   L+  L      +A     RIKD+V     R N L+GYGLVVGL G+GD LR++PF
Sbjct: 1   MKYLILLMMLAFSIVSTAHAGPVRIKDLVEFDGVRGNDLVGYGLVVGLNGSGDGLRNAPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE+ M ++L+ LG++  G +   KNVAAV VTA LPPFA  GS+IDV+++++GDASSL G
Sbjct: 61  TEEIMSNILERLGVNVSGEQFRPKNVAAVFVTAALPPFARGGSQIDVTVSAIGDASSLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT +  ADG IYAVAQG+++  G   +G  ++  +G+ T G I +GA VERE+   
Sbjct: 121 GTLIMTPMNAADGQIYAVAQGTIIAGGATAEGDGANVTQGVPTSGVIPSGARVEREIDFD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTV--KVSKPTNIDLT 239
               ++L L LR+ DF+TA RI   IN    N F RP+A   DS TV   V     I + 
Sbjct: 181 LSSLSELRLALRDADFTTAARIEAAIN----NDFGRPVALMLDSGTVSLNVDSTEMISVA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             +  +E ++VE +  ARV++++R+GTIV+G++VRIS+V VS GNLT++I E    +QPN
Sbjct: 237 HALGRIENISVEPERKARVVVDQRSGTIVMGEDVRISRVAVSQGNLTLRIQEAPIAIQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F + G TV    T  ++ +    G   + D   L+ +I+G+N++G+    +I IL+ IK
Sbjct: 297 PF-AEGETVVVPRTRAELEEEPGIGLAEVPDGTSLSEVIAGLNALGVSPRDMIDILKSIK 355

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E I++
Sbjct: 356 AAGALHAEFIVR 367


>gi|260767765|ref|ZP_05876700.1| flagellar P-ring protein FlgI [Vibrio furnissii CIP 102972]
 gi|260617274|gb|EEX42458.1| flagellar P-ring protein FlgI [Vibrio furnissii CIP 102972]
 gi|315179403|gb|ADT86317.1| flagellar P-ring protein FlgI [Vibrio furnissii NCTC 11218]
          Length = 361

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 150/365 (41%), Positives = 220/365 (60%), Gaps = 13/365 (3%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           +  L+ +    +   +RIKDV  +   R NQL+GYGLV GL GTG+S   +PFT+QS  +
Sbjct: 4   LTLLLMMFVAVSAQAARIKDVSQVAGVRSNQLVGYGLVTGLPGTGES---TPFTDQSFNA 60

Query: 69  LLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +LQ+ GI  P G +  +KNVAAV+VTA+LP F+  G  +DV+++S+G A SLRGG L+ T
Sbjct: 61  MLQSFGIQLPQGTKPKTKNVAAVIVTADLPAFSKQGQTVDVTVSSIGSAKSLRGGTLMQT 120

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
            L G DG +YAVAQG++VVSG    G   S  +    T G I  GAIVERE+P  F    
Sbjct: 121 FLKGLDGQVYAVAQGNLVVSGFSASGADGSKIVGNNPTVGMISAGAIVEREVPTPFGRGD 180

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEV 245
            +   L   DF+TA R+AD +N +        +A A D+ +V+V  P ++      +S +
Sbjct: 181 FITFNLLESDFTTAQRMADAVNQF----LGPQMASAVDATSVRVRAPRDVGQRVAFLSAI 236

Query: 246 EMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           E L  +  D  A++I+N RTGTIV+G +VR+    V++G +TV I EN  V QPNAF S 
Sbjct: 237 ENLEFDPADGAAKIIVNSRTGTIVVGQHVRLKPAAVTHGGMTVAIKENLNVSQPNAF-SG 295

Query: 305 GSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G T    ++ ++V++ KG  F L     L+ L+  +N +G     +++ILQ +K AGA++
Sbjct: 296 GQTAIVPDSSIEVTEKKGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIE 355

Query: 364 SEIII 368
            ++II
Sbjct: 356 GQLII 360


>gi|148976398|ref|ZP_01813104.1| flagellar P-ring protein precursor I [Vibrionales bacterium SWAT-3]
 gi|145964221|gb|EDK29477.1| flagellar P-ring protein precursor I [Vibrionales bacterium SWAT-3]
          Length = 363

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 146/372 (39%), Positives = 224/372 (60%), Gaps = 15/372 (4%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++  ++F ++ L   ++   +RIKDV  +   R NQL+GYGLV GL GTG+   ++PF
Sbjct: 1   MKKLTLVLFGMLFL--ATSAHAARIKDVAKVAGVRSNQLVGYGLVTGLPGTGE---TTPF 55

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T+Q+  ++LQN GI  P G +  +KNVAAV+VTA LP F+  G  +DV+++S+G A SLR
Sbjct: 56  TDQTFNAMLQNFGIQLPPGTKPKTKNVAAVIVTAELPAFSKQGQEVDVTVSSIGSAKSLR 115

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+ T L G DG +YAVAQG++VVSG   +G   S  +      G I +GA VE+E+P
Sbjct: 116 GGTLLQTFLKGLDGQVYAVAQGNLVVSGFSAQGNDGSKIVGNNPNVGIISSGATVEQEIP 175

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     +   L   DF+TA R+AD +N++        +A A D+ +VKV  P  I   
Sbjct: 176 TPFGRGDYITFNLIQSDFTTAQRMADAVNNF----LGPQMASAVDATSVKVRAPREISQR 231

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S +E +  +     A++I+N RTGTIV+G +VR+    V++G +TV I EN  V Q
Sbjct: 232 VAFLSAIENIEFDPAEGSAKIIVNSRTGTIVVGKHVRLKAAAVTHGGMTVAIKENLNVSQ 291

Query: 298 PNAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF S G TV   ++D++V++ +   F       L+ L+  +N +G     +++ILQ +
Sbjct: 292 PNAF-SGGQTVVVPDSDIEVTEADGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQAL 350

Query: 357 KAAGALQSEIII 368
           K AGA++ ++II
Sbjct: 351 KQAGAIEGQLII 362


>gi|330899408|gb|EGH30827.1| flagellar basal body P-ring protein [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 345

 Score =  384 bits (987), Expect = e-105,   Method: Composition-based stats.
 Identities = 142/348 (40%), Positives = 204/348 (58%), Gaps = 11/348 (3%)

Query: 27  KDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR--LGS 84
           KD+ S+   R NQLIGYGLVVGL GTGD    +PFT Q+  ++L   GI  P G   +  
Sbjct: 2   KDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPFTLQTFNNMLSQFGIKVPAGSGTVQL 61

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAV V A+LP FA PG  +D++++S+G++ SLRGG L+MT + G DGN+YA+AQG++
Sbjct: 62  KNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSLRGGALLMTPMKGVDGNVYAIAQGNL 121

Query: 145 VVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           VV G   +G   S     + + G+I  GA VER +P  F     L L L   DF+TA R+
Sbjct: 122 VVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSVPSGFNQGNTLTLNLNRSDFTTAKRV 181

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDT-PARVIIN 261
            D+IN          +A+A D  +V+V+ P +       +S +E L V+     A+VIIN
Sbjct: 182 VDKINEL----LGPGVAQALDGGSVRVTAPLDPGQRVDYLSILENLEVDPGQTAAKVIIN 237

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN- 320
            RTGTIVIG NV++S   V++G+LTV ITE+  V QP A  S G T     + +      
Sbjct: 238 SRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGAL-SGGQTAVVPRSRVNAQQEL 296

Query: 321 KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              F       L+ ++  +N +G     +++IL+ +K AGALQ+++I+
Sbjct: 297 HPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGALQADLIV 344


>gi|311694365|gb|ADP97238.1| flagellar P-ring protein precursor I [marine bacterium HP15]
          Length = 365

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 141/372 (37%), Positives = 221/372 (59%), Gaps = 13/372 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +     +++ L      +  +  R+KD+  ++  R+NQL+GYGLVVGL GTGD    +PF
Sbjct: 1   MSLRRVIVWVLALAVVSAPVLADRLKDLSRIKGVRNNQLVGYGLVVGLDGTGDK---APF 57

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T Q+ R+++   G++ P G      NVAAV V+A LPPFA  G  ID++++S+G+A SLR
Sbjct: 58  TNQTFRNMMNQFGVTLPEGVNPNLANVAAVTVSATLPPFAKAGQEIDITVSSIGNADSLR 117

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+MTSL GADG +YA+AQGS+VV G   +G   S     + + G+I NGA +ERE+ 
Sbjct: 118 GGTLLMTSLKGADGQVYAMAQGSLVVGGFGAQGQDGSRITVNVPSVGRIPNGATIEREVA 177

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     +   L  PDF+TA R+ + +N     R    +A A+D+ ++ V  P +    
Sbjct: 178 SPFSQGDTITFHLLRPDFTTARRVVEAVND----RLGPDMAYAHDATSISVRAPRDPSQR 233

Query: 239 TRLMSEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S +E + V+    A +V+IN RTGTIV+G NV++S   V++GNLTV I EN  V Q
Sbjct: 234 VSFLSILENIEVDPAQDAAKVVINSRTGTIVVGQNVQVSAAAVTHGNLTVTIQENPNVEQ 293

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PN F + G T  + ++ + +++     F    A  LN ++  +N +G     ++++L+ +
Sbjct: 294 PNPF-AGGDTAIEQDSQIAITEEPARMFKFGPAVTLNEIVQAVNQVGAAPGDVMAVLEAL 352

Query: 357 KAAGALQSEIII 368
           K AGAL++E+I+
Sbjct: 353 KQAGALRAELIV 364


>gi|56460248|ref|YP_155529.1| flagellar basal body P-ring protein [Idiomarina loihiensis L2TR]
 gi|62286744|sp|Q5R0Q0|FLGI_IDILO RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|56179258|gb|AAV81980.1| Flagellar basal-body P-ring protein [Idiomarina loihiensis L2TR]
          Length = 366

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 151/373 (40%), Positives = 212/373 (56%), Gaps = 13/373 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M     F +   +     +    SRIKD+ S+Q  R NQLIGYGLVVGL GTG+    +P
Sbjct: 1   MRTLKIFALAVSLLSMLAAPVQASRIKDIASVQGVRSNQLIGYGLVVGLPGTGE---QTP 57

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+Q+ R++L N GI+ P   R    NVAAV V A LP FA PG +IDV+++S+G A  L
Sbjct: 58  FTDQTFRTMLGNFGINIPANERPKIDNVAAVAVHAELPAFAKPGQKIDVTVSSVGSADGL 117

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
            GG L+ T L GA+G +YAVAQGS++V GL  +G   S  +    T G+I NG +VERE+
Sbjct: 118 TGGTLMQTFLKGANGEVYAVAQGSLIVGGLGAEGNDGSRIVINTPTVGRIPNGGVVEREV 177

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-ID 237
              F  S  L   L   DF+TA R+A+ IN+          A+A D+ +V+V  P +   
Sbjct: 178 RSGFGSSDYLTFNLHQSDFTTAKRMAETINNLV----GDGTAQAVDATSVRVRAPRDLSQ 233

Query: 238 LTRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               MS +E L V+     A++I+N RTGTIV+G NV +    V++GN+ V I EN  V 
Sbjct: 234 RVSYMSTLENLEVQQASASAKIIVNARTGTIVVGQNVELRPAAVAHGNMQVTIAENVNVD 293

Query: 297 QPNAFSSNGSTVTQNNTDLKV-SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPN F ++G T     + + V  ++   F       LN L+  +N IG     +I++L+ 
Sbjct: 294 QPNPF-ADGETAITPQSIIDVNQEDARMFVFQPGTTLNDLVRAVNQIGAAPGDMIAVLEA 352

Query: 356 IKAAGALQSEIII 368
           +K AGAL  E+I+
Sbjct: 353 LKQAGALSGELIV 365


>gi|119775446|ref|YP_928186.1| flagellar basal body P-ring protein [Shewanella amazonensis SB2B]
 gi|166214837|sp|A1S810|FLGI_SHEAM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|119767946|gb|ABM00517.1| flagellar P-ring protein FlgI [Shewanella amazonensis SB2B]
          Length = 363

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 152/370 (41%), Positives = 215/370 (58%), Gaps = 12/370 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +I  L+   + L         RIKD+ ++Q  R NQLIGYGLVVGL GTG+      +T
Sbjct: 1   MKIKVLLAVAL-LAMTVPVKAERIKDIAAVQGVRSNQLIGYGLVVGLPGTGEKAN---YT 56

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQ+  ++L+N GI+ P   +   KNVA V V A++PPF  PG  +DV+++S+G+A SLRG
Sbjct: 57  EQTFTTMLKNFGINLPTNVKPKIKNVAVVAVHADMPPFIKPGQTLDVTVSSIGEAKSLRG 116

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DGNIYA+AQGS+VVSG   +G   S  ++   T G+I NGA+VER +P 
Sbjct: 117 GTLLQTFLKGVDGNIYAIAQGSMVVSGFSAEGLDGSKVIQNTPTVGRIPNGALVERAVPS 176

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     L   L   DFSTA R+AD IN          +A A D+ +V+V  P +     
Sbjct: 177 AFAHGDFLTFNLHRADFSTAKRMADAINDL----LGPEMARALDAASVQVYAPRDASQRV 232

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++ +E + VE  D  A+VI+N RTGTIV+G NV++    V++G LTV I EN+QV QP
Sbjct: 233 SFLATLENVEVEPADESAKVIVNSRTGTIVVGQNVKLLPAAVTHGGLTVTIAENQQVSQP 292

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           NA +   + VT  +T      N   F       L+ L+  +N +G     +++IL+ +K 
Sbjct: 293 NALAGGDTVVTNQSTIDASQANSRMFLFNPGTSLDELVRAVNLVGAAPSDVLAILEALKM 352

Query: 359 AGALQSEIII 368
           AGAL  E+I+
Sbjct: 353 AGALHGELIV 362


>gi|238796908|ref|ZP_04640412.1| Flagellar P-ring protein [Yersinia mollaretii ATCC 43969]
 gi|238719168|gb|EEQ10980.1| Flagellar P-ring protein [Yersinia mollaretii ATCC 43969]
          Length = 373

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 149/368 (40%), Positives = 217/368 (58%), Gaps = 8/368 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
               L  + + L         RI+D+ ++Q  R N L+GYGLVVGL G+GD    +PFT 
Sbjct: 8   LCLSLFCTGLILFLPQQAQAERIRDLTTIQGIRSNSLMGYGLVVGLDGSGDQTMQTPFTT 67

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS+ ++L  LGI+ P G  +  KNVAAVMVT  LPPFA PG +IDV ++SLG+A SLRGG
Sbjct: 68  QSLSNMLSQLGITVPAGTNMQLKNVAAVMVTTELPPFARPGEKIDVVVSSLGNAKSLRGG 127

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L G D  IYA+AQG+++VSG   +   S        G +I  GA VERE+P  F
Sbjct: 128 TLLMTPLKGVDNQIYALAQGNLLVSGSGAQAGGSRVQVNQLNGARISGGATVEREVPVSF 187

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRL 241
                L LQL   DFS A +++D+IN     R     A A DSRT+K+  P +     R 
Sbjct: 188 ASENILRLQLNEDDFSLAQQVSDEIN----RRLGGSTAMAEDSRTIKLFAPADSAGKVRF 243

Query: 242 MSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           ++ V+ + ++     A+VIIN RTG++V+  +V +    VS G+LTV+I++  +V QP+ 
Sbjct: 244 LANVQNIPIKVGVMDAKVIINSRTGSVVMNRHVVLEACAVSQGDLTVEISQTNEVSQPDT 303

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
               G TV   NT + V +  G    +  + DLNS++  +NS+G   + ++SILQ +K+A
Sbjct: 304 PLGGGQTVVTPNTQISVREQNGHLQQVKTSADLNSVVRALNSLGATPNDLMSILQSMKSA 363

Query: 360 GALQSEII 367
           G L++++ 
Sbjct: 364 GCLRAKLE 371


>gi|254488985|ref|ZP_05102190.1| flagellar P-ring protein FlgI [Roseobacter sp. GAI101]
 gi|214045854|gb|EEB86492.1| flagellar P-ring protein FlgI [Roseobacter sp. GAI101]
          Length = 367

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 157/372 (42%), Positives = 234/372 (62%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R   + F+LI L   +     RIKD+V     R+N L+GYGLVVGL G+GD LR++PF
Sbjct: 1   MIRGWLITFALIVLILPAYAGPVRIKDLVDFDGVRENDLVGYGLVVGLNGSGDGLRNAPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE  M ++L+ LG++  G +   KNVAAV+VTA LP FA  GS+IDV+++++GDA SL G
Sbjct: 61  TEDIMTNILERLGVNVTGEQFRPKNVAAVLVTATLPAFARTGSQIDVTVSAIGDAKSLMG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L  ADG+IYAVAQG+++  G   +G + + ++G+ T G I +GA VERE+  +
Sbjct: 121 GTLIMTPLNAADGDIYAVAQGTIIAGGAVAEGDAGAVIQGVPTSGVIPSGARVEREIDFQ 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN--IDLT 239
               +DL L LR  DF+TA RI   IN      F R +A   DS TV+++        + 
Sbjct: 181 LSSLSDLRLALREGDFTTATRIERAIN----LEFGREVAVMLDSGTVQLNIERTRMPSVA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             +  +E L+VE +  ARV++++R+GTIV+G++VRIS+V VS GNL ++I E   VVQPN
Sbjct: 237 HALGRIENLSVEPERKARVVVDQRSGTIVMGEDVRISRVAVSQGNLVLRIQEEPIVVQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F + G T+    T   + +    G   + +   L+ +I G+N++G+    +I IL+ IK
Sbjct: 297 PF-AEGETIIVPRTRAAIEEQPGIGLAEIPNGTSLSEVIGGLNALGVSPRDMIDILKSIK 355

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E +++
Sbjct: 356 AAGALHAEFVVR 367


>gi|171059408|ref|YP_001791757.1| flagellar basal body P-ring protein [Leptothrix cholodnii SP-6]
 gi|170776853|gb|ACB34992.1| flagellar P-ring protein [Leptothrix cholodnii SP-6]
          Length = 392

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 155/367 (42%), Positives = 219/367 (59%), Gaps = 9/367 (2%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
             L+ +   L   +    +RIK+V S+Q  R NQL+GYGLVVGL GTGD    +PFT QS
Sbjct: 30  LALVLASTALWWPAPAHATRIKEVASVQGVRPNQLVGYGLVVGLDGTGDQTTQTPFTAQS 89

Query: 66  MRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           + ++LQ LG++ P G  +  KNVAAVMVTA LPPFA PG  +DV++ SLG+A SLRGG L
Sbjct: 90  LTAMLQQLGVTVPPGTNMQIKNVAAVMVTATLPPFAQPGQSVDVTVASLGNAKSLRGGTL 149

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           + T L GAD  IYA+AQG++++ G       S       + G+I +GA VER +P    +
Sbjct: 150 IGTPLRGADNQIYALAQGNLIIGGAGASAGGSKVQVNHLSAGRIPDGATVERAVPTPLAE 209

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMS 243
              L L L++ DF+TA  ++  IN     RF +  A A D R V+V  P   D     ++
Sbjct: 210 GDSLQLDLKSSDFATARAVSQAINE----RFGKGTASAMDGRVVRVKMPATPDERVNFLA 265

Query: 244 EVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           ++E L +E   P A+VI+N RTG+IV+   V ++   V++GNL+V IT   QV QP  F 
Sbjct: 266 DMENLAIELAKPAAKVIVNARTGSIVMNQAVTLAACAVAHGNLSVTITSTPQVSQPAPF- 324

Query: 303 SNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           SNG T     TD+K++   GS   L +   L  ++  +NS+G     +++ILQ IKAAGA
Sbjct: 325 SNGQTTVTEKTDIKINQEPGSLIQLKEGTQLTDVVKALNSLGATPGDLLAILQAIKAAGA 384

Query: 362 LQSEIII 368
           L +E+ +
Sbjct: 385 LNAELEV 391


>gi|109899398|ref|YP_662653.1| flagellar basal body P-ring protein [Pseudoalteromonas atlantica
           T6c]
 gi|122971713|sp|Q15R89|FLGI_PSEA6 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|109701679|gb|ABG41599.1| flagellar P-ring protein [Pseudoalteromonas atlantica T6c]
          Length = 370

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 155/373 (41%), Positives = 219/373 (58%), Gaps = 11/373 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            ++   I  +  +  +      RIKD+ S+Q  R NQL+GYGLVVGL GTG+    SPFT
Sbjct: 1   MKLLLFILMISSIIIVPVGQAQRIKDLASVQGVRSNQLVGYGLVVGLPGTGE---QSPFT 57

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQS R++L N GIS     +   KNVAAV V A LPPF  PG  IDV+++S+G+A+SLRG
Sbjct: 58  EQSFRTMLSNFGISLDSSLKPKIKNVAAVAVHAELPPFLKPGQTIDVTVSSVGEAASLRG 117

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DG +YAVAQGS+VVSG   +G   S  +    T G+I NGA++ER +P 
Sbjct: 118 GTLLQTFLKGLDGKVYAVAQGSMVVSGFGAEGADGSKIVANTPTVGRIANGALIERAVPS 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSL--NRFSRPIAEAYDSRTVKVSKPTNI-D 237
            F  +  L L L  PDFSTA  +AD IN            IA   D+ +V+VS P ++  
Sbjct: 178 GFMQNDFLTLNLNYPDFSTAKILADTINQRLGADPDKGYVIATPIDAASVRVSAPRDVGQ 237

Query: 238 LTRLMSEVEMLT-VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E    +    PAR++IN RTGTIVIG +VR+    +++G LTV I+EN+QV 
Sbjct: 238 RVGFLATLENFEFMPAKAPARIVINSRTGTIVIGQDVRLLPAAITHGGLTVTISENQQVT 297

Query: 297 QPNAFSSNGSTVTQNNTDLKVS-DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPN     G TV  + + + V+ D+   F       L+ L+  +N +G     +++IL+ 
Sbjct: 298 QPNPL-GQGDTVVTDQSIIDVNLDDTRMFKFDPGVTLDQLVRAVNEVGAAPGDLMAILEA 356

Query: 356 IKAAGALQSEIII 368
           +  AGALQ E+++
Sbjct: 357 LSEAGALQGELVV 369


>gi|260428977|ref|ZP_05782954.1| flagellar P-ring protein FlgI [Citreicella sp. SE45]
 gi|260419600|gb|EEX12853.1| flagellar P-ring protein FlgI [Citreicella sp. SE45]
          Length = 367

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 154/371 (41%), Positives = 231/371 (62%), Gaps = 9/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R   +  +L GL   ++    RIKD+V +   R N L+GYGLVVGL GTGD LR++PF
Sbjct: 1   MLRSLIVCLALFGLMHPASAQSVRIKDLVEVDGVRANDLVGYGLVVGLNGTGDGLRNAPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE+ M+++L+ LG++  G +   +NVAAV VT  LPPF   GS+IDV+++++GDA SL G
Sbjct: 61  TEEIMQNILERLGVNVTGEQFRPRNVAAVFVTGRLPPFGRAGSQIDVTVSAIGDAKSLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT +  ADG IYAVAQG+V+  G+  +G ++  ++G+ T G I  GA +ERE+   
Sbjct: 121 GTLIMTPMNAADGQIYAVAQGTVIAGGVEAQGDAARLVQGVPTSGVIPAGARIEREVDFD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKV--SKPTNIDLT 239
           F   + L L LR PDF+TA RI + IN        R  A+  D+ TV V   +       
Sbjct: 181 FTQLSSLRLALREPDFTTAARIENAINRSV----GRGAAQMLDAGTVSVDLRRTGASSPA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
           R +  +E L VE +  ARV++++R+GTIV+G++VRIS+V VS GNLT++I E    VQP+
Sbjct: 237 RAVVAIENLPVEPERRARVVVDQRSGTIVMGEDVRISRVAVSQGNLTLRIEETPIAVQPS 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F + G TV    T  ++ +    G   +     L+ +++G+N++G+    +I IL+ IK
Sbjct: 297 PF-AEGETVVVPRTGAEIVEEPGIGLAEIPSGTSLSEVVAGLNALGVSPRDMIDILKSIK 355

Query: 358 AAGALQSEIII 368
           AAGAL +E ++
Sbjct: 356 AAGALHAEFVV 366


>gi|332305619|ref|YP_004433470.1| flagellar P-ring protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172948|gb|AEE22202.1| flagellar P-ring protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 370

 Score =  383 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 155/373 (41%), Positives = 217/373 (58%), Gaps = 11/373 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +    I  +  +         RIKD+ S+Q  R NQL+GYGLVVGL GTG+    SPFT
Sbjct: 1   MKFLLFILIISAVVIAPIGQAQRIKDLASVQGVRSNQLVGYGLVVGLPGTGE---QSPFT 57

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQS R++L N GIS     +   KNVAAV V A LPPF  PG  IDV+++S+G+A+SLRG
Sbjct: 58  EQSFRTMLTNFGISLDSSLKPKIKNVAAVAVHAELPPFLKPGQTIDVTVSSVGEAASLRG 117

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DG +YAVAQGS+VVSG   +G   S  +    T G+I NGA++ER +P 
Sbjct: 118 GTLLQTFLKGLDGKVYAVAQGSLVVSGFGAQGADGSRIVANTPTVGRIANGALIERAVPS 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSL--NRFSRPIAEAYDSRTVKVSKPTNI-D 237
            F  +  L L L  PDFSTA  +AD IN            IA   D+ +V+VS P ++  
Sbjct: 178 GFMQNDFLTLNLNYPDFSTAKILADTINQRLGADPDKGYIIATPVDAASVRVSAPRDVGQ 237

Query: 238 LTRLMSEVEMLT-VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E    +    PAR++IN RTGTIVIG +VR+    +++G LTV I+EN+QV 
Sbjct: 238 RVGFLATLENFEFMPAKAPARIVINSRTGTIVIGQDVRLLPAAITHGGLTVTISENQQVS 297

Query: 297 QPNAFSSNGSTVTQNNTDLKVS-DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPN     G TV  + + + V+ D+   F       L+ L+  +N +G     +++IL+ 
Sbjct: 298 QPNPL-GQGETVVTDQSIIDVNLDDTRMFKFDPGVTLDQLVRAVNEVGAAPGDLMAILEA 356

Query: 356 IKAAGALQSEIII 368
           +  AGALQ E+++
Sbjct: 357 LSEAGALQGELVV 369


>gi|126668562|ref|ZP_01739516.1| flagellar P-ring protein precursor I [Marinobacter sp. ELB17]
 gi|126626967|gb|EAZ97610.1| flagellar P-ring protein precursor I [Marinobacter sp. ELB17]
          Length = 384

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 145/367 (39%), Positives = 220/367 (59%), Gaps = 11/367 (2%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
             L  +L+ L   S  +  R+KD+  ++  RDNQL+GYGLVVGL G+GD    +PFT Q+
Sbjct: 24  KCLAIALMALMVASPVMADRLKDLARIKGVRDNQLVGYGLVVGLAGSGDK---APFTNQT 80

Query: 66  MRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            R+++   G++ P G      NVAAV V A +PPFA PG +ID++++S+G+A SLRGG L
Sbjct: 81  FRNMMNQFGVTLPQGVDPKLANVAAVTVNATIPPFAKPGQQIDITVSSIGNAKSLRGGTL 140

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           +MT+L GADGN+YA+AQGS++V G   +G   S     I + G+I NGA VERE+   F 
Sbjct: 141 LMTTLKGADGNVYALAQGSLIVGGFGAEGLDGSRITVNIPSAGRIPNGATVEREVVSPFN 200

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
           +   +   L   DF+TA R+ + IN          +A A+D+ +V V  P +       +
Sbjct: 201 NGDTVTFNLLRSDFTTARRVVEAIN----GNLGPDMAYAHDATSVSVRAPRDASQRVSFL 256

Query: 243 SEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E + V   +  A+V+IN RTGTIV+G NV++S   V++G+LTV I EN  VVQPN  
Sbjct: 257 SILENIEVNPAEAAAKVVINSRTGTIVVGQNVKVSAAAVTHGSLTVIIQENPNVVQPNPL 316

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           ++  + V Q++      D    F    A  LN ++  +N +G     ++++L+ +K AGA
Sbjct: 317 AAGNTEVVQDSQIAVTEDPARMFKFGPAVTLNEIVQAVNQVGAAPGDVMAVLEALKQAGA 376

Query: 362 LQSEIII 368
           L++E+I+
Sbjct: 377 LRAELIV 383


>gi|254522675|ref|ZP_05134730.1| flagellar P-ring protein FlgI [Stenotrophomonas sp. SKA14]
 gi|219720266|gb|EED38791.1| flagellar P-ring protein FlgI [Stenotrophomonas sp. SKA14]
          Length = 380

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 144/362 (39%), Positives = 208/362 (57%), Gaps = 8/362 (2%)

Query: 11  SLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLL 70
             + L   +     RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL
Sbjct: 22  FFLLLAMAAPASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLL 81

Query: 71  QNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSL 129
             LG++ P       KNVAAV + A LPPFA PG  ID++++S+G+A SLRGG L+M  L
Sbjct: 82  GELGVNVPPNVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIGNAVSLRGGSLLMAPL 141

Query: 130 LGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADL 188
            GADG IYA+AQG+++V G   +G   S     + + G+I NGA VER LP    +  D+
Sbjct: 142 RGADGQIYAIAQGNLIVGGFGAQGKDGSRVSVNVPSVGRIPNGATVERALPDPLANGGDI 201

Query: 189 ILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEM 247
            L L N DF+T  R+   +N    N F    A A D  TV V+ PT+      L++ +E 
Sbjct: 202 TLNLHNNDFTTVSRMVAALN----NAFGEGAARAVDGVTVAVTAPTDPGARIGLLARIEN 257

Query: 248 LTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
           L +     PA+V++N RTGT+VIG  VR+    +S+G+LTV I EN  V QPNA S   +
Sbjct: 258 LELTPGSAPAKVVVNSRTGTVVIGQQVRVGPAAISHGSLTVTIQENTNVSQPNALSGGRT 317

Query: 307 TVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
             +  +T    +D    F       L+ ++  +N++G     +I+IL+ +K AGAL +E+
Sbjct: 318 VASPQSTITATNDGSRMFKFSGGTTLDEIVHAVNAVGAAPGDLIAILEALKQAGALSAEL 377

Query: 367 II 368
            +
Sbjct: 378 EV 379


>gi|114562346|ref|YP_749859.1| flagellar basal body P-ring protein [Shewanella frigidimarina NCIMB
           400]
 gi|114333639|gb|ABI71021.1| flagellar P-ring protein [Shewanella frigidimarina NCIMB 400]
          Length = 368

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 150/371 (40%), Positives = 215/371 (57%), Gaps = 11/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
              ++ +      L   +     RIKD+ S+Q  R NQL+GYGLVVGL GTG+  R   +
Sbjct: 4   KLLMSTVAVVASILMLTAPAHAERIKDIASIQGVRSNQLVGYGLVVGLPGTGEKTR---Y 60

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           TEQ+ R++L+N GI+ P   R  SKNVA V V A +P F  PG  +D++++SLG+A SLR
Sbjct: 61  TEQTFRTMLKNFGINLPDSVRPNSKNVAVVAVHAEMPAFIKPGQNLDITVSSLGEAKSLR 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+ T L G DGN+YA+AQGS++VSG   +G   S  ++   T G+I +GAIVER + 
Sbjct: 121 GGTLLQTFLKGVDGNVYAIAQGSLIVSGFSAEGLDGSMVIQNTPTVGRIPSGAIVERSVI 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     L   LR  DFSTA R AD IN          +A+A D+ +++VS P +    
Sbjct: 181 SPFASGDYLTFNLRRSDFSTAKRTADAINDL----LGPDMAKAIDATSIQVSAPRDASQR 236

Query: 239 TRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S +E + V   +  A+VI+N RTGTIV+G NV++    V++G LTV I E  QV Q
Sbjct: 237 VSFLSVLENIEVIPAEESAKVIVNSRTGTIVVGQNVKLLPAAVTHGGLTVTIAEATQVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           PNA +   + VT N+T      ++  F       L+ L+  +N +G     +++IL+ +K
Sbjct: 297 PNALAGGDTVVTTNSTIDVSEKDRRMFMFNPGTTLDELVRAVNLVGAAPSDVLAILEALK 356

Query: 358 AAGALQSEIII 368
            AGAL  E+II
Sbjct: 357 MAGALHGELII 367


>gi|153213605|ref|ZP_01948878.1| flagellar P-ring protein FlgI [Vibrio cholerae 1587]
 gi|153825355|ref|ZP_01978022.1| flagellar P-ring protein FlgI [Vibrio cholerae MZO-2]
 gi|153829338|ref|ZP_01982005.1| flagellar P-ring protein FlgI [Vibrio cholerae 623-39]
 gi|183179569|ref|ZP_02957780.1| flagellar P-ring protein FlgI [Vibrio cholerae MZO-3]
 gi|229513837|ref|ZP_04403299.1| flagellar P-ring protein FlgI [Vibrio cholerae TMA 21]
 gi|229522142|ref|ZP_04411559.1| flagellar P-ring protein FlgI [Vibrio cholerae TM 11079-80]
 gi|229524188|ref|ZP_04413593.1| flagellar P-ring protein FlgI [Vibrio cholerae bv. albensis VL426]
 gi|229528802|ref|ZP_04418192.1| flagellar P-ring protein FlgI [Vibrio cholerae 12129(1)]
 gi|262191685|ref|ZP_06049861.1| flagellar P-ring protein FlgI [Vibrio cholerae CT 5369-93]
 gi|297580839|ref|ZP_06942764.1| flagellar P-ring protein FlgI [Vibrio cholerae RC385]
 gi|124115804|gb|EAY34624.1| flagellar P-ring protein FlgI [Vibrio cholerae 1587]
 gi|148875179|gb|EDL73314.1| flagellar P-ring protein FlgI [Vibrio cholerae 623-39]
 gi|149741039|gb|EDM55108.1| flagellar P-ring protein FlgI [Vibrio cholerae MZO-2]
 gi|183012980|gb|EDT88280.1| flagellar P-ring protein FlgI [Vibrio cholerae MZO-3]
 gi|229332576|gb|EEN98062.1| flagellar P-ring protein FlgI [Vibrio cholerae 12129(1)]
 gi|229337769|gb|EEO02786.1| flagellar P-ring protein FlgI [Vibrio cholerae bv. albensis VL426]
 gi|229341067|gb|EEO06072.1| flagellar P-ring protein FlgI [Vibrio cholerae TM 11079-80]
 gi|229349018|gb|EEO13975.1| flagellar P-ring protein FlgI [Vibrio cholerae TMA 21]
 gi|262032424|gb|EEY50986.1| flagellar P-ring protein FlgI [Vibrio cholerae CT 5369-93]
 gi|297534665|gb|EFH73501.1| flagellar P-ring protein FlgI [Vibrio cholerae RC385]
 gi|327484712|gb|AEA79119.1| Flagellar P-ring protein FlgI [Vibrio cholerae LMA3894-4]
          Length = 361

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 150/356 (42%), Positives = 217/356 (60%), Gaps = 13/356 (3%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
            S+   +RIKDV  +   R+NQL+GYGLV GL GTG+S   +PFT+QS  ++LQ+ GI  
Sbjct: 13  ASSAQAARIKDVAQVAGVRNNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQSFGIQL 69

Query: 78  PGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
           P G +  +KNVAAV+VTA+LP F+  G  ID++++S+G A SLRGG L+ T L G DG +
Sbjct: 70  PPGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQTFLKGLDGQV 129

Query: 137 YAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           YAVAQG++VVSG        S  +    T G I +GAIVERE+P  F     +   L   
Sbjct: 130 YAVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYITFNLFES 189

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET-D 253
           DF+TA R+AD +N +        +A A D+ ++KV  P +       +S +E L     D
Sbjct: 190 DFTTAQRLADAVNQF----LGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPAD 245

Query: 254 TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
           + A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA    G TV   NT
Sbjct: 246 SAAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLSVSQPNAL-GGGQTVVVPNT 304

Query: 314 DLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 305 EIEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLII 360


>gi|30248326|ref|NP_840396.1| flagellar basal body P-ring protein [Nitrosomonas europaea ATCC
           19718]
 gi|81584780|sp|Q82XG5|FLGI_NITEU RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|30138212|emb|CAD84220.1| Flagellar P-ring protein [Nitrosomonas europaea ATCC 19718]
          Length = 370

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 151/369 (40%), Positives = 213/369 (57%), Gaps = 8/369 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           +        + L         RIKD+ ++Q  R NQLIGYGLVVGL GTGD  + +PFT 
Sbjct: 5   KWILSFGLSVCLIVSHPVSAERIKDLANIQGVRANQLIGYGLVVGLDGTGDQTQQTPFTV 64

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS+ S+L  LG++ P G  L  +NVA+VMVTA LP FA PG +IDV+++S+G+A SLRGG
Sbjct: 65  QSILSMLGQLGVNLPPGTNLQLRNVASVMVTATLPAFAKPGQQIDVTVSSMGNAKSLRGG 124

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L G D  +YAVAQGS+V+ G       SS        G+I  GAIVER +P   
Sbjct: 125 TLLMTPLKGIDNQVYAVAQGSLVIGGAGASSAGSSVQINHLGAGRISAGAIVERAVPTVL 184

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRL 241
                + L+LR+ DF+TA RI D INS    RFS   A A D R +++  P  N      
Sbjct: 185 GQGEYINLELRDTDFTTARRIVDTINS----RFSYGTATALDGRVIQLRAPLNNNQRVTF 240

Query: 242 MSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           +S++E L V      A+VIIN RTG++V+   V +    V++GNL+V I     V QP  
Sbjct: 241 ISQIEDLDVIPAQGIAKVIINARTGSVVMNQMVTLESSAVAHGNLSVIINTQPIVSQPGP 300

Query: 301 FSSNGSTVTQNNTDLKV-SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           F+  G TV    + ++V S+      L  +  L  ++  +N+IG     +++ILQ +KA+
Sbjct: 301 FAQRGETVVVPQSQIEVRSEEGNLMLLPGSASLADVVKALNAIGATPQDLLAILQALKAS 360

Query: 360 GALQSEIII 368
           G+L++E+ I
Sbjct: 361 GSLRAELEI 369


>gi|238782796|ref|ZP_04626825.1| Flagellar P-ring protein [Yersinia bercovieri ATCC 43970]
 gi|238716219|gb|EEQ08202.1| Flagellar P-ring protein [Yersinia bercovieri ATCC 43970]
          Length = 373

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 149/368 (40%), Positives = 225/368 (61%), Gaps = 8/368 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
               L F+ +           RI+D+ +LQ  R N L+GYGLVVGL GTGD    +PFT 
Sbjct: 8   LCLSLFFTGLIFLVPQDAQAERIRDLTTLQGVRSNSLMGYGLVVGLDGTGDQTMQTPFTT 67

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS+ ++L  LGI+ P G  +  +NVAAVMVTA LPPF+ PG +IDV ++SLG+A SLRGG
Sbjct: 68  QSLSNMLSQLGITVPPGTNMQLRNVAAVMVTAELPPFSRPGEKIDVVVSSLGNAKSLRGG 127

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L G D  IYA+AQG+++VSG   +   +        G +I  GA VERE+P  F
Sbjct: 128 TLLMTPLKGVDNQIYALAQGNLLVSGAGAQSGGNRVQVNQLNGARISGGASVEREVPVSF 187

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRL 241
            +   L LQL   DFS A +++D IN     R    +A A DSRT+K++ PT+     R 
Sbjct: 188 ANENILRLQLNEDDFSVAQKMSDAIN----RRLGGGVAMAEDSRTIKLNAPTDSAAKVRF 243

Query: 242 MSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           ++EV+ + ++ D   A+VIIN RTG++V+  +V +    V+ G+LTV++++  +V QPN 
Sbjct: 244 LAEVQDIPIQIDIMDAKVIINSRTGSVVMNRHVVLDACAVAQGDLTVEVSQTNEVSQPNT 303

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
             + G TV   NT++ + +  G    +  + DLN++I  +N++G   + ++SILQ +K+A
Sbjct: 304 PLAGGQTVVTPNTEISIREQNGYLQRVNTSADLNNVIRALNNLGATPNDLMSILQSMKSA 363

Query: 360 GALQSEII 367
           G L++++ 
Sbjct: 364 GCLRAKLE 371


>gi|126738560|ref|ZP_01754265.1| flagellar P-ring protein precursor I [Roseobacter sp. SK209-2-6]
 gi|126720359|gb|EBA17065.1| flagellar P-ring protein precursor I [Roseobacter sp. SK209-2-6]
          Length = 367

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 150/372 (40%), Positives = 225/372 (60%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R+   +   + L  +      R+KD+V     R N L+GYGLVVGL GTGD LR+SPF
Sbjct: 1   MTRLIKYLIVFLFLPIMVQANAIRLKDLVEFDGVRGNDLVGYGLVVGLDGTGDGLRNSPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE  M ++L+ LG++  G +   KNVAAV VTA LPPFA  G  IDV+++++GD+ SL G
Sbjct: 61  TEDIMSNILERLGVNVTGEQFRPKNVAAVFVTATLPPFARVGGNIDVTVSAIGDSKSLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L  ADG IYAVAQG+++  G   +G+ +S  +G+ T G I +G  VERE+   
Sbjct: 121 GTLIMTPLNAADGQIYAVAQGTILAGGAVAEGEGASVTQGVPTAGVIPSGGRVEREIDFD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNIDLT 239
               + + L LR PDF+TA RI   +N      F R +A   DS TV++      +    
Sbjct: 181 LSSLSTMRLALREPDFTTAGRIERAVN----REFGRNVALMQDSGTVRIDIGGTNSRSTA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             +  +E + VE    ARV++++R+GTIV+G +VRIS+V V+ GNLT++I E   V QPN
Sbjct: 237 HAIGRIENILVEPQRKARVVVDQRSGTIVMGSDVRISRVAVAQGNLTLRIEEAPLVAQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKG--SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F ++GSTV    T   + +  G     + +   L+ +++G+N++G+    +I IL+ +K
Sbjct: 297 PF-ADGSTVVVPRTTAAIDEEPGIQLAEVPETTSLSEVVAGLNALGVSPRDMIDILKSLK 355

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E +++
Sbjct: 356 AAGALHAEFVVR 367


>gi|15642192|ref|NP_231824.1| flagellar basal body P-ring protein [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121586253|ref|ZP_01676043.1| flagellar P-ring protein FlgI [Vibrio cholerae 2740-80]
 gi|121726533|ref|ZP_01679782.1| flagellar P-ring protein FlgI [Vibrio cholerae V52]
 gi|147674065|ref|YP_001217710.1| flagellar basal body P-ring protein [Vibrio cholerae O395]
 gi|153817090|ref|ZP_01969757.1| flagellar P-ring protein FlgI [Vibrio cholerae NCTC 8457]
 gi|153820873|ref|ZP_01973540.1| flagellar P-ring protein FlgI [Vibrio cholerae B33]
 gi|227082317|ref|YP_002810868.1| flagellar P-ring protein FlgI [Vibrio cholerae M66-2]
 gi|229507730|ref|ZP_04397235.1| flagellar P-ring protein FlgI [Vibrio cholerae BX 330286]
 gi|229512075|ref|ZP_04401554.1| flagellar P-ring protein FlgI [Vibrio cholerae B33]
 gi|229519211|ref|ZP_04408654.1| flagellar P-ring protein FlgI [Vibrio cholerae RC9]
 gi|229607234|ref|YP_002877882.1| flagellar basal body P-ring protein [Vibrio cholerae MJ-1236]
 gi|254849322|ref|ZP_05238672.1| flagellar P-ring protein precursor [Vibrio cholerae MO10]
 gi|255747108|ref|ZP_05421053.1| flagellar P-ring protein FlgI [Vibrio cholera CIRS 101]
 gi|262161348|ref|ZP_06030458.1| flagellar P-ring protein FlgI [Vibrio cholerae INDRE 91/1]
 gi|262167781|ref|ZP_06035483.1| flagellar P-ring protein FlgI [Vibrio cholerae RC27]
 gi|298500429|ref|ZP_07010234.1| flagellar P-ring protein FlgI [Vibrio cholerae MAK 757]
 gi|14548044|sp|Q9KQ14|FLGI_VIBCH RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|172047625|sp|A5F677|FLGI_VIBC3 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|254789299|sp|C3LPJ7|FLGI_VIBCM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|9656749|gb|AAF95338.1| flagellar P-ring protein FlgI [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121549519|gb|EAX59545.1| flagellar P-ring protein FlgI [Vibrio cholerae 2740-80]
 gi|121630986|gb|EAX63365.1| flagellar P-ring protein FlgI [Vibrio cholerae V52]
 gi|126512358|gb|EAZ74952.1| flagellar P-ring protein FlgI [Vibrio cholerae NCTC 8457]
 gi|126521665|gb|EAZ78888.1| flagellar P-ring protein FlgI [Vibrio cholerae B33]
 gi|146315948|gb|ABQ20487.1| flagellar P-ring protein FlgI [Vibrio cholerae O395]
 gi|227010205|gb|ACP06417.1| flagellar P-ring protein FlgI [Vibrio cholerae M66-2]
 gi|227014089|gb|ACP10299.1| flagellar P-ring protein FlgI [Vibrio cholerae O395]
 gi|229343900|gb|EEO08875.1| flagellar P-ring protein FlgI [Vibrio cholerae RC9]
 gi|229352040|gb|EEO16981.1| flagellar P-ring protein FlgI [Vibrio cholerae B33]
 gi|229355235|gb|EEO20156.1| flagellar P-ring protein FlgI [Vibrio cholerae BX 330286]
 gi|229369889|gb|ACQ60312.1| flagellar P-ring protein FlgI [Vibrio cholerae MJ-1236]
 gi|254845027|gb|EET23441.1| flagellar P-ring protein precursor [Vibrio cholerae MO10]
 gi|255735510|gb|EET90910.1| flagellar P-ring protein FlgI [Vibrio cholera CIRS 101]
 gi|262023846|gb|EEY42545.1| flagellar P-ring protein FlgI [Vibrio cholerae RC27]
 gi|262028659|gb|EEY47313.1| flagellar P-ring protein FlgI [Vibrio cholerae INDRE 91/1]
 gi|297541122|gb|EFH77176.1| flagellar P-ring protein FlgI [Vibrio cholerae MAK 757]
          Length = 361

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 150/356 (42%), Positives = 217/356 (60%), Gaps = 13/356 (3%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
            S+   +RIKDV  +   R+NQL+GYGLV GL GTG+S   +PFT+QS  ++LQ+ GI  
Sbjct: 13  ASSAQAARIKDVAQVAGVRNNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQSFGIQL 69

Query: 78  PGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
           P G +  +KNVAAV+VTA+LP F+  G  ID++++S+G A SLRGG L+ T L G DG +
Sbjct: 70  PPGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQTFLKGLDGQV 129

Query: 137 YAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           YAVAQG++VVSG        S  +    T G I +GAIVERE+P  F     +   L   
Sbjct: 130 YAVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYITFNLFES 189

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET-D 253
           DF+TA R+AD +N +        +A A D+ ++KV  P +       +S +E L     D
Sbjct: 190 DFTTAQRLADAVNQF----LGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPAD 245

Query: 254 TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
           + A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA    G TV   NT
Sbjct: 246 SAAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNAL-GGGQTVVVPNT 304

Query: 314 DLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 305 EIEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLII 360


>gi|258621053|ref|ZP_05716087.1| flagellar P-ring protein FlgI [Vibrio mimicus VM573]
 gi|258625281|ref|ZP_05720189.1| flagellar P-ring protein FlgI [Vibrio mimicus VM603]
 gi|258582454|gb|EEW07295.1| flagellar P-ring protein FlgI [Vibrio mimicus VM603]
 gi|258586441|gb|EEW11156.1| flagellar P-ring protein FlgI [Vibrio mimicus VM573]
          Length = 361

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 150/356 (42%), Positives = 216/356 (60%), Gaps = 13/356 (3%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
            S+   +RIKDV  +   R+NQL+GYGLV GL GTG+S   +PFT+QS  ++LQN GI  
Sbjct: 13  ASSAQAARIKDVAQVAGVRNNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQNFGIQL 69

Query: 78  PGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
           P G +  +KNVAAV+VTA+LP F+  G  IDV+++S+G A SLRGG L+ T L G DG +
Sbjct: 70  PPGTKPKTKNVAAVIVTADLPAFSKQGQTIDVTVSSIGSAKSLRGGTLMQTFLKGLDGQV 129

Query: 137 YAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           YAVAQG++VVSG        S  +    T G I +GAIVERE+P  F     +   L   
Sbjct: 130 YAVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYITFNLFES 189

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET-D 253
           DF+TA R+AD +N +        +A A D+ ++KV  P +       +S +E L     D
Sbjct: 190 DFTTAQRLADAVNQF----LGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPAD 245

Query: 254 TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
           + A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA    G TV   ++
Sbjct: 246 SAAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNAL-GGGQTVVTPDS 304

Query: 314 DLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            ++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 305 SIEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLII 360


>gi|77918757|ref|YP_356572.1| flagellar basal body P-ring protein [Pelobacter carbinolicus DSM
           2380]
 gi|115311527|sp|Q3A5F5|FLGI_PELCD RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|77544840|gb|ABA88402.1| P-ring of flagella basal body-like protein [Pelobacter carbinolicus
           DSM 2380]
          Length = 367

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 152/355 (42%), Positives = 230/355 (64%), Gaps = 9/355 (2%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
                  +RIKD+  LQ  R NQL+GYGLVVGL G+GDS  S+ FT +S+ ++++ LG++
Sbjct: 18  AAGPAGATRIKDIARLQGVRSNQLVGYGLVVGLNGSGDSD-STAFTVRSLVNMMERLGVT 76

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
                +   NVAAV+VTA LP F+  GS IDV ++S+GDA SL GG L+MT L GADG I
Sbjct: 77  VDVNDVKVDNVAAVIVTAELPAFSKTGSTIDVLVSSIGDADSLVGGSLLMTPLKGADGKI 136

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAVAQG + V  L   G++++  +   T G+I  GA+VERE+P +    A+L  QL NPD
Sbjct: 137 YAVAQGPLAVGALAFGGKAATVQKNHPTVGRIPGGALVEREVPFRLTPGAELHYQLTNPD 196

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN--IDLTRLMSEVEMLTVETDT 254
           F+T  R+A  IN      F + +A A DS ++K++ P +   +    ++++E L +  D+
Sbjct: 197 FTTVTRMAQAINK----HFQKTLARAEDSGSLKITIPEDQQNEPIHFIADLESLNIRPDS 252

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            AR+++NE+TGTIV+G++VRI+ V VS+GNL + I+EN+QV QP  F S G TV   +T 
Sbjct: 253 MARIVVNEKTGTIVMGEDVRIATVAVSHGNLNLIISENDQVSQPLPF-SEGETVVVPDTS 311

Query: 315 LKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++VS++ G+  +++    +  +   +N+IG     +I+I Q IKAAGAL +E+++
Sbjct: 312 MEVSEDNGNLVVMEMGVSIGDVARALNAIGATPRDLIAIFQAIKAAGALHAELVV 366


>gi|2920802|gb|AAC33161.1| FlgI [Vibrio cholerae]
          Length = 361

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 150/356 (42%), Positives = 217/356 (60%), Gaps = 13/356 (3%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
            S+   +RIKDV  +   R+NQL+GYGLV GL GTG+S   +PFT+QS  ++LQ+ GI  
Sbjct: 13  ASSAQAARIKDVAQVAGVRNNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQSFGIQL 69

Query: 78  PGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
           P G +  +KNVAAV+VTA+LP F+  G  ID++++S+G A SLRGG L+ T L G DG +
Sbjct: 70  PPGTKPKTKNVAAVIVTADLPAFSKQGQTIDITVSSIGSAKSLRGGTLMQTFLKGLDGQV 129

Query: 137 YAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           YAVAQG++VVSG        S  +    T G I +GAIVERE+P  F     +   L   
Sbjct: 130 YAVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFARGDYITFNLFES 189

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET-D 253
           DF+TA R+AD +N +        +A A D+ ++KV  P +       +S +E L     D
Sbjct: 190 DFTTAQRLADAVNQF----LGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPAD 245

Query: 254 TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
           + A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA    G TV   NT
Sbjct: 246 SAAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNAL-GGGQTVVVPNT 304

Query: 314 DLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 305 EIEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLII 360


>gi|84388095|ref|ZP_00990991.1| flagellar P-ring protein precursor [Vibrio splendidus 12B01]
 gi|84377162|gb|EAP94032.1| flagellar P-ring protein precursor [Vibrio splendidus 12B01]
          Length = 363

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 145/372 (38%), Positives = 224/372 (60%), Gaps = 15/372 (4%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++  ++F ++ L   ++   +RIKDV  +   R NQL+GYGLV GL GTG+   ++PF
Sbjct: 1   MKKLTLVLFGMLFL--ATSAHAARIKDVAKVAGVRSNQLVGYGLVSGLPGTGE---TTPF 55

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T+Q+  ++LQN GI  P G +  +KNVAAV+VTA LP F+  G  +DV+++S+G A SLR
Sbjct: 56  TDQTFNAMLQNFGIQLPPGTKPKTKNVAAVIVTAELPAFSKQGQEVDVTVSSIGSAKSLR 115

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+ T L G DG +YAVAQG++VVSG   +G   S  +      G I +GA VE+E+P
Sbjct: 116 GGTLLQTFLKGLDGQVYAVAQGNLVVSGFSAQGNDGSKIVGNNPNVGIISSGATVEQEIP 175

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     +   L   DF+TA R+AD +N++        +A A D+ +VKV  P  I   
Sbjct: 176 TPFGRGDYITFNLIQSDFTTAQRLADAVNNF----LGPQMASAVDATSVKVRAPREISQR 231

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S +E +  +     A++I+N RTGTIV+G +VR+    V++G +TV I EN  V Q
Sbjct: 232 VAFLSAIENIEFDPAEGSAKIIVNSRTGTIVVGKHVRLRAAAVTHGGMTVAIKENLNVSQ 291

Query: 298 PNAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF S G TV   ++D+++++ +   F       L+ L+  +N +G     +++ILQ +
Sbjct: 292 PNAF-SGGQTVVVPDSDIEITEGDGKMFKFEPGLTLDDLVRAVNEVGAAPSDLMAILQAL 350

Query: 357 KAAGALQSEIII 368
           K AGA++ ++II
Sbjct: 351 KQAGAIEGQLII 362


>gi|90408063|ref|ZP_01216234.1| flagellar P-ring protein precursor [Psychromonas sp. CNPT3]
 gi|90310820|gb|EAS38934.1| flagellar P-ring protein precursor [Psychromonas sp. CNPT3]
          Length = 366

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 154/371 (41%), Positives = 225/371 (60%), Gaps = 10/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +  +  ++ + + L    A   +RIKD+ S+Q  R NQL+GYGLVVGL GTG+  +SS F
Sbjct: 1   MKCLTQVVIAFLLLIFSGASYSARIKDIASVQGVRSNQLVGYGLVVGLPGTGE--KSSKF 58

Query: 62  TEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           TEQ+  ++L+N GI+ P G +L  KNVA V +TA L  FA  G +ID++++++G+A SLR
Sbjct: 59  TEQAFATMLRNFGINIPIGEKLKIKNVAPVAITAELKAFAKRGQKIDITVSAIGEAKSLR 118

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+ T L G DGN+YA+AQGSVVV GL  +G   S  +    T G+I NGAIVERE+ 
Sbjct: 119 GGELLQTFLKGVDGNVYAIAQGSVVVGGLGAEGADGSKVVINTPTVGRIANGAIVEREVV 178

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     +   L   DF+TA R+AD IN+          A   D+ +V+V  P NI   
Sbjct: 179 SPFSHGDTITFNLHESDFTTAKRMADTINNLV----GANTATLLDATSVRVLAPRNISQR 234

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              MS +E L  E     A++I+N RTGTIVIG +V++    +++G ++V I+EN+ V Q
Sbjct: 235 VSYMSTLENLEFEPARGAAKIIVNSRTGTIVIGQDVKLLPTAITHGGISVTISENKTVTQ 294

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           PNA +   + VT N+T    +++   F+      LN L+  +N +GL    +++IL+ +K
Sbjct: 295 PNALAGGKTKVTDNSTITITNEDSRMFTFDTGVSLNDLVRAVNQVGLAPGDLMAILEALK 354

Query: 358 AAGALQSEIII 368
            AGALQ E+II
Sbjct: 355 QAGALQGELII 365


>gi|283850810|ref|ZP_06368096.1| flagellar P-ring protein [Desulfovibrio sp. FW1012B]
 gi|283573733|gb|EFC21707.1| flagellar P-ring protein [Desulfovibrio sp. FW1012B]
          Length = 386

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 159/370 (42%), Positives = 236/370 (63%), Gaps = 8/370 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +IF  + L+ + I          +RIKD+ S+   R NQL+GYGLVVGL GTGD  R S 
Sbjct: 22  VIFLTSLLVLAAILFCLARPAHGARIKDIASVSGMRKNQLVGYGLVVGLSGTGDQ-RGSD 80

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FT QS+ ++L  +G+      L  KNVAAVMVTA +P  A PGSRIDV+++SLGD++SL 
Sbjct: 81  FTVQSIFNMLDKMGVRVDRATLKPKNVAAVMVTAQMPVSAKPGSRIDVTVSSLGDSTSLL 140

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG+L++T L G DGNIYA+AQGSV+V G+  +G  +S  + I+T G +  GA VER +  
Sbjct: 141 GGVLLVTPLKGVDGNIYAIAQGSVLVGGVSAQGAGASVSKNITTVGILPGGANVERAVAF 200

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN--IDL 238
            F D  DL L LRNPDFSTA R+A ++N          +A A D+ T++++       +L
Sbjct: 201 SFNDQTDLTLSLRNPDFSTATRVAKRVNE----TMGAAMATAVDAGTIRLAVAPENQGNL 256

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           T LM+ +E + V  D+ ARV+++E+TGT+V+G NV+IS V V++GNL +Q+ E+  V QP
Sbjct: 257 TPLMAAIENIEVTPDSRARVVVDEKTGTVVLGQNVQISPVAVTHGNLQIQVQESADVSQP 316

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
             F S G TV    T++ V++      +I+   L  L+ G+N++G     +ISIL+ +++
Sbjct: 317 LPF-SGGQTVVTPQTNIGVNEENRKLKMIEGATLQELVEGLNALGATPRDLISILRTLES 375

Query: 359 AGALQSEIII 368
           +GAL +++ +
Sbjct: 376 SGALAADLEV 385


>gi|307945671|ref|ZP_07661007.1| flagellar P-ring protein FlgI [Roseibium sp. TrichSKD4]
 gi|307771544|gb|EFO30769.1| flagellar P-ring protein FlgI [Roseibium sp. TrichSKD4]
          Length = 390

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 165/370 (44%), Positives = 237/370 (64%), Gaps = 9/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           F    ++          A   SRIKD+   +  R+NQLIGYGLVVGL GTGD+LR++PFT
Sbjct: 25  FLKVAILACATLYITAPAHSASRIKDIADFEGIRENQLIGYGLVVGLNGTGDTLRNAPFT 84

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
            QS++++L+ LG++T G  L +  VAAVMVTANLPPFA+ G+RIDV++++LG++ SL+GG
Sbjct: 85  RQSLQAMLERLGVNTRGVDLNTNTVAAVMVTANLPPFATQGTRIDVNVSALGNSGSLQGG 144

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L++T L+ ADG +YA+AQGSV + G   +  ++S   G+ T G+I NGA+VERE+  K 
Sbjct: 145 TLLVTPLVAADGEVYAIAQGSVAIGGFAAQADAASVTRGVPTSGRIANGALVEREVEFKL 204

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTR 240
                L L LRNPD +TA R+A  IN         P AE  D  TV++  P     ++  
Sbjct: 205 ASLTTLRLALRNPDLTTARRVALSINELI----GFPTAEPLDPGTVRIDLPREFSGNIVD 260

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           L++++E L V+ D  ARV+I+E +G IV+G  V++S V V+ GNLTV I E  +VVQP  
Sbjct: 261 LLTDIEQLIVQPDMIARVVIDENSGIIVMGQEVKVSTVAVAQGNLTVTIAETPEVVQPLP 320

Query: 301 FSSNGSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           F +NG T     ++L V+D+       + D   L  L+ G+N++G+    +ISILQ IKA
Sbjct: 321 F-ANGETAVVPRSELLVNDDPDAKLAIVPDTVTLKQLVDGLNALGIGPRDMISILQAIKA 379

Query: 359 AGALQSEIII 368
           +GALQ+EI +
Sbjct: 380 SGALQAEIEV 389


>gi|90411009|ref|ZP_01219023.1| flagellar P-ring protein precursor [Photobacterium profundum 3TCK]
 gi|90328222|gb|EAS44533.1| flagellar P-ring protein precursor [Photobacterium profundum 3TCK]
          Length = 363

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/349 (41%), Positives = 210/349 (60%), Gaps = 13/349 (3%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           RIKD+  +   R NQL+GYGLVVGL GTG+   ++PFT+QS  ++LQN GI  P G +  
Sbjct: 22  RIKDISEVAGVRSNQLVGYGLVVGLPGTGE---TTPFTDQSFNAMLQNFGIQLPAGTKPK 78

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KNVAAV V A LP F   G  ID++++S+G A SLRGG L+ T L G DG +YAVAQGS
Sbjct: 79  TKNVAAVAVNATLPAFTKQGQSIDITVSSIGSAKSLRGGTLLQTFLKGLDGKVYAVAQGS 138

Query: 144 VVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VV G  V     S  +  I T G+I NGA+VE+E+P  F     L   L   DFSTA R
Sbjct: 139 LVVGGFSVTGADGSKLVGNIPTVGRISNGAMVEQEVPNPFGRGDFLTFNLFESDFSTAQR 198

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDT-PARVII 260
           +AD +N +        +A A D+ +V+V  P ++      ++ VE +  +     A++I+
Sbjct: 199 MADSVNEF----LGPQMAAAIDATSVRVRAPRDVSQRVAFLATVENIEFDPAVGAAKIIV 254

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD- 319
           N RTGTIVIG NV++    +++G +TV I EN QV QP  F S G TV   N+++ V++ 
Sbjct: 255 NSRTGTIVIGQNVKLKPAAITHGGMTVSIKENYQVSQPAPF-SGGETVVVPNSEIDVTEK 313

Query: 320 NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +   F       L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 314 DSRMFKFEPGITLDELVRAVNQVGAAPSDLMAILQALKQAGAIEGQLII 362


>gi|190574259|ref|YP_001972104.1| flagellar basal body P-ring protein [Stenotrophomonas maltophilia
           K279a]
 gi|190012181|emb|CAQ45804.1| putative flagellar P-ring protein precuror [Stenotrophomonas
           maltophilia K279a]
          Length = 380

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 141/367 (38%), Positives = 209/367 (56%), Gaps = 8/367 (2%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           +      +    ++     RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS
Sbjct: 17  SLYCGVFLVFAVVAPASAERIKDLAQIGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQS 76

Query: 66  MRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           +++LL  LG++ P       KNVAAV + A LPPFA PG  ID++++S+G+A S+RGG L
Sbjct: 77  LKNLLGELGVNVPPNVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIGNAVSMRGGSL 136

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           +M  L GADG IYA+AQG+++V G   +G   S     + + G+I NGA VER LP    
Sbjct: 137 LMAPLRGADGQIYAIAQGNLIVGGFGAQGKDGSRVSVNVPSVGRIPNGATVERALPDPLA 196

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLM 242
           +  ++ L L N DF+T  R+   +N    N F    A A D  TV V+ PT+      L+
Sbjct: 197 NGGEITLNLHNNDFTTVSRMVAALN----NAFGEGAARAVDGVTVAVTAPTDPGARIGLL 252

Query: 243 SEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           + +E L +     PA+V++N RTGT+VIG  VR+    +S+G+LTV I EN  V QPNA 
Sbjct: 253 ARIENLELTPGSAPAKVVVNSRTGTVVIGQQVRVGPAAISHGSLTVTIQENTNVSQPNAL 312

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S   +  +  +T    +D    F       L+ ++  +N++G     +I+IL+ +K AGA
Sbjct: 313 SGGRTVASPQSTITATNDGSRMFKFSGGTTLDEIVHAVNAVGAAPGDLIAILEALKQAGA 372

Query: 362 LQSEIII 368
           L +E+ +
Sbjct: 373 LSAELEV 379


>gi|85706145|ref|ZP_01037240.1| flagellar P-ring protein precursor [Roseovarius sp. 217]
 gi|85669309|gb|EAQ24175.1| flagellar P-ring protein precursor [Roseovarius sp. 217]
          Length = 370

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 157/370 (42%), Positives = 223/370 (60%), Gaps = 9/370 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
            I  ++  +            RIKD+V     R N L+GYGLVVGL GTGD LR++PFTE
Sbjct: 6   LILCIVLGVAAFAGSVDASPIRIKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNAPFTE 65

Query: 64  QSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           + M ++L+ LGI+  G +   KNVAAV VTA LPPFA  G +IDV+++++GDA SL GG 
Sbjct: 66  EIMSNILERLGINVSGEQFRPKNVAAVFVTAELPPFARAGGQIDVTVSAIGDAKSLLGGT 125

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           LVMT L  ADG IYAVAQG+++  G   +G++   ++G+ T G I +GA VERE+   F 
Sbjct: 126 LVMTPLNAADGQIYAVAQGTIIAGGFSAEGEAGGVVQGVPTAGVIPSGARVEREIDFDFT 185

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVK--VSKPTNIDLTRL 241
               + L LR PDF+TA RI   IN        R  A   DS TV+  +S+         
Sbjct: 186 TIETIRLALREPDFTTAARIESAIN----GTIGRDAAIMLDSGTVRLTLSRMRAASPAHA 241

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           + ++E + VE +  ARV++++R+GTIV+G +VRIS+V VS GNLT+++ E   VVQPN F
Sbjct: 242 LGQIENILVEPERKARVVVDQRSGTIVMGQDVRISRVAVSQGNLTLRVQETPLVVQPNPF 301

Query: 302 SSNGSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           +  G TV    T  +       G   L     L+ +I+G+N++G+    +I IL+ IKAA
Sbjct: 302 AQ-GETVVVPRTQAEFEKEPGIGMAELEPGTSLSDVIAGLNALGVAPRDMIDILKSIKAA 360

Query: 360 GALQSEIIIQ 369
           GAL +E +++
Sbjct: 361 GALHAEFVVR 370


>gi|56695118|ref|YP_165465.1| flagellar basal body P-ring protein [Ruegeria pomeroyi DSS-3]
 gi|62286715|sp|Q5LWZ2|FLGI_SILPO RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|56676855|gb|AAV93521.1| flagellar P-ring protein FlgI [Ruegeria pomeroyi DSS-3]
          Length = 366

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 153/371 (41%), Positives = 232/371 (62%), Gaps = 9/371 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             +  L+  L+ L  ++     R+KD+V     R N L+GYGLVVGL GTGD LR++PFT
Sbjct: 1   MTLIRLLACLLFLPCLAQAGAVRLKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNAPFT 60

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           E+ M ++L+ LG++  G     KNVAAV VTA LPPFA  GS+ID++++++GD+ SL GG
Sbjct: 61  EEIMSNILERLGVNVTGEDFRPKNVAAVFVTAALPPFARVGSQIDITVSAIGDSKSLLGG 120

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L  ADG IYAVAQG+V+  G   +GQ++S ++G+ T G I  GA VERE+    
Sbjct: 121 TLIMTPLNAADGQIYAVAQGTVLAGGASAEGQAASVVQGVPTSGVIPAGARVEREIEFDL 180

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTV--KVSKPTNIDLTR 240
                L L LR PDF+TA RI   +NS     F+  +A   DS TV   ++         
Sbjct: 181 GSLTQLRLALREPDFTTAGRIETAVNSA----FNGRVAVMRDSGTVELDIAATQARSPAH 236

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           ++  +E + VE +  ARV++++R+GTIV+G +VRIS+V VS G+LT+++ E    VQPN 
Sbjct: 237 VIGRIENILVEPERKARVVVDQRSGTIVMGADVRISRVAVSQGSLTLRVEEAPIAVQPNP 296

Query: 301 FSSNGSTVTQNNTDLKVSDNKG--SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           F ++G TV    T+ ++    G     + ++  L+ +++G+N++G+    +I IL+ IKA
Sbjct: 297 F-ADGDTVVVPRTNAEIEQEPGIKLAEVPESASLSDVVAGLNALGVSPRDMIDILKTIKA 355

Query: 359 AGALQSEIIIQ 369
           AGAL +E +++
Sbjct: 356 AGALHAEFVVR 366


>gi|254225805|ref|ZP_04919410.1| flagellar P-ring protein FlgI [Vibrio cholerae V51]
 gi|125621711|gb|EAZ50040.1| flagellar P-ring protein FlgI [Vibrio cholerae V51]
          Length = 361

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 149/356 (41%), Positives = 216/356 (60%), Gaps = 13/356 (3%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
            S+   +RIKDV  +   R+NQL+GYGLV GL GTG+S   +PFT+QS  ++LQN GI  
Sbjct: 13  ASSAQAARIKDVAQVAGVRNNQLVGYGLVTGLPGTGES---TPFTDQSFNAMLQNFGIQL 69

Query: 78  PGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
           P G +  +KNVAAV+VTA+LP F+  G  IDV+++S+G A SLRGG L+ T + G DG +
Sbjct: 70  PPGTKPKTKNVAAVIVTADLPAFSKQGQTIDVTVSSIGSAKSLRGGTLMQTFMKGLDGQV 129

Query: 137 YAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           YAVAQG++VVSG        S  +    T G I +GAIVERE+P  F     +   L   
Sbjct: 130 YAVAQGNLVVSGFSATGADGSKIVGNNPTVGMISSGAIVEREVPNPFGRGDYITFNLFES 189

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET-D 253
           DF+TA R+AD +N +        +A A D+ ++KV  P +       +S +E L     D
Sbjct: 190 DFTTAQRLADAVNQF----LGPQMASAVDAASIKVRAPRDLSQRVAFLSAIENLEFNPAD 245

Query: 254 TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
           + A++I+N RTGTIV+G NVR+    V++G +TV I EN  V QPNA    G TV   ++
Sbjct: 246 SAAKIIVNSRTGTIVVGQNVRLKPAAVTHGGMTVAIKENLNVSQPNAL-GGGQTVVTPDS 304

Query: 314 DLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            ++V++ +G  F L     L+ L+  +N +G     +++ILQ +K AGA++ ++II
Sbjct: 305 SIEVTEKQGKMFKLEPGVTLDDLVRAVNEVGAAPSDLMAILQALKQAGAIEGQLII 360


>gi|77359726|ref|YP_339301.1| flagellar basal body P-ring protein [Pseudoalteromonas haloplanktis
           TAC125]
 gi|115311530|sp|Q3IDW0|FLGI_PSEHT RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|76874637|emb|CAI85858.1| flagellar P-ring protein precursor (Basal body P-ring protein)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 364

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 142/371 (38%), Positives = 210/371 (56%), Gaps = 13/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             +  +   ++ L      +  RIKDV  ++  R NQL+GYGLVVGL GTG+    S FT
Sbjct: 1   MNVFKVFCLMVLLGWQLPAMAERIKDVSMVEGVRSNQLVGYGLVVGLPGTGE---QSRFT 57

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQS + +L + GI+ P   +   KNVAAV V A LPPF  PG  ID++++S+G A SLRG
Sbjct: 58  EQSFKGMLNSFGITLPASLKPKIKNVAAVAVHAELPPFRKPGQTIDITVSSIGSAGSLRG 117

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DGN+YA+ QGS++V GL  +G   S  +    T G+I NGA VER +  
Sbjct: 118 GTLLQTFLKGVDGNVYAIGQGSLIVGGLGAEGLDGSKVVINTPTVGRIPNGATVERAVKS 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F  +  +   L  PDF+TA R+   IN           A+A D+ +++V  P +     
Sbjct: 178 PFMQNDYITFNLNRPDFTTAKRLEKTINDLV----GPNSAQALDAASIRVIAPRDASQRV 233

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L     DT A++I+N RTGTIVIG NV++    +++G LTV I E   V QP
Sbjct: 234 SYLSTLENLEFTPADTAAKIIVNSRTGTIVIGKNVKLQPAAITHGGLTVTIAEQLNVSQP 293

Query: 299 NAFSSNGSTVTQNNTDLKV-SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           NAF S+G TV    + + +  D+  +F       L+ L+  +N +G     +++IL+ +K
Sbjct: 294 NAF-SDGDTVVTQQSIIDIKQDDSRAFVFNPGVSLDDLVRAINEVGAAPGDLMAILEALK 352

Query: 358 AAGALQSEIII 368
            AGA+  ++++
Sbjct: 353 EAGAINGQLVV 363


>gi|170725959|ref|YP_001759985.1| flagellar basal body P-ring protein [Shewanella woodyi ATCC 51908]
 gi|226701963|sp|B1KLG5|FLGI_SHEWM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|169811306|gb|ACA85890.1| flagellar P-ring protein [Shewanella woodyi ATCC 51908]
          Length = 363

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 148/352 (42%), Positives = 207/352 (58%), Gaps = 13/352 (3%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG- 80
              RIKD+ ++Q  R NQLIGYGLVVGL GTG+      +TEQ+ +++L+N GI+ P   
Sbjct: 19  QAQRIKDIANVQGVRSNQLIGYGLVVGLPGTGEKTT---YTEQTFKTMLKNFGINLPDNL 75

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
           R   KNVA V V A +P F  PG  +DV+++SLG+A SLRGG L+ T L G DGN+YA+A
Sbjct: 76  RPKIKNVAVVAVHAEMPAFIKPGQTLDVTVSSLGEAKSLRGGTLLQTFLKGVDGNVYAIA 135

Query: 141 QGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           QGS+VVSG   +G   S  ++   T G+I NG IVER +   F     L   LR  DFST
Sbjct: 136 QGSMVVSGFSAEGLDGSKVIQNTPTVGRIPNGGIVERTVTTPFSTGDHLTFNLRRADFST 195

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-AR 257
           A R+AD IN          +A   D+ +V+VS P ++      ++ +E + VE  +  A+
Sbjct: 196 AKRLADAINEL----LGPGMARPLDAASVQVSAPRDVSQRVSFLATLENIQVEPASESAK 251

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           VI+N RTGTIV+G  VR+    V++G LTV I E  QV QPN   + G TV   +T + V
Sbjct: 252 VIVNSRTGTIVVGREVRLLPAAVTHGGLTVTIAEATQVSQPNPL-AGGQTVVTADTTIDV 310

Query: 318 -SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             ++   F       L+ L+  +N +G     +++IL+ +K AGAL  E+II
Sbjct: 311 AEEDSRMFLFNPGTTLDELVRAVNLVGAAPSDVLAILEALKMAGALHGELII 362


>gi|170751918|ref|YP_001758178.1| flagellar basal body P-ring protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170658440|gb|ACB27495.1| flagellar P-ring protein [Methylobacterium radiotolerans JCM 2831]
          Length = 378

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 170/349 (48%), Positives = 240/349 (68%), Gaps = 9/349 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SR+KD+ S++  R NQL+GYG+VVGL GTGD+L + PFT+QS++++L+ LG++T G  + 
Sbjct: 34  SRVKDLASIEGVRQNQLVGYGIVVGLNGTGDTLNNIPFTKQSLQAMLERLGVNTRGATMR 93

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           ++N+AAVMVTA+LPPFA+ G+RIDV+++SLGDA SL+GG L++T LLGADG +YA+AQGS
Sbjct: 94  TQNLAAVMVTASLPPFAAQGTRIDVTVSSLGDAKSLQGGTLLVTPLLGADGEVYALAQGS 153

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           V ++G   +G ++    G+ T G+I NGA +ERE+  K  D+  L L LRNPDF+T+ RI
Sbjct: 154 VAIAGFAAEGDAAKITRGVPTNGRISNGANIEREIAFKLNDARSLRLSLRNPDFTTSKRI 213

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPT--NIDLTRLMSEVEMLTVETDTPARVIIN 261
           A  IN +         AE  D  TV +  P   N ++ RL++EVE L VE D  ARV+++
Sbjct: 214 AAAINDF----MGADTAEPTDPATVTIQIPARYNGNMIRLITEVEQLKVEPDQTARVVVD 269

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS--D 319
           ER+G IV+G +VR+S V ++ GNLTV ITE  QV QP    SNG TV    T +KV   D
Sbjct: 270 ERSGIIVMGRDVRVSTVAIAQGNLTVTITEQPQVSQPAPL-SNGRTVVVPRTGVKVDTGD 328

Query: 320 NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
                 + +   L  L+ G+N++G+    +ISILQ IKAAGALQ++I +
Sbjct: 329 GNKLALVKEGVSLRELVDGLNALGVGPRDLISILQAIKAAGALQADIEL 377


>gi|261856356|ref|YP_003263639.1| flagellar P-ring protein [Halothiobacillus neapolitanus c2]
 gi|261836825|gb|ACX96592.1| flagellar P-ring protein [Halothiobacillus neapolitanus c2]
          Length = 372

 Score =  381 bits (979), Expect = e-104,   Method: Composition-based stats.
 Identities = 155/372 (41%), Positives = 225/372 (60%), Gaps = 9/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+  +  L+  +     ++ +   RIKD+ +    R+NQ+IGYGLVVGL GTGD     P
Sbjct: 5   MLIMLVGLLLPVTVAQAVTQEPAQRIKDLATFAGVRNNQIIGYGLVVGLPGTGDQTTQVP 64

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FT QS++++L   G+S   G +  KNVAAVMVT++LPPFA PG +IDV+++S+G+A SLR
Sbjct: 65  FTLQSIQNMLARQGLSPAAGNVQLKNVAAVMVTSSLPPFAKPGQQIDVTVSSIGNAKSLR 124

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELP 179
           GG L+MT L G DG IYAVAQGS++V GL V G   S     I T G+I NGA+VER + 
Sbjct: 125 GGELLMTPLKGVDGKIYAVAQGSLLVGGLDVSGKDGSRVTVNIPTAGRIPNGALVERSVA 184

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-L 238
                +  + L L  PDF+TA  +   IN          +AEA D  T++V  P + +  
Sbjct: 185 STMGGANSVYLDLNTPDFTTAKNMEKAINQM----LGGGVAEAVDGGTIRVRAPQDANAR 240

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              MS +E + V      A+V++N RTGT+VIG NVRI    VS+G+LTV + EN QV Q
Sbjct: 241 VGFMSVLEGIEVSPGEGAAKVVVNARTGTVVIGQNVRIEAAAVSHGDLTVTVKENAQVSQ 300

Query: 298 PNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P  F S G TV   N+ +   ++ K +F       LN ++  +N++G     +++IL+ +
Sbjct: 301 PAPF-SRGQTVVTPNSQVSAKEDKKRAFLFNPGVTLNDIVKAVNAVGASPSDLVAILEAL 359

Query: 357 KAAGALQSEIII 368
           K+AGAL++++I+
Sbjct: 360 KSAGALKAQLIV 371


>gi|85712258|ref|ZP_01043309.1| flagellar P-ring protein precursor [Idiomarina baltica OS145]
 gi|85693885|gb|EAQ31832.1| flagellar P-ring protein precursor [Idiomarina baltica OS145]
          Length = 366

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 152/372 (40%), Positives = 213/372 (57%), Gaps = 11/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M F    L+   I    +     SRIKD+ S+   R NQLIGYGLVVGL GTG+    +P
Sbjct: 1   MNFLKVMLLGLAIMGQLVLPVQASRIKDIASVAGIRSNQLIGYGLVVGLPGTGE---QTP 57

Query: 61  FTEQSMRSLLQNLGISTPGGR-LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+Q+ R++L N GI+ P G+     NVAAV V A +P FA PG +IDV+++S+G A SL
Sbjct: 58  FTDQTFRTMLGNFGINVPQGQRPKINNVAAVAVHAEIPAFAKPGQKIDVTVSSVGSADSL 117

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
            GG L+ T L GA+G +YAVAQGS++V GL  +G   S  +    T G+I  GAIVERE+
Sbjct: 118 TGGTLLQTFLKGANGEVYAVAQGSLIVGGLGAEGSDGSKIVINTPTVGRIPGGAIVEREI 177

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-ID 237
           P  F         L + DF+TA R+A+ IN          +A+A D+ +++V  P +   
Sbjct: 178 PTAFAQGDYFTFNLHDSDFTTAKRVANTINGLV----GEGMAQAIDATSIRVKAPRDLSQ 233

Query: 238 LTRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               MS +E L VE     A++IIN RTGTIV+G NV +    V++GN+ V ITE+ QV 
Sbjct: 234 RVSYMSTLENLQVEQAMAAAKIIINARTGTIVVGQNVELRPAAVAHGNMQVTITEDMQVD 293

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPN F    + VT  +      ++   F       LN L+  +N +G     II++L+ +
Sbjct: 294 QPNPFGQGDTAVTPQSVVDIQQEDARMFVFNPGTTLNDLVRAVNQVGAAPGDIIAVLEAL 353

Query: 357 KAAGALQSEIII 368
           K AGA+  E+I+
Sbjct: 354 KQAGAISGELIV 365


>gi|291280517|ref|YP_003497352.1| flagellar P-ring protein FlgI [Deferribacter desulfuricans SSM1]
 gi|290755219|dbj|BAI81596.1| flagellar P-ring protein FlgI [Deferribacter desulfuricans SSM1]
          Length = 362

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 148/365 (40%), Positives = 222/365 (60%), Gaps = 8/365 (2%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
             L F ++ +   ++    +IKD+  +   RDNQLIGYGLVVGL GTGD    + FT QS
Sbjct: 3   KLLSFLIVIIFAYNSYAYVKIKDIAQVNGIRDNQLIGYGLVVGLNGTGDKS-GTEFTIQS 61

Query: 66  MRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           + ++L  +GI+    ++  KNVAAVMVTA LPPFA  G+R+DV+++S+GDA SL GG L+
Sbjct: 62  LVNMLDRMGITVDKDKVKVKNVAAVMVTAKLPPFAKAGTRVDVTVSSIGDAKSLEGGTLL 121

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MT L G DG IYAVAQG + V G+ V       ++   T G+I NGA+VERE+P    D+
Sbjct: 122 MTPLSGPDGKIYAVAQGPLSVGGMNVSSGGGGTVKNHPTVGRIPNGALVEREIPYTL-DN 180

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMS 243
             + L       S  I+  + IN Y    F + IA A   +T+KV+ P +   +    + 
Sbjct: 181 NYITLAFERDSISDLIKAKNAINKY----FRQEIAFADSPKTIKVTIPDSYKNNFYDFLD 236

Query: 244 EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           +V  + ++ +  ++V+++ERTGTIV+G +VRIS V VS+GNLT++IT   ++ QPN+FS 
Sbjct: 237 KVLHIEIDPEPSSKVVVDERTGTIVMGSDVRISTVAVSHGNLTIKITNTVEISQPNSFSQ 296

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
             + VT N       ++     + +   ++ L+  +NS+G+    +I+ILQ IKAAGALQ
Sbjct: 297 GTTAVTANQNTEVKEEDAKLMVIPEGVRISDLVKALNSLGVSPRDLIAILQAIKAAGALQ 356

Query: 364 SEIII 368
            E+ +
Sbjct: 357 GELEV 361


>gi|220905266|ref|YP_002480578.1| flagellar basal body P-ring protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|254789291|sp|B8J2Y1|FLGI_DESDA RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|219869565|gb|ACL49900.1| flagellar P-ring protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 370

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 151/366 (41%), Positives = 226/366 (61%), Gaps = 8/366 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           + ++  + + L  +      RIKD+ S    RDNQLIGYGLVVGL GTGD  + + FT  
Sbjct: 10  VLWIFTAALLLSMVLPAQAVRIKDIASFSGVRDNQLIGYGLVVGLAGTGDK-KDAVFTLS 68

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           SM++++  +GI      L +KNVA+VMVTA +P  A PG+R+DV+++S+GDA+SL GG+L
Sbjct: 69  SMKNMMDRMGIGVDSSALKTKNVASVMVTARMPVSAKPGTRLDVTVSSVGDATSLLGGVL 128

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           + T+L G DG IY +AQGS+ V G   +G+++S  + IST G I  G IVER +P +F  
Sbjct: 129 LQTALKGVDGKIYTLAQGSLTVGGFSSQGRAASVSKNISTVGIIPGGGIVERGIPFEFNQ 188

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLM 242
              L L LR  DFSTA +IA+++N         P A A D  ++ +  P     ++  LM
Sbjct: 189 QDKLTLHLRTADFSTAQQIAERVNGA----MGGPFARAIDDMSITMDIPAQYRNNMVPLM 244

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           + +E L V  DT A+V+++E+TGT+V+G +VRI++  V++GNL + + E EQV QP  F 
Sbjct: 245 ASIENLDVSPDTAAKVVVDEKTGTVVLGRDVRITRTAVAHGNLQITVQEGEQVSQPGPF- 303

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           S G TV    T+  V +      +I+   L  L+ G+NSIG     +ISIL+ ++ +GAL
Sbjct: 304 SQGQTVVTPTTETNVREENRHLVIIEGATLQELVDGLNSIGATPRDLISILRTMQVSGAL 363

Query: 363 QSEIII 368
            +E+ +
Sbjct: 364 LAELEV 369


>gi|299131793|ref|ZP_07024988.1| flagellar P-ring protein [Afipia sp. 1NLS2]
 gi|298591930|gb|EFI52130.1| flagellar P-ring protein [Afipia sp. 1NLS2]
          Length = 369

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 167/350 (47%), Positives = 243/350 (69%), Gaps = 8/350 (2%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR 81
             SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++  G  
Sbjct: 24  ATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNIRGAT 83

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
           + + NVAAVMVT NLP FA+ G+R+DV+++++GDA SL+GG L++T LLGADGN+YAVAQ
Sbjct: 84  IRTGNVAAVMVTGNLPAFATQGTRMDVTVSAMGDAKSLQGGTLLVTPLLGADGNVYAVAQ 143

Query: 142 GSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           GS+ + G   +GQ++S  +G+ T G+I NGA+VERE+        ++ L LRN DF+TA 
Sbjct: 144 GSLAIGGFQAEGQAASVTKGVPTNGRIANGALVEREIEFALNKLPNVRLALRNSDFTTAK 203

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVI 259
           RIA  +N Y        IAE  D  TV++S P     ++  L++E+E L VE D  A+++
Sbjct: 204 RIAAAVNDY----LGDKIAEPVDPSTVQLSIPAEFKGNVVALLTEIEQLQVEPDMGAKIV 259

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           I+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPNAF +NG TV   NT + V +
Sbjct: 260 IDERSGIIVMGRDVRVNTVAVAQGNLTVTISESPQVSQPNAF-ANGRTVVTPNTSVGVRE 318

Query: 320 NKGSFSL-IDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +    +L  D   L  L+ G+N +G+    +ISILQ IKAAGA+Q++I +
Sbjct: 319 DGKKLALVKDGVSLQQLVDGLNGLGIGPRDMISILQAIKAAGAIQADIEV 368


>gi|328543151|ref|YP_004303260.1| flagellar P-ring protein I [polymorphum gilvum SL003B-26A1]
 gi|326412897|gb|ADZ69960.1| Flagellar P-ring protein I [Polymorphum gilvum SL003B-26A1]
          Length = 371

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 171/371 (46%), Positives = 248/371 (66%), Gaps = 9/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           I      +F ++ L   +A   SRIKD+   +  RDNQLIGYGLVVGL GTGDSLR++PF
Sbjct: 5   ILFRISAVFVVLALLSSAALSASRIKDIADFEGIRDNQLIGYGLVVGLNGTGDSLRNAPF 64

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T QS++++L+ LG++T G  L +KNVAAVMVTANLP F++ G+R+DVS+++LGD+ SL+G
Sbjct: 65  TRQSLQAMLERLGVNTRGVDLNTKNVAAVMVTANLPAFSTQGTRLDVSVSALGDSESLQG 124

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L++T LLGADG +YA+AQGSV + G   +G ++S + G+ T G+I NGA++EREL  K
Sbjct: 125 GTLLVTPLLGADGEVYAIAQGSVAIGGFSAQGDAASIVRGVPTSGRIANGALIERELDFK 184

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLT 239
                 + L LRNPD +T+ RIA  IN         P AE  D  TV++  P     ++ 
Sbjct: 185 LASMTSVRLALRNPDLTTSRRIALSINELI----GLPTAEPIDPATVRIDLPRQYEGNIV 240

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            L++++E L +E D PARV+I+E +G IV+G NV++S V V+ GNLTV I E  +V QP 
Sbjct: 241 DLLTDIEQLIIEPDLPARVVIDENSGIIVMGQNVKVSTVAVAQGNLTVTIAETPEVSQPL 300

Query: 300 AFSSNGSTVTQNNTDLKVSD--NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F +NG TV    +++ V++  ++    + +   L  L+ G+N++G+    +ISILQ IK
Sbjct: 301 PF-ANGETVVVPRSEVTVTEQTDRKLAVVPETITLQQLVDGLNALGIGPRDMISILQAIK 359

Query: 358 AAGALQSEIII 368
           A+GALQ+EI +
Sbjct: 360 ASGALQAEIEV 370


>gi|222147573|ref|YP_002548530.1| flagellar basal body P-ring protein [Agrobacterium vitis S4]
 gi|254789288|sp|B9JRP8|FLGI_AGRVS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|221734561|gb|ACM35524.1| flagellar P-ring protein precursor [Agrobacterium vitis S4]
          Length = 371

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 228/368 (61%), Positives = 290/368 (78%), Gaps = 1/368 (0%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +   +     L+     +    SRIKDV SLQ+GRDNQLIGYGLVVGLQ TGDSLRSSPF
Sbjct: 5   VLLFSIFTGFLLAAAGPALAQGSRIKDVASLQAGRDNQLIGYGLVVGLQSTGDSLRSSPF 64

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T+QSMR++LQNLGIST GG+  +KNVAAVMVTA LPPF SPGSRID +++SLGDA+SLRG
Sbjct: 65  TDQSMRAMLQNLGISTQGGQSSAKNVAAVMVTATLPPFGSPGSRIDATVSSLGDATSLRG 124

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MTSL GADG IYAVAQGSVVVSG   +GQ+++  EG++T G++ NGAI+ERELP K
Sbjct: 125 GTLIMTSLSGADGQIYAVAQGSVVVSGFTAQGQAATVTEGVTTSGRVPNGAIIERELPSK 184

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL 241
           FKDS +L+LQLRNPDFST++ +A +IN+Y+   +  PIAEA DS+ V + KP   DL +L
Sbjct: 185 FKDSVNLVLQLRNPDFSTSLGMARRINNYATATYGAPIAEARDSQEVVIQKPRTADLAQL 244

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           M+++E L VETDTPA+V+INERTGTIVIG +VR+SKV VSYG LTVQ+ E  QV+QP  F
Sbjct: 245 MADIENLVVETDTPAKVVINERTGTIVIGADVRVSKVAVSYGTLTVQVNETPQVIQPQPF 304

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           SS G+T TQ  TD+         +++D PDL +L++G+N+IG+K DGII+ILQGIK+AGA
Sbjct: 305 SS-GTTATQPQTDISAQKTGDKVAIVDGPDLRTLVAGLNNIGVKPDGIIAILQGIKSAGA 363

Query: 362 LQSEIIIQ 369
           LQ+E+++Q
Sbjct: 364 LQAELVLQ 371


>gi|297538900|ref|YP_003674669.1| flagellar P-ring protein [Methylotenera sp. 301]
 gi|297258247|gb|ADI30092.1| flagellar P-ring protein [Methylotenera sp. 301]
          Length = 377

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 141/370 (38%), Positives = 221/370 (59%), Gaps = 11/370 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           ++R        I L  I      R+KD+ ++Q  R+NQLIGYGLVVGL GTGD    +P+
Sbjct: 15  VWRDICCALLSISLLFIQPAHAERLKDLATIQGVRNNQLIGYGLVVGLDGTGD---QTPY 71

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QSM S++Q +G++ P G  +  KNVA+V++T +LP FA PG  +DV+++S+G A SLR
Sbjct: 72  TVQSMISMMQQMGVNLPAGTSIQMKNVASVIITGSLPAFAQPGQTLDVTVSSMGSAKSLR 131

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L GADG IYA+AQG++VV G+      S       + G+I +GA VER +P 
Sbjct: 132 GGTLLMTPLKGADGQIYAMAQGNLVVGGVGASANGSQTQINHLSVGRISDGATVERSIPN 191

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
               + ++ L+L+  DFSTA  +AD IN     RF +  A A D R ++V  P N     
Sbjct: 192 TINLTDNVNLELKESDFSTASLVADAINK----RFGQNTALAQDGRVIRVQAPANSSRVS 247

Query: 241 LMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            ++++E + V      A++I+N RTG++V+   V +    VS+GNL+V I  +  + QP 
Sbjct: 248 FLADLEKINVAPAPTNAKIIMNARTGSVVMNQAVTLESCAVSHGNLSVVINTDPVISQPG 307

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           A SS G T++   + ++++   G    L    +L+ ++  +N+IG     +++ILQ +KA
Sbjct: 308 ALSS-GQTISTARSQIEINKEPGKVLKLNSGANLSDVVKALNAIGATPQDLLAILQAMKA 366

Query: 359 AGALQSEIII 368
           AG+L +++ +
Sbjct: 367 AGSLHADLEV 376


>gi|114330365|ref|YP_746587.1| flagellar basal body P-ring protein [Nitrosomonas eutropha C91]
 gi|114307379|gb|ABI58622.1| flagellar P-ring protein [Nitrosomonas eutropha C91]
          Length = 375

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 151/356 (42%), Positives = 211/356 (59%), Gaps = 8/356 (2%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
             +     RIKD+V++Q  R NQLIGYGLVVGL GTGD  + +PFT QS+ S+L  LG++
Sbjct: 23  ISAPASAERIKDLVNIQGVRANQLIGYGLVVGLDGTGDQTQQTPFTVQSILSMLGQLGVN 82

Query: 77  TPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
            P G  L  +NVA+VMVTA LP FA PG +IDV+++S+G+A SLRGG L+MT L G D  
Sbjct: 83  LPPGVNLQLRNVASVMVTATLPAFAKPGQQIDVTVSSMGNAKSLRGGTLLMTPLKGIDNQ 142

Query: 136 IYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           +YAVAQGS+V+ G       SS        G+I  GAIVER +P        + L+L + 
Sbjct: 143 VYAVAQGSLVIGGAGASSAGSSVQINHLGAGRISAGAIVERAVPTLLGQGEYINLELHDT 202

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVEMLTVETDT 254
           DF+TA RI + INS    RFS   A A D R +++  P  N      +S++E L V    
Sbjct: 203 DFTTARRIVETINS----RFSYGTATALDGRVIQLRAPVDNNQRVTFISQIEGLDVMPAQ 258

Query: 255 -PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
             A+VIIN RTG++V+   V +    V++GNL+V I     V QP  FS  G TV    +
Sbjct: 259 GVAKVIINARTGSVVMNQMVTLEPSAVAHGNLSVIINTQPIVSQPGPFSQRGETVVVPQS 318

Query: 314 DLKV-SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            ++V S+      L  +  L  ++  +N+IG     +++ILQ +KAAG+L++E+ I
Sbjct: 319 QIEVRSEEGNLMLLPGSASLADVVKALNAIGATPQDLLAILQALKAAGSLRAELEI 374


>gi|83312923|ref|YP_423187.1| flagellar basal body P-ring protein [Magnetospirillum magneticum
           AMB-1]
 gi|115311523|sp|Q2W0J7|FLGI_MAGMM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|82947764|dbj|BAE52628.1| Flagellar basal-body P-ring protein [Magnetospirillum magneticum
           AMB-1]
          Length = 392

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 164/363 (45%), Positives = 234/363 (64%), Gaps = 15/363 (4%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
              A   SRIKD+   +  RDN L+GYGLVVGL  TGDSL ++PFT++S+  +L+ LG++
Sbjct: 33  PAEAFGASRIKDIADFEGVRDNMLVGYGLVVGLNSTGDSLTNAPFTKESLTGMLERLGVN 92

Query: 77  TPG------GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLL 130
                     +L  KNVAAVM+TA LPPF+  G+RID++++++GDA  LRGG L++T L+
Sbjct: 93  IRDKTGAISSQLTPKNVAAVMITATLPPFSRQGTRIDINVSAMGDAKDLRGGTLLVTPLI 152

Query: 131 GADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKDSADLI 189
           GADG +YAV QG V   G    G   SS  +G+ T G+I NGAIVERELP +      + 
Sbjct: 153 GADGEVYAVGQGQVATGGFTASGASGSSVTKGVPTAGRIANGAIVERELPFEMSHLESVK 212

Query: 190 LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEM 247
           + LRNPDF+T+ RIA  INS+        +A   D  TV+++ P     ++  L+++VE 
Sbjct: 213 VSLRNPDFTTSRRIAQAINSF----LGGDMARPVDPGTVQIAVPPGYRGNVVGLLTDVEQ 268

Query: 248 LTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGST 307
           L VE D  ARV+++E +GTIV+G+NVRIS V ++ G LT++ITE  QV QP+ FS  G+T
Sbjct: 269 LRVEPDQMARVVVDEVSGTIVMGENVRISTVAIAQGQLTIRITETPQVSQPSPFSDAGTT 328

Query: 308 VTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSE 365
            T   TD++V +  G+    +     L  L+ G+NS+G+    +I+ILQ IKAAGALQ+E
Sbjct: 329 TTVQRTDIQVDEGAGNKLAVVPHKVTLQELVEGLNSLGIGPRDLITILQAIKAAGALQAE 388

Query: 366 III 368
           + +
Sbjct: 389 LEV 391


>gi|254470489|ref|ZP_05083893.1| flagellar P-ring protein FlgI [Pseudovibrio sp. JE062]
 gi|211960800|gb|EEA95996.1| flagellar P-ring protein FlgI [Pseudovibrio sp. JE062]
          Length = 358

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 163/362 (45%), Positives = 246/362 (67%), Gaps = 8/362 (2%)

Query: 10  FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSL 69
             ++    + A   SRIKD+   +  RDNQLIGYGLVVGLQGTGDSL +SPFT QS++++
Sbjct: 1   MLILFGATLQANAASRIKDIADFEGIRDNQLIGYGLVVGLQGTGDSLNASPFTRQSLQAM 60

Query: 70  LQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSL 129
           L+ LG++T    L +KN AAVMVTANLP F++ G+RIDV++++LGDA +L+GG L++T L
Sbjct: 61  LERLGVNTNEADLNTKNTAAVMVTANLPAFSTQGTRIDVTVSALGDAKNLQGGTLLVTPL 120

Query: 130 LGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLI 189
           +GADG  YA+AQG + ++G   +G+++S + G+ T G+I NGA+VERE+  K    + + 
Sbjct: 121 MGADGEAYAIAQGPLAIAGFAAQGEAASVVRGVPTSGRIPNGALVEREVEFKLSSLSSIR 180

Query: 190 LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT--NIDLTRLMSEVEM 247
           L LRNPD +T+ RIA  IN         P AE  D  TV+++ P   + ++  L++++E 
Sbjct: 181 LALRNPDLTTSRRIAIAINELI----GLPTAEPLDPATVRLTLPKQFDGNIVDLITDIEQ 236

Query: 248 LTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGST 307
           L VE D PA+++I+E +G IV+G  V++S V V+ GNLTV I E+ ++VQP  F + G T
Sbjct: 237 LIVEPDLPAKIVIDESSGIIVMGQQVKVSTVAVAQGNLTVTIAESPEIVQPLPF-AQGDT 295

Query: 308 VTQNNTDLKVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
                +D++V+++    +L++    L  L+ G+N++G+    +ISILQ IKAAGALQ+EI
Sbjct: 296 AAVPRSDVQVTEDNRQLALVNETITLQQLVDGLNALGIGPRDLISILQAIKAAGALQAEI 355

Query: 367 II 368
            +
Sbjct: 356 EV 357


>gi|220924572|ref|YP_002499874.1| flagellar basal body P-ring protein [Methylobacterium nodulans ORS
           2060]
 gi|219949179|gb|ACL59571.1| flagellar P-ring protein [Methylobacterium nodulans ORS 2060]
          Length = 377

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 169/360 (46%), Positives = 239/360 (66%), Gaps = 9/360 (2%)

Query: 13  IGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQN 72
           I +    A  +SR+KD+ +++  R NQL+GYG+VVGL GTGD+L + PFT+QS++++L+ 
Sbjct: 22  IMVGASPALALSRVKDLAAIEGVRPNQLVGYGIVVGLNGTGDTLNNVPFTKQSVQAMLER 81

Query: 73  LGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
           LG++T G  + + N+AAVMVTANLPPFA+ G+RIDV+++SLGDA SL+GG L++T LLGA
Sbjct: 82  LGVNTRGATMRTANLAAVMVTANLPPFATQGTRIDVTVSSLGDAKSLQGGTLLVTPLLGA 141

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQL 192
           DG +YA+AQGS+ ++G   +G ++    G+ T G+I NGA++ERE+  K      L L L
Sbjct: 142 DGEVYALAQGSLAIAGFQAEGDAAKITRGVPTNGRIANGAMIEREIEFKLNQQRMLRLSL 201

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTV 250
           RNPD +T+ RIA  IN +         AE  D  TV +  P      + RL++E+E L V
Sbjct: 202 RNPDLTTSKRIAAAINDF----MGADTAEPTDPSTVTLQVPARYQGNMIRLLTEIEQLKV 257

Query: 251 ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
           E D  ARV+I+ER+G IV+G +VR+S V V+ GNLTV ITE  QV QP    S G+TV  
Sbjct: 258 EPDQTARVVIDERSGIIVMGRDVRVSTVAVAQGNLTVTITEQPQVSQPEPL-SQGTTVVV 316

Query: 311 NNTDLKVS--DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             T LKV   D      + +   L  L+ G+N++G+    +ISILQ IKAAGALQ++I +
Sbjct: 317 PRTALKVDTGDRNKLALVKEGVSLRELVDGLNALGVGPRDLISILQAIKAAGALQADIEV 376


>gi|194365676|ref|YP_002028286.1| flagellar basal body P-ring protein [Stenotrophomonas maltophilia
           R551-3]
 gi|194348480|gb|ACF51603.1| flagellar P-ring protein [Stenotrophomonas maltophilia R551-3]
          Length = 376

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 147/369 (39%), Positives = 213/369 (57%), Gaps = 8/369 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           R A  I +L+ L   +     RIKD+  +   R N L+GYGLVVGL G+GD    +PFT 
Sbjct: 11  RRAASIVALMLLIVAAPASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTV 70

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS+++LL  LG++ P       KNVAAV + A LPPFA PG  ID++++S+G+A SLRGG
Sbjct: 71  QSLKNLLGELGVNVPANVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIGNAVSLRGG 130

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKK 181
            L+M  L GADG IYA+AQG+++V G   +G   S     + + G+I NGA VER LP  
Sbjct: 131 SLLMAPLRGADGQIYAIAQGNLIVGGFGAQGKDGSRVSVNVPSVGRIPNGATVERALPDP 190

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTR 240
             +  D+ L L N DF+T  R+   +N    N F    A A D  TV V+ PT+      
Sbjct: 191 LANGGDITLNLHNNDFTTVSRMVAALN----NAFGEGAARAVDGVTVAVTAPTDPGARIG 246

Query: 241 LMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
           L++ +E L +     PA+V++N RTGT+VIG  V++    +S+G+LTV I EN  V QPN
Sbjct: 247 LLARIENLELTPGSAPAKVVVNSRTGTVVIGQQVKVGPAAISHGSLTVTIQENTNVSQPN 306

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           A S   +  +  +T    +D    F       L+ ++  +N++G     +I+IL+ +K A
Sbjct: 307 ALSGGRTVASPQSTITATNDGSRMFKFSGGTTLDEIVHAVNAVGAAPGDLIAILEALKQA 366

Query: 360 GALQSEIII 368
           GAL +E+ +
Sbjct: 367 GALSAELEV 375


>gi|77464884|ref|YP_354388.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides 2.4.1]
 gi|124021067|sp|Q3IY97|FLGI2_RHOS4 RecName: Full=Flagellar P-ring protein 2; AltName: Full=Basal body
           P-ring protein 2; Flags: Precursor
 gi|77389302|gb|ABA80487.1| putative flagellar P-ring protein [Rhodobacter sphaeroides 2.4.1]
          Length = 363

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 162/371 (43%), Positives = 232/371 (62%), Gaps = 10/371 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ R+  L+  L G          RIKD+V     R N L+GYGLVVGL GTGD LR++P
Sbjct: 1   MLIRLLLLVICLAG---PGVAEEIRIKDLVRFDGVRGNDLLGYGLVVGLNGTGDGLRNAP 57

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTE  M +LL+ LG++  G +   KNVAAV VTA LPPFA  G++IDV+++++GDA SL 
Sbjct: 58  FTEDIMSNLLERLGVNVTGEQYRPKNVAAVFVTATLPPFARAGAQIDVTVSAMGDAKSLL 117

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG LVMT L GADG IYAVAQG+++  G+  +GQ++  ++G+ T G I  GA VERE+  
Sbjct: 118 GGTLVMTPLNGADGQIYAVAQGTIIAGGVSAEGQAARVVQGVPTAGTIPEGARVEREVEF 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           +F     + L LR+PDF+TA RI D+IN        R +A   D+ TV +         R
Sbjct: 178 EFARLDRVRLALRSPDFTTAGRIEDRIN----RELGRGVATMLDAGTVSLDLGRLGPPAR 233

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           +M  +E L V  +T ARV++++R+GTIV+G++VRIS+V V+ G LT+++ E   VVQPN 
Sbjct: 234 VMGRIENLEVVPETVARVVVDQRSGTIVMGEDVRISRVAVAQGGLTLRVEEQPMVVQPNP 293

Query: 301 FSSNGSTVTQNNTDLKVSD--NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           F S G TV    T   +      G   +     L+ +++G+N++G+  + +I IL+ I A
Sbjct: 294 F-SRGETVVVPRTTASIQQRPGTGLAEIPAETSLSRVVAGLNALGVAPNDMIDILKSIHA 352

Query: 359 AGALQSEIIIQ 369
           AGAL +E I++
Sbjct: 353 AGALHAEFIVR 363


>gi|114777908|ref|ZP_01452822.1| flagellar P-ring protein precursor I [Mariprofundus ferrooxydans
           PV-1]
 gi|114551695|gb|EAU54247.1| flagellar P-ring protein precursor I [Mariprofundus ferrooxydans
           PV-1]
          Length = 372

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 159/370 (42%), Positives = 222/370 (60%), Gaps = 9/370 (2%)

Query: 1   MIFRIAFL-IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           M FR  FL   +L  L         RIKD+  ++  R N L+GYGLVVGL GTGDS  SS
Sbjct: 5   MSFRPLFLPAIALSMLMMPLMAQAERIKDLADIEGVRGNALVGYGLVVGLNGTGDSGTSS 64

Query: 60  PFTEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           PFT  S+ ++L+ LG++      ++  KN+AAVMVT+ LP FA PG ++DV+++S+GDA 
Sbjct: 65  PFTISSITAMLERLGVNVRADITKMKPKNIAAVMVTSELPAFARPGQQLDVTVSSIGDAK 124

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
            LRGG L++T LLG DG  YAVAQG +   G  + G+S+S  +G  T  ++ NGA VER 
Sbjct: 125 DLRGGTLLVTPLLGGDGRPYAVAQGGLSTGGFSIAGKSASTTKGHPTAARVPNGARVERA 184

Query: 178 LPKKFK-DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI 236
            P+    D   + L L NPDF+TA  + D IN+    R    +A A DS TV+V  P N 
Sbjct: 185 APRGLSADQDKISLNLHNPDFTTAKNMQDAINA----RLGNGMARAIDSGTVQVWNP-NS 239

Query: 237 DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
           +   L++ +E + +  D  A VI++ERTGTIV+G  VRI  V V++GN++V ITEN QV 
Sbjct: 240 NAVELIARLEQIDIPLDHAAVVIVDERTGTIVMGQEVRIDTVAVAHGNISVSITENPQVS 299

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           QPNAF    +T    +      D      L     L+ L++ +N++G     +I++LQ I
Sbjct: 300 QPNAFGGGQTTTVDRSKVNVQEDEAKLVVLPKQVSLSKLVTALNAVGATPSDLIAVLQAI 359

Query: 357 KAAGALQSEI 366
           KAAGAL +E+
Sbjct: 360 KAAGALHAEL 369


>gi|126463726|ref|YP_001044840.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|332559783|ref|ZP_08414105.1| FlgI2 [Rhodobacter sphaeroides WS8N]
 gi|126105390|gb|ABN78068.1| flagellar P-ring protein [Rhodobacter sphaeroides ATCC 17029]
 gi|332277495|gb|EGJ22810.1| FlgI2 [Rhodobacter sphaeroides WS8N]
          Length = 363

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 162/371 (43%), Positives = 232/371 (62%), Gaps = 10/371 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ R+  L+  L G          RIKD+V     R N L+GYGLVVGL GTGD LR++P
Sbjct: 1   MLIRLLLLVICLAG---PGVAEEIRIKDLVRFDGVRGNDLLGYGLVVGLNGTGDGLRNAP 57

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTE  M +LL+ LG++  G +   KNVAAV VTA LPPFA  G++IDV+++++GDA SL 
Sbjct: 58  FTEDIMSNLLERLGVNVTGEQYRPKNVAAVFVTATLPPFARAGAQIDVTVSAMGDAKSLL 117

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG LVMT L GADG IYAVAQG+++  G+  +GQ++  ++G+ T G I  GA VERE+  
Sbjct: 118 GGTLVMTPLNGADGQIYAVAQGTIIAGGVSAEGQAARVVQGVPTAGTIPEGARVEREVDF 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
           +F     + L LR+PDF+TA RI D+IN        R +A   D+ TV +         R
Sbjct: 178 EFARLDRVRLALRSPDFTTAGRIEDRIN----RELGRGVATMLDAGTVSLDLGRLGPPAR 233

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           +M  +E L V  +T ARV++++R+GTIV+G++VRIS+V V+ G LT+++ E   VVQPN 
Sbjct: 234 VMGRIENLEVVPETVARVVVDQRSGTIVMGEDVRISRVAVAQGGLTLRVEEQPMVVQPNP 293

Query: 301 FSSNGSTVTQNNTDLKVSD--NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           F S G TV    T   +      G   +     L+ +++G+N++G+  + +I IL+ I A
Sbjct: 294 F-SRGETVVVPRTTASIQQRPGTGLAEIPAETSLSRVVAGLNALGVAPNDMIDILKSIHA 352

Query: 359 AGALQSEIIIQ 369
           AGAL +E I++
Sbjct: 353 AGALHAEFIVR 363


>gi|90423008|ref|YP_531378.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           BisB18]
 gi|90105022|gb|ABD87059.1| flagellar P-ring protein [Rhodopseudomonas palustris BisB18]
          Length = 378

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 161/365 (44%), Positives = 236/365 (64%), Gaps = 6/365 (1%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           A     ++ L    A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS
Sbjct: 17  AVAAAVVLTLSCGGAGATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQS 76

Query: 66  MRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           ++++L+ +G++  G  + + NVAAVMVT NLPPF + G+R+DV++++LGD+ +L+GG L+
Sbjct: 77  LQAMLERMGVNIRGATIRTGNVAAVMVTGNLPPFGTQGTRMDVTVSALGDSKNLQGGTLL 136

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           +T LLGADGN+YAVAQGS+ + G   +G ++    G+ T G+I NGAI+ERE+       
Sbjct: 137 VTPLLGADGNVYAVAQGSLAIGGFQAEGDAAKITRGVPTVGRIANGAIIEREIEFALNRL 196

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMS 243
            +  L LRN DF+TA RIA  IN +         AE  D  TV+++ P     ++   ++
Sbjct: 197 PNARLALRNGDFTTAKRIAAAINDFV----GAKCAEPIDPSTVQLTIPAEFKGNVVAFLT 252

Query: 244 EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           E+E L VE D  A++II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN  S 
Sbjct: 253 EIEQLQVEPDLAAKIIIDERSGIIVMGRDVRVATVAVAQGNLTVTISESPQVSQPNPLSR 312

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
             +TVT N+      D K    + D   L  L+ G+N +G+    +I ILQ IKAAGA+Q
Sbjct: 313 GRTTVTPNSKIGVTEDGKKLAVVRDGVSLQQLVDGLNGLGIGPRDLIGILQAIKAAGAIQ 372

Query: 364 SEIII 368
           ++I +
Sbjct: 373 ADIEV 377


>gi|253996315|ref|YP_003048379.1| flagellar P-ring protein [Methylotenera mobilis JLW8]
 gi|253982994|gb|ACT47852.1| flagellar P-ring protein [Methylotenera mobilis JLW8]
          Length = 390

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 139/371 (37%), Positives = 221/371 (59%), Gaps = 8/371 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++     L  +++ +         R+KD+ S+Q  R NQLIGYGLVVGL GTGD    +P
Sbjct: 24  IMLPCLLLASTVLSITTAPVAHAERLKDLASIQGVRSNQLIGYGLVVGLDGTGDQTVQTP 83

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ S++Q +G++ P G  L  KNVAAV+VT++LP FA PG  +D++++S+G+A SL
Sbjct: 84  FTVQSIISMMQQMGVNLPTGTSLQLKNVAAVIVTSSLPAFAQPGQTLDITVSSMGNAKSL 143

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L GADG +YA+AQGS+VV G+      S       + G+I  GA VER +P
Sbjct: 144 RGGTLLMTPLKGADGQVYAMAQGSLVVGGVGASANGSQTQVNHLSVGRITAGATVERAVP 203

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT 239
                +    L+L++ DFSTA  + D +N     +F +  A A ++R ++++ P +    
Sbjct: 204 SNVTQNNTFNLELKDSDFSTASLVVDAVN----RQFGQNTALAQNARVIQINPPASYSRV 259

Query: 240 RLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++ +E L V      A+VI+N RTG++V+   V +    VS+GNLTV I  +  + QP
Sbjct: 260 AFLAALESLNVAPAASYAKVIVNARTGSVVMNQTVTLESCAVSHGNLTVTINTDPVISQP 319

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            A +S G TV    +++ +  + G    L    +L+ ++  +N+IG     +++ILQ +K
Sbjct: 320 GALAS-GQTVATARSEIDIKKDPGQVVKLDSGANLSDVVKALNAIGATPQDLLAILQAMK 378

Query: 358 AAGALQSEIII 368
           AAG+L++E+ +
Sbjct: 379 AAGSLRAELEV 389


>gi|89902481|ref|YP_524952.1| flagellar basal body P-ring protein [Rhodoferax ferrireducens T118]
 gi|123091072|sp|Q21S32|FLGI_RHOFD RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|89347218|gb|ABD71421.1| flagellar P-ring protein [Rhodoferax ferrireducens T118]
          Length = 381

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/370 (38%), Positives = 217/370 (58%), Gaps = 10/370 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +   +  +  L        SRIK+V +++  R NQL G+GLVVGL GTGD     P+T Q
Sbjct: 15  LLAALCLIASLLGAGTAQASRIKEVAAVEGVRSNQLTGFGLVVGLDGTGDQTTQMPYTAQ 74

Query: 65  SMRSLLQNLGISTPGGR---LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            + + LQ LGI+ P  +   L  KNVAAV+VTA LP FA PG  IDV+++S+G+A SL+G
Sbjct: 75  GLTNYLQQLGITLPEAQVSKLQLKNVAAVLVTAALPAFARPGQAIDVNVSSMGNAKSLKG 134

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+ T L GADG +YA+AQGS+VV+G       S       + G+I  GA VER +P  
Sbjct: 135 GTLITTPLKGADGEVYALAQGSLVVAGAGAAAGGSKVQINHLSAGRIPGGAQVERIVPTP 194

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTR 240
             + A + L L+  DF TA R+A+ IN     RF    A A D RT+ V+ P+  +    
Sbjct: 195 LLEGASITLGLQASDFQTARRVAEAIN----RRFGAHSARALDGRTIDVTAPSESNARVS 250

Query: 241 LMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            ++E+E L +E+  P A+V+IN RTG+IV+   V + +  +++GNL+V I+    + QPN
Sbjct: 251 FIAEMEELQLESSIPSAKVVINSRTGSIVMNQAVTLGECAIAHGNLSVSISTTPVISQPN 310

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
             S+ G TV    +++++    G    L  +  L+ ++  +N++G     +++ILQ IKA
Sbjct: 311 PLSTGGKTVVAEKSNIQIRQEPGMLIQLPKSTQLSDVVRALNALGATPQDLLAILQAIKA 370

Query: 359 AGALQSEIII 368
           AGAL +E+ +
Sbjct: 371 AGALNAELEV 380


>gi|118588720|ref|ZP_01546128.1| flagellar P-ring protein precursor I [Stappia aggregata IAM 12614]
 gi|118438706|gb|EAV45339.1| flagellar P-ring protein precursor I [Stappia aggregata IAM 12614]
          Length = 380

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 162/351 (46%), Positives = 235/351 (66%), Gaps = 8/351 (2%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
           Q  SRIKD+   +  R+NQLIGYGLVVGL GTGDSL +SPFT+QS++++L+ LG++T   
Sbjct: 34  QAASRIKDIADFEGIRENQLIGYGLVVGLNGTGDSLNNSPFTQQSLQAMLERLGVNTRNI 93

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
            L +  VAAVMVTANLPPF++ G+RIDV++++LGD+ SL+GG L++T L+GADG +YA+A
Sbjct: 94  DLNTNTVAAVMVTANLPPFSTQGTRIDVNVSALGDSDSLQGGTLLVTPLVGADGEVYAIA 153

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QGS+ + G   +  ++S + G+ T G+I NG +VEREL  K      L L LRNPD +TA
Sbjct: 154 QGSIAIGGFSAQADAASVVRGVPTAGRIANGGLVERELDFKLASLTTLRLALRNPDLTTA 213

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT--NIDLTRLMSEVEMLTVETDTPARV 258
            RIA  +N         P AE  D  TV++  P   + ++  L++++E L VE D  AR+
Sbjct: 214 RRIALSVNELI----GMPTAEPLDPATVRIDLPQQYDGNIVDLLTDIEQLIVEPDLAARI 269

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           +I+E +G IV+G +V++S V V+ GNLTV I E+ QV QP  F +NG T     +D+ V 
Sbjct: 270 VIDENSGIIVMGQDVKVSMVAVAQGNLTVTIAESPQVSQPLPF-ANGQTAVVPRSDVSVD 328

Query: 319 DNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +     +++     L  L+ G+N++G+    +ISILQ IKAAGALQ++I +
Sbjct: 329 EEGSKLAIVPQTVTLKQLVDGLNALGIGPRDMISILQAIKAAGALQADIEV 379


>gi|114762174|ref|ZP_01441642.1| flagellar P-ring protein precursor I [Pelagibaca bermudensis
           HTCC2601]
 gi|114545198|gb|EAU48201.1| flagellar P-ring protein precursor I [Roseovarius sp. HTCC2601]
          Length = 370

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 163/374 (43%), Positives = 234/374 (62%), Gaps = 11/374 (2%)

Query: 1   MIFRIA--FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS 58
           MI R+    L F+L  L + +A    RIKD+V     R N L+GYGLVVGL GTGD LR+
Sbjct: 1   MITRLLGLCLAFTLCLLTQSAAAQSVRIKDLVEFDGVRSNDLVGYGLVVGLNGTGDGLRN 60

Query: 59  SPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           +PFTE+ M+++L+ LG++  G +   +NVAAV VT+ LPPF   GS+IDV+++++GDASS
Sbjct: 61  APFTEEIMQNILERLGVNVTGEQFRPRNVAAVFVTSRLPPFGRAGSQIDVTVSAIGDASS 120

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           L GG L+MT L  ADG IYAVAQG+V+  G+  +G  +  ++G+ T G I  GA +ERE+
Sbjct: 121 LLGGTLIMTPLNAADGQIYAVAQGTVIAGGVNAEGDGARVVQGVPTSGMIPAGARIEREV 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNI 236
              F D + L L LR PDF+TA RI   IN     R  R  AE  D+ TV V+       
Sbjct: 181 EFAFADLSTLRLALREPDFTTAARIEAAIN----RRVGRRAAEMLDAGTVSVNLQQTGTG 236

Query: 237 DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
              + +  +E L VE +  ARV++++R+GTIV+G++VRIS+V VS GNLT++I E    V
Sbjct: 237 SPAQAVVAIENLPVEPERRARVVVDQRSGTIVMGEDVRISRVAVSQGNLTLRIEETPIAV 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQ 354
           QPN F + G TV    T   + +    G   +     L+ +I+G+N++G+    +I IL+
Sbjct: 297 QPNPF-AEGETVIVPRTGADIVEEPGIGLAEVPGGTSLSEVIAGLNALGVSPRDMIDILK 355

Query: 355 GIKAAGALQSEIII 368
            IKAAGAL ++ ++
Sbjct: 356 SIKAAGALHADFLV 369


>gi|124021069|sp|Q2RQE9|FLGI_RHORT RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 379

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 166/369 (44%), Positives = 236/369 (63%), Gaps = 8/369 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
            IA  + ++  L    A+  SRIKD+   +  RDN L+GYGLVVGL+GTGD L    FT+
Sbjct: 14  LIAVALTAVFLLAPTGAEAASRIKDLADFEGVRDNILVGYGLVVGLKGTGDKLDDVTFTK 73

Query: 64  QSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           +S+  +L+ LG++T  G+L   NVAAVMVT  LPPFA  GSRIDV+I++LG A SL GG 
Sbjct: 74  ESLIGMLERLGVNTREGKLDPDNVAAVMVTGTLPPFARQGSRIDVTISALGTAKSLAGGT 133

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L++T L+GADG +YAVAQG   + G  V+GQS+S  +G+ T G+I NGA+VE E+P    
Sbjct: 134 LMVTPLIGADGEVYAVAQGQAQIGGYAVQGQSASVQKGVPTSGRIPNGALVEAEVPFNLS 193

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRL 241
               + + LRNPDF+TA RIA  IN++        +A   D  TV V+       +   L
Sbjct: 194 AMESVKISLRNPDFTTARRIAQAINAF----LGTELARPLDPGTVLVAVTAGYEGNAVAL 249

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           ++++E L VE DT ARV+I+E TGTIVIG+ VRI+ V ++ GNLT+++TE  QV QP  F
Sbjct: 250 LTDIEQLLVEPDTVARVVIDEATGTIVIGEKVRINTVAIAQGNLTIRVTETPQVSQPAPF 309

Query: 302 SSNGSTVTQNNTDLKVSD--NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           S  G T     T+++V +  +     +    +L  L++ +N++G+    +ISILQ IK+A
Sbjct: 310 SQGGQTAVVPRTNIQVDEGKDNKLTVVNGGVNLQDLVNSLNALGVGPRDMISILQAIKSA 369

Query: 360 GALQSEIII 368
           GA+Q+EI +
Sbjct: 370 GAMQAEIQV 378


>gi|163758017|ref|ZP_02165105.1| flagellar basal-body P-ring protein [Hoeflea phototrophica DFL-43]
 gi|162284306|gb|EDQ34589.1| flagellar basal-body P-ring protein [Hoeflea phototrophica DFL-43]
          Length = 363

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 220/351 (62%), Positives = 278/351 (79%), Gaps = 1/351 (0%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
            +   SRIKD+ SLQ+ RDNQLIGYGLVVGLQGTGD LR+SPFTEQS+R++LQNLGIST 
Sbjct: 14  QSAAASRIKDIASLQAARDNQLIGYGLVVGLQGTGDGLRNSPFTEQSLRAMLQNLGISTE 73

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           GG   + NVAAV+VTANLPPFAS GSR+DV+++SLGDA+SLRGG LVMTSL GADG IYA
Sbjct: 74  GGATRANNVAAVIVTANLPPFASIGSRVDVTVSSLGDATSLRGGTLVMTSLSGADGQIYA 133

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           VAQGSV+VSG+  +G +++  +GI+T G++  GAI+ERE+P  FK    L+ QLRNPDFS
Sbjct: 134 VAQGSVIVSGIQAQGDAATLQQGIATSGRLPGGAIIEREIPTSFKSVGGLVYQLRNPDFS 193

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARV 258
           TA+ +AD IN+Y+  R+  PIAEA DS TV V KP   DL RL +E+E L VETDTPARV
Sbjct: 194 TAVGMADVINAYAEARYDGPIAEARDSTTVAVRKPERADLARLTAELENLVVETDTPARV 253

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++NERTGTIVIG++VR+S+V VS+G LTVQI E   VVQP+ F S+G T  +  TD+   
Sbjct: 254 VVNERTGTIVIGNDVRVSRVAVSHGTLTVQINETPTVVQPSPF-SDGVTAIEPLTDITAG 312

Query: 319 DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            + G  ++ID PDL SL++G+NSIG+  DGII+ILQGIK+AGAL +E+++Q
Sbjct: 313 VDGGQVAIIDGPDLRSLVAGLNSIGVTPDGIIAILQGIKSAGALHAELVLQ 363


>gi|68164542|gb|AAY87271.1| predicted flagellar basal-body P-ring protein [uncultured bacterium
           BAC17H8]
          Length = 381

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 145/382 (37%), Positives = 234/382 (61%), Gaps = 20/382 (5%)

Query: 1   MIFRIA--FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS 58
           M+ ++    ++F    +   ++ +  R+KD+ S+   R NQL+GYG+VVGL GTGD   S
Sbjct: 5   MMHKLIKWLVLFGCFAVIGSASALADRLKDMTSIAGVRSNQLVGYGVVVGLAGTGDG--S 62

Query: 59  SPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           S  T QS++S++   G+ T    L +KNVA+VMVTA +P F  PG R+D++++++G A S
Sbjct: 63  SGLTLQSLQSMVSQFGLVTDSANLNAKNVASVMVTAEMPAFMKPGQRLDITVSTIGGAKS 122

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERE 177
           LRGG L+MT +LGADG  YAVAQG++VV GL V G   SS +  I T G+I  GA +E+ 
Sbjct: 123 LRGGTLLMTPMLGADGETYAVAQGNLVVGGLGVAGNDGSSVIVNIPTVGRIPRGASIEKM 182

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           +   F+ + +++L L   DFSTA+R+AD +N      F   +A   D+ T+KV  P +  
Sbjct: 183 VDTPFQSNDNVLLNLHQSDFSTAMRVADAVNEV----FGPDVAVPLDASTIKVRAPVDPS 238

Query: 238 L-TRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                +S +E + VE   P A+VI+N RTGTIVIG +VR++  VV++G+LTV+I E+++V
Sbjct: 239 QKVSFVSLLENIEVEPARPSAKVIVNSRTGTIVIGGDVRVTPSVVTHGSLTVRINEDKEV 298

Query: 296 VQPNAFSSN--------GSTVTQNNTDLKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKT 346
            Q N  + N        G     ++T++ +      +F      +L+ ++  +N++G   
Sbjct: 299 TQTNTITQNQQGAVVAPGQAQVNDDTEIVIEQEPARAFIFDPGVELSDVVDAVNAVGASP 358

Query: 347 DGIISILQGIKAAGALQSEIII 368
             +++IL+ ++ AG+L++EII+
Sbjct: 359 ADLVAILEALREAGSLRAEIIV 380


>gi|154252998|ref|YP_001413822.1| flagellar P-ring protein [Parvibaculum lavamentivorans DS-1]
 gi|154156948|gb|ABS64165.1| flagellar P-ring protein [Parvibaculum lavamentivorans DS-1]
          Length = 378

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 170/370 (45%), Positives = 247/370 (66%), Gaps = 8/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           F    L   L   +   AQ  SRIKD+V ++  RDN L+GYGLVVGL GTGD+LR++PFT
Sbjct: 12  FLTLVLAGLLAAGNPGGAQASSRIKDIVDVEGIRDNMLVGYGLVVGLNGTGDTLRNAPFT 71

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           +QS+  +L+ LG++T G  L + NVAAVMV+ANLP FAS G+RIDV++++LGDA++L+GG
Sbjct: 72  QQSLIGMLERLGVNTRGTSLKTANVAAVMVSANLPAFASQGTRIDVTVSALGDATNLQGG 131

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
           +L++T L+GADG +YAVAQGS+   G   KG+ +S   G+ T G+I NGAIVEREL  + 
Sbjct: 132 VLLVTPLMGADGQVYAVAQGSLATGGFAAKGEGASVTRGVPTNGRIANGAIVERELDFQL 191

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTR 240
            D   L L LRNPD +TA R+A  IN++         A A +  TV+++ P      +  
Sbjct: 192 SDLRALRLSLRNPDLTTAQRVASAINAFI----GTQTATADNPTTVQLTVPPAYRGGVVA 247

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           L++++E L V+ D  ARV+I+E +G IV+G +VR+S V ++ GNLT+ ++E+ QV QP+ 
Sbjct: 248 LLTDIEQLRVQPDLTARVVIDESSGVIVMGQDVRVSMVAIAQGNLTISVSESPQVSQPSP 307

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSF--SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           FS+ G TV    TD+ V +  G     L  +  L  L+ G+N++G+    +I+ILQ IK+
Sbjct: 308 FSTQGDTVVVPRTDIDVDEETGKQLGILDGSISLKELVDGLNALGVSPRDMITILQAIKS 367

Query: 359 AGALQSEIII 368
           +GALQ+EI +
Sbjct: 368 SGALQAEIQV 377


>gi|303325595|ref|ZP_07356038.1| flagellar P-ring protein FlgI [Desulfovibrio sp. 3_1_syn3]
 gi|302863511|gb|EFL86442.1| flagellar P-ring protein FlgI [Desulfovibrio sp. 3_1_syn3]
          Length = 370

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 148/349 (42%), Positives = 220/349 (63%), Gaps = 8/349 (2%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR 81
              RIKD+ +    RDNQLIGYGLVVGL GTGD  + S FT  SM++++  +GI      
Sbjct: 27  QAVRIKDIATFSGVRDNQLIGYGLVVGLAGTGDK-KDSVFTLSSMKNMMDRMGIGVNSSA 85

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
           L  KNVA+VMVTA +P  + PGSR+DV+++S+GDA+SL GG+L+ T+L G DG  Y +AQ
Sbjct: 86  LKIKNVASVMVTARMPVSSKPGSRLDVTVSSVGDATSLLGGVLLQTALKGVDGKTYCLAQ 145

Query: 142 GSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           G++ V G  V G ++S  + ++T G I  G IVER +P +F     L L +R  DFSTA 
Sbjct: 146 GALTVGGFSVTGAAASTQKNVNTVGLIPGGGIVERGIPFEFNQQDKLTLNMRVGDFSTAQ 205

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVI 259
           +IA+++N+        P A A D+ +V V  P     +L  LM+ VE L V  DT A+V+
Sbjct: 206 QIAERLNAA----MGGPYARAVDAMSVSVDVPPQYKSNLVPLMASVENLEVTPDTAAKVV 261

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           ++E+TGT+V+G +VRIS+  V++GNL + + E++QV QP  F S G TV    TD+ V +
Sbjct: 262 VDEKTGTVVLGRDVRISRAAVAHGNLQITVQESQQVSQPGPF-SQGQTVVTPQTDINVRE 320

Query: 320 NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
                 +++   L  L+ G+N+IG     +ISIL+ ++ +G+L +E+ +
Sbjct: 321 ENRRLVMVEGATLQELVDGLNAIGATPRDLISILRSLQVSGSLHAELEV 369


>gi|254510781|ref|ZP_05122848.1| flagellar P-ring protein FlgI [Rhodobacteraceae bacterium KLH11]
 gi|221534492|gb|EEE37480.1| flagellar P-ring protein FlgI [Rhodobacteraceae bacterium KLH11]
          Length = 364

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 236/369 (63%), Gaps = 9/369 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +  L F LI L         R+KD+V     R N L+GYGLVVGL GTGD LR+SPFTE+
Sbjct: 1   MKILAFLLILLPCTVTAGAIRLKDLVDFDGVRGNDLVGYGLVVGLNGTGDGLRNSPFTEE 60

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            M ++L+ LG++  G     KNVAAV+VTA+LPPF+  GS+IDV+++++GD++SL GG L
Sbjct: 61  IMSNILERLGVNVNGEDFRPKNVAAVLVTASLPPFSRVGSQIDVTVSAIGDSNSLLGGTL 120

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           +MT L  ADG IYAVAQGSV+  G   +G++++ ++G+ T G I +GA VERE+  +   
Sbjct: 121 IMTPLNAADGQIYAVAQGSVLAGGASAEGEAATVVQGVPTSGMIPSGARVEREIDFELSA 180

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTV--KVSKPTNIDLTRLM 242
              L L LR PDF+TA RI   INS     F+R +A   DS TV   ++   +      +
Sbjct: 181 LTRLRLALREPDFTTAGRIETAINS----EFNRAVAIMRDSGTVELNIAATQSASTAHAI 236

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
             +E + VE ++ ARV++++R+GTIV+G +VRIS+V VS GNLT+ + E    VQPN F+
Sbjct: 237 GRIENILVEPESKARVVVDQRSGTIVMGRDVRISRVAVSQGNLTLTVEEAPIAVQPNPFA 296

Query: 303 SNGSTVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
             G TV    T   + + +G+    + +A  L+ +++G+N++G+    +I IL+ IKAAG
Sbjct: 297 R-GETVVVPRTVAGIEEEEGTGLAEIPEATTLSEVVAGLNALGVSPRDMIDILKTIKAAG 355

Query: 361 ALQSEIIIQ 369
           AL +E I++
Sbjct: 356 ALHAEFIVR 364


>gi|206889436|ref|YP_002249845.1| flagellar P-ring protein FlgI [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741374|gb|ACI20431.1| flagellar P-ring protein FlgI [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 403

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 146/367 (39%), Positives = 221/367 (60%), Gaps = 11/367 (2%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L    + L   +     RIKD+ S    R+NQL+GYGLVVGL GTGD  +   +  Q +
Sbjct: 42  LLFIFFLILSFATTSHAERIKDIASWSGIRENQLVGYGLVVGLNGTGD--KDGTYLYQPI 99

Query: 67  RSLLQNLGISTPGGRLGSK--NVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            ++L  +GI+     L  K  NVAAVMVTA LP    PG++IDV ++S+GDA SL+GG L
Sbjct: 100 ANMLSRMGITVNVKDLKGKVKNVAAVMVTAKLPTNVKPGTKIDVQVSSIGDAKSLQGGTL 159

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           ++T L G DG +YA+AQG + + G    G+++  ++     G I  GAIVE+ +P     
Sbjct: 160 LLTPLTGPDGEVYALAQGPISIGGFIAAGRAAQAIKNHQNVGSIPEGAIVEKAVPVNLNA 219

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLM 242
            ++L L L+ PD +TA  IA++IN      +   IA+A D  T+ ++ P+    ++   M
Sbjct: 220 KSELQLLLQFPDITTAKNIAEKINEI----YKAGIAKALDPTTISINIPSTYRGNVLDFM 275

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +EVE + V TD PARV+INERTGT+VIG +V+IS   +++G LT+ I E  +V+QP   S
Sbjct: 276 AEVEKIEVSTDLPARVVINERTGTVVIGSHVKISPAALAHGGLTITIKETPEVIQPPPLS 335

Query: 303 SNGS-TVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
             GS T T   T+LKV + + S   +    +  L+  +N++G+    +ISILQ +K +GA
Sbjct: 336 PRGSVTETVPRTELKVEEKQASLVEVQGSTVGELVRALNTLGVTPKDLISILQALKTSGA 395

Query: 362 LQSEIII 368
           L+++++I
Sbjct: 396 LKADLVI 402


>gi|83594181|ref|YP_427933.1| flagellar basal body P-ring protein [Rhodospirillum rubrum ATCC
           11170]
 gi|83577095|gb|ABC23646.1| Flagellar P-ring protein [Rhodospirillum rubrum ATCC 11170]
          Length = 383

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 166/369 (44%), Positives = 236/369 (63%), Gaps = 8/369 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
            IA  + ++  L    A+  SRIKD+   +  RDN L+GYGLVVGL+GTGD L    FT+
Sbjct: 18  LIAVALTAVFLLAPTGAEAASRIKDLADFEGVRDNILVGYGLVVGLKGTGDKLDDVTFTK 77

Query: 64  QSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           +S+  +L+ LG++T  G+L   NVAAVMVT  LPPFA  GSRIDV+I++LG A SL GG 
Sbjct: 78  ESLIGMLERLGVNTREGKLDPDNVAAVMVTGTLPPFARQGSRIDVTISALGTAKSLAGGT 137

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L++T L+GADG +YAVAQG   + G  V+GQS+S  +G+ T G+I NGA+VE E+P    
Sbjct: 138 LMVTPLIGADGEVYAVAQGQAQIGGYAVQGQSASVQKGVPTSGRIPNGALVEAEVPFNLS 197

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRL 241
               + + LRNPDF+TA RIA  IN++        +A   D  TV V+       +   L
Sbjct: 198 AMESVKISLRNPDFTTARRIAQAINAF----LGTELARPLDPGTVLVAVTAGYEGNAVAL 253

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           ++++E L VE DT ARV+I+E TGTIVIG+ VRI+ V ++ GNLT+++TE  QV QP  F
Sbjct: 254 LTDIEQLLVEPDTVARVVIDEATGTIVIGEKVRINTVAIAQGNLTIRVTETPQVSQPAPF 313

Query: 302 SSNGSTVTQNNTDLKVSD--NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           S  G T     T+++V +  +     +    +L  L++ +N++G+    +ISILQ IK+A
Sbjct: 314 SQGGQTAVVPRTNIQVDEGKDNKLTVVNGGVNLQDLVNSLNALGVGPRDMISILQAIKSA 373

Query: 360 GALQSEIII 368
           GA+Q+EI +
Sbjct: 374 GAMQAEIQV 382


>gi|163783622|ref|ZP_02178611.1| flagellar P-ring protein precursor [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881115|gb|EDP74630.1| flagellar P-ring protein precursor [Hydrogenivirga sp. 128-5-R1-1]
          Length = 362

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 154/357 (43%), Positives = 229/357 (64%), Gaps = 7/357 (1%)

Query: 12  LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
           L+ L  +S  +  RIKD+ +++  R N L GYGLVVGL+GTGD  +++ FT +S+ + LQ
Sbjct: 12  LLILLFVSLSMAERIKDIATIEGNRVNYLQGYGLVVGLKGTGDG-KATQFTVKSLANALQ 70

Query: 72  NLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
            +GI     R+  KNVAAV VTA +PP+A  G R+DVS++S+GDA SL GG L++T L G
Sbjct: 71  KMGIVVDPNRITVKNVAAVFVTAKIPPYAKAGMRVDVSVSSIGDAKSLEGGTLLLTPLRG 130

Query: 132 ADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQ 191
            DG IYA+AQG ++V G   +G+ +S ++ + T G+I NGA++ER+LP     +  + + 
Sbjct: 131 PDGRIYALAQGQLIVGGYEARGRGASQVKNVPTVGRIPNGAVLERDLPFDMNVAD-VNII 189

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVE 251
           L  PDF+TA R+ D INS    RF  PIA A DS TVKV  PT ++    ++E+E L ++
Sbjct: 190 LDVPDFTTAKRVQDAINS----RFKAPIAVALDSATVKVGIPTGVNPVDFLAEIENLEIK 245

Query: 252 TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
           T   A+V+I+ R+GTIV+G NVRIS V V+ G+L V++ E  +V QP    S G T    
Sbjct: 246 TSQVAKVVIDGRSGTIVLGGNVRISPVAVAVGSLVVKVKELAEVSQPPPL-SPGETKVVP 304

Query: 312 NTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            T+++V + K     +    ++ L++ +N IG     IIS+LQ IK AGAL++++ +
Sbjct: 305 RTEVEVIEEKRRLIPLKGTTVHELVTSLNKIGATPREIISVLQAIKEAGALKAKLEV 361


>gi|170742318|ref|YP_001770973.1| flagellar basal body P-ring protein [Methylobacterium sp. 4-46]
 gi|168196592|gb|ACA18539.1| flagellar P-ring protein [Methylobacterium sp. 4-46]
          Length = 371

 Score =  378 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 165/349 (47%), Positives = 234/349 (67%), Gaps = 9/349 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SR+KD+ +++  R NQL+GYG+VVGL GTGD+L + PFT+QS++++L+ LG++T G  + 
Sbjct: 27  SRVKDLATIEGVRPNQLVGYGIVVGLNGTGDTLNNVPFTKQSVQAMLERLGVNTRGATMR 86

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           + N+AAVMVTANLPPFA+ G+RIDV+++SLGDA SL+GG L++T LLGADG +YA+AQGS
Sbjct: 87  TANLAAVMVTANLPPFAAQGTRIDVTVSSLGDAKSLQGGTLLVTPLLGADGEVYALAQGS 146

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + ++G   +G ++    G+ T G+I NGA++ERE+  K      L L LRNPD +T+ RI
Sbjct: 147 LAIAGFQAEGDAAKVTRGVPTNGRIANGAMIEREIEFKLGQQRALRLSLRNPDLTTSKRI 206

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTPARVIIN 261
           A  IN +         AE  D  TV +  P      + RL++E+E L VE D  ARV+I+
Sbjct: 207 AAAINDF----MGADTAEPTDPSTVTLQVPPRYQGNMIRLLTEIEQLKVEPDQTARVVID 262

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS--D 319
           ER+G IV+G +VR+S V V+ GNLTV ITE  QV QP    S G TV    T +KV   D
Sbjct: 263 ERSGIIVMGRDVRVSTVAVAQGNLTVTITEQPQVSQPEPL-SQGQTVVVPRTAIKVETGD 321

Query: 320 NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
                 + +   L  L+ G+N++G+    +ISILQ IKA+GALQ++I +
Sbjct: 322 RNKLALVKEGVSLRELVDGLNALGIGPRDLISILQAIKASGALQADIEV 370


>gi|149203103|ref|ZP_01880074.1| flagellar P-ring protein precursor I [Roseovarius sp. TM1035]
 gi|149143649|gb|EDM31685.1| flagellar P-ring protein precursor I [Roseovarius sp. TM1035]
          Length = 372

 Score =  378 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 160/367 (43%), Positives = 228/367 (62%), Gaps = 9/367 (2%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            +  +L      +A    RIKD+V     R N L+GYGLVVGL GTGD LR++PFTE+ M
Sbjct: 11  IMALALALAGVTAAASPIRIKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNAPFTEEIM 70

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
            ++L+ LGI+  G +   KNVAAV VTA LPPFA  GS+IDV+I+++GDA SL GG LVM
Sbjct: 71  SNILERLGINVSGEQFRPKNVAAVFVTAELPPFARAGSQIDVTISAIGDAKSLLGGTLVM 130

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L  ADG IYAVAQG+++  G+  +G +   ++G+ T G I +GA VERE+   F    
Sbjct: 131 TPLNAADGQIYAVAQGTIIAGGVAAQGDAGGVVQGVPTAGVIPSGARVEREIDFDFAGLD 190

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVK--VSKPTNIDLTRLMSE 244
            + L LR PDF+TA RI   IN     R  R  A   D+ TV+  +S+         + +
Sbjct: 191 TIRLALREPDFTTAGRIETAIN----GRVGRDAAIMLDAGTVQLTLSRMRAASPAHALGQ 246

Query: 245 VEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           +E + VE +  ARV++++R+GTIV+G +VRIS+V VS GNLT++I E   VVQPN F + 
Sbjct: 247 IENILVEPERKARVVVDQRSGTIVMGQDVRISRVAVSQGNLTLRIQETPLVVQPNPF-AQ 305

Query: 305 GSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           G TV    T   + +    G   ++    L+ +I+G+N++G+    +I IL+ IKAAGAL
Sbjct: 306 GETVVVPRTQAGIEEEPGIGLAEVLPGTSLSEVIAGLNALGVAPRDMIDILKSIKAAGAL 365

Query: 363 QSEIIIQ 369
            +E +++
Sbjct: 366 HAEFVVR 372


>gi|239817161|ref|YP_002946071.1| flagellar P-ring protein [Variovorax paradoxus S110]
 gi|239803738|gb|ACS20805.1| flagellar P-ring protein [Variovorax paradoxus S110]
          Length = 377

 Score =  378 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 150/368 (40%), Positives = 214/368 (58%), Gaps = 8/368 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           R      +L  +   S     R+K++ S+Q  RDN LIGYGL+VGL GTGD    +PFT 
Sbjct: 14  RSLIGFAALCAITLCSPAQAERLKELASIQGVRDNPLIGYGLMVGLDGTGDQTMQTPFTT 73

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS+ ++LQ LGI+ P G  +  KNVAAVMVTA LP FA PG  IDV+++S+G+A SLRGG
Sbjct: 74  QSLNNMLQQLGITIPQGVNMQLKNVAAVMVTATLPSFARPGQNIDVTVSSMGNAKSLRGG 133

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L G DG +YA+AQG++VV G       S       + G+I  GA+VER +    
Sbjct: 134 TLLMTPLKGVDGQVYAIAQGNMVVGGAGASANGSKAQVNQLSSGRIPAGALVERSVEAPV 193

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLM 242
                  L+L   DF T    AD IN     +F    A+A D+R ++V  P   +    +
Sbjct: 194 GGEGSFTLELNRSDFGTVQLAADAIN----RQFGAGTAQALDARVIQVQAPAPQERVGFL 249

Query: 243 SEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           + +E L V      ARV++N RTG++V+   VR++   V++GNL+V I  +  V QPNAF
Sbjct: 250 ARLESLEVTPTQAVARVVVNARTGSVVMNQAVRVNDCAVAHGNLSVVINTDPVVSQPNAF 309

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            S GSTV    + + +S   G+  ++     L  +I G+NS+G     ++SILQ +K+AG
Sbjct: 310 -SGGSTVVGQTSQISISQGGGALQMVRGGASLADVIKGLNSLGANPQDLVSILQAMKSAG 368

Query: 361 ALQSEIII 368
           AL++E+ I
Sbjct: 369 ALRAELEI 376


>gi|58039091|ref|YP_191055.1| flagellar basal body P-ring protein [Gluconobacter oxydans 621H]
 gi|81557150|sp|Q5FT97|FLGI_GLUOX RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|58001505|gb|AAW60399.1| Flagellar P-ring protein precursor [Gluconobacter oxydans 621H]
          Length = 380

 Score =  378 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 166/370 (44%), Positives = 229/370 (61%), Gaps = 11/370 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
             AF+   L+ L   +     RIKD+  ++  R NQLIGYGLVVGL GTGD L ++ FT 
Sbjct: 18  LTAFVCVGLLLLPGFTLAASVRIKDITDMEGVRSNQLIGYGLVVGLNGTGDRLTNTIFTR 77

Query: 64  QSMRSLLQNLGISTPG--GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           +++ S+L  LG++      +L + +VAAVMVTA+LP F   G+RIDV++++ GDASSL G
Sbjct: 78  ETLISMLNRLGVNIRDQETQLQTHDVAAVMVTADLPAFVHGGNRIDVTVSAAGDASSLTG 137

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L++T L+ ADG +YAVAQGS+  +    +G ++S    + T G I NG IVERE+P  
Sbjct: 138 GTLLVTPLMAADGEVYAVAQGSLATNAFSARGAAASITRNVPTSGHIANGGIVEREVPFD 197

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL 241
               A+L L LRNPDF+TA RIA  IN         PIA   D RTV +   +N D    
Sbjct: 198 LSHRANLHLSLRNPDFTTASRIASIINRTFG-----PIAIVQDPRTVLLDL-SNHDPVST 251

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           +S +  L V  DTPA+V+++E +GTI++G +VRIS V V+ GNLTVQ+TE  QV QP  F
Sbjct: 252 LSRIGDLLVTPDTPAKVVVDEASGTIIMGADVRISTVAVAQGNLTVQVTETPQVSQPGPF 311

Query: 302 SSNGSTVTQNNTDLKVSDNKG--SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
            S G T     T++KV   K      +     L  L+SG+N++G+    +ISILQ IKA 
Sbjct: 312 -SGGQTAVVPRTNVKVDTGKTHHLAVVPGGTTLRELVSGLNALGVGPRDMISILQAIKAD 370

Query: 360 GALQSEIIIQ 369
           GALQ+E+ ++
Sbjct: 371 GALQAELEMR 380


>gi|23016699|ref|ZP_00056452.1| COG1706: Flagellar basal-body P-ring protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 391

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 166/362 (45%), Positives = 232/362 (64%), Gaps = 14/362 (3%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
              A   SRIKD+   +  RDN L+GYGLVVGL GTGDSL ++PFT++S+  +L+ LG++
Sbjct: 33  PADAFGASRIKDIADFEGVRDNMLVGYGLVVGLNGTGDSLTNAPFTKESLTGMLERLGVN 92

Query: 77  TPG-----GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
                     +  KNVAAVMVTA LPPFA  G+RID +++++GDA  LRGG L++T L+G
Sbjct: 93  IRDKTGAITSVSPKNVAAVMVTAVLPPFARQGTRIDTNVSAMGDAKDLRGGTLLVTPLIG 152

Query: 132 ADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKDSADLIL 190
           ADG +YAV QG V   G    G   SS  +G+ T G+I NGAIVERELP +      + +
Sbjct: 153 ADGEVYAVGQGQVATGGFTASGASGSSVTKGVPTAGRIANGAIVERELPFEMSHLESVKV 212

Query: 191 QLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEML 248
            LRNPDF+T+ RIA  +NS+        +A   D  TV+++ P     ++  L+++VE L
Sbjct: 213 SLRNPDFTTSRRIAQAVNSF----LGGDMARPVDPGTVQITVPPGYRGNVVGLLTDVEQL 268

Query: 249 TVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTV 308
            VE D  ARV+I+E +GTIV+G+NVRIS V ++ G LT++ITE  QV QP+ FS  G+T 
Sbjct: 269 RVEPDQMARVVIDEVSGTIVMGENVRISTVAIAQGQLTIRITETPQVSQPSPFSDAGTTT 328

Query: 309 TQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           T   TD++V +  G+    +     L  L+ G+NS+G+    +I ILQ IKAAGALQ+E+
Sbjct: 329 TVQRTDIQVDEGAGNKLAVVPHKVTLQELVEGLNSLGIGPRDLIVILQAIKAAGALQAEL 388

Query: 367 II 368
            +
Sbjct: 389 EV 390


>gi|126734124|ref|ZP_01749871.1| flagellar P-ring protein FlgI [Roseobacter sp. CCS2]
 gi|126716990|gb|EBA13854.1| flagellar P-ring protein FlgI [Roseobacter sp. CCS2]
          Length = 368

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/373 (41%), Positives = 232/373 (62%), Gaps = 9/373 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M    +  +F  + L  ++A    RIKD+V     R N L+GYGLVVGL GTGD LR+SP
Sbjct: 1   MRLLQSLCLFVALLLPNLTAANPVRIKDLVEFDGVRSNDLVGYGLVVGLNGTGDGLRNSP 60

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTE  + ++L+ LG++  G +    NVAAV+VT  LPPFA  GS +D++++++GDA SL 
Sbjct: 61  FTEDILGNVLERLGVNVTGEQFRPNNVAAVLVTGELPPFARAGSALDITVSAIGDADSLL 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT +  ADG+IYAVAQG+++  G    G  ++ ++G+ T G I +GA +ERE+  
Sbjct: 121 GGTLIMTPMKAADGDIYAVAQGTIIAGGASAAGDGAAVIQGVPTAGVIPSGATIEREITF 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
            F     + + LR PDF+TA RI   IN+     FS  +A   D+ TV++S P     + 
Sbjct: 181 DFSSLHTIRMALRTPDFTTADRIERAINA----EFSGAVAVMLDAGTVELSIPATKMRSP 236

Query: 241 LMS--EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +   VE + V+ +  ARV++++R+GTIV+G++VRIS+V VS GNLT++I E   V QP
Sbjct: 237 AHALVRVENIMVQPERRARVVVDQRSGTIVMGEDVRISRVAVSQGNLTLRIQEAPLVAQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           N F + G TV    TD+ V +    G   +     L+ +++G+N++G+    +I IL+ I
Sbjct: 297 NPF-AEGETVIVPRTDVDVIEEPGIGLAEVDGGTSLSEVVAGLNALGVAPRDMIDILKSI 355

Query: 357 KAAGALQSEIIIQ 369
           KA+GAL +E I++
Sbjct: 356 KASGALHAEFIVR 368


>gi|319787117|ref|YP_004146592.1| flagellar P-ring protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317465629|gb|ADV27361.1| flagellar P-ring protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 380

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 144/351 (41%), Positives = 204/351 (58%), Gaps = 8/351 (2%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG- 80
              RIKD+  +   R N L+GYGLVVGL  +GD    +PFT QS++++L  LG+  P   
Sbjct: 33  QAERIKDLAQVGGVRGNALVGYGLVVGLDNSGDRTSQAPFTVQSLKNMLSELGVQVPANV 92

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
               KNVAAV + A LPPFA PG  IDV+++S+G+A SLRGG L+M  L GADG +YA+A
Sbjct: 93  NPQLKNVAAVAIHAELPPFAKPGQTIDVTVSSIGNAVSLRGGSLLMAPLKGADGQVYAIA 152

Query: 141 QGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           QG++VV G   +G   S     I + G+I NGA VER LP       D+ L L   DF+T
Sbjct: 153 QGNLVVGGFGAQGRDGSRVAVNIPSAGRIPNGATVERALPSVLDGGGDITLNLHRNDFTT 212

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETD-TPAR 257
             R+ D IN+Y    F   +A A D  TV V+ P ++      +++VE L +     PA+
Sbjct: 213 VSRMVDAINAY----FGPGVARAVDGVTVSVAAPADVGSRIGFLAQVENLELSPGSAPAK 268

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           VI+N RTGT+VIG  VR+    V++G LTV I E  QV QP A +  G+ V QN+T    
Sbjct: 269 VIVNARTGTVVIGSQVRVMPAAVAHGALTVTINEGVQVSQPGALAGGGTVVAQNSTVSGT 328

Query: 318 SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            +    F       L+ ++  +N +G     +I+IL+ ++ AGAL++E+ +
Sbjct: 329 QEGSRMFRFEGGTTLDEIVRAVNEVGAAPGDLIAILEALRQAGALRAELEV 379


>gi|51246536|ref|YP_066420.1| flagellar basal body P-ring protein [Desulfotalea psychrophila
           LSv54]
 gi|81641309|sp|Q6AJR7|FLGI_DESPS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|50877573|emb|CAG37413.1| probable flagellar P-ring protein (FlgI) [Desulfotalea psychrophila
           LSv54]
          Length = 390

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 144/375 (38%), Positives = 218/375 (58%), Gaps = 13/375 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +     LIF+ I     +    SRIKD+  L   R NQLIGYGL+ GL GTGD ++ S F
Sbjct: 20  LILTLCLIFTGINFSTSNDVQASRIKDIAQLHGVRSNQLIGYGLITGLNGTGDDMKKSAF 79

Query: 62  TEQSMRSLLQNLGISTPGGRLGS---KNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           T Q++ +++   GI+     + S   KNVAAVMVTA+LPPFAS GS+ID+ ++S+GDA S
Sbjct: 80  TLQAIYNMMTRSGITLNPSEMKSIKIKNVAAVMVTASLPPFASSGSKIDIQVSSMGDAKS 139

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           L GG L+MT L G D  +YA+AQG + +      G+S+   +     G+I +GA VE  +
Sbjct: 140 LAGGTLLMTPLKGVDNRVYAIAQGPLAIGAFSFGGKSAQAQKNHPNAGRIPDGATVEDTV 199

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-- 236
                    L  QL N DF+TA  +   IN     +F +  A   DS +V ++ P +   
Sbjct: 200 LVDIGADGTLTYQLANADFTTANNMTRAINK----KFGKDTAYPLDSGSVTINIPPHFSK 255

Query: 237 DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
            + + ++ VE + +  D+ ARV++NERTGT+V+G NVR+S V VS+GNL + I E+  V 
Sbjct: 256 RVVQFVANVESIDITADSVARVVVNERTGTVVMGQNVRLSTVAVSHGNLNLIIRESFDVS 315

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFS---LIDAPDLNSLISGMNSIGLKTDGIISIL 353
           QP    ++G TV   +T++ V++ +G      + +   +  + + +N+IG     +I+I 
Sbjct: 316 QPAPL-ADGETVITPSTEISVTEEEGQLVVLNMKNDVSIGEIANALNAIGATPRDLIAIF 374

Query: 354 QGIKAAGALQSEIII 368
           Q IKAAGA+  E+I+
Sbjct: 375 QAIKAAGAMHGELIV 389


>gi|256830173|ref|YP_003158901.1| flagellar P-ring protein [Desulfomicrobium baculatum DSM 4028]
 gi|256579349|gb|ACU90485.1| flagellar P-ring protein [Desulfomicrobium baculatum DSM 4028]
          Length = 371

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 146/351 (41%), Positives = 222/351 (63%), Gaps = 8/351 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
                R+KD+ S    R N L+GYGLVVGL GTGD   SS FT QSM ++L+N+G+    
Sbjct: 26  PAGAVRLKDIASFGGVRSNDLVGYGLVVGLPGTGDKS-SSQFTIQSMANMLENMGVKVDR 84

Query: 80  GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
             L  KNVAAVMVT  +P  A PGSR+D +++S+GDASSL GG+L+MT L G DG+IYA+
Sbjct: 85  AALKPKNVAAVMVTVKMPASARPGSRLDATVSSVGDASSLLGGVLLMTPLKGIDGSIYAL 144

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           +QG++ V G    G +++  + ++T G+I  GA+VER +P  F +  D+ +QL   DFST
Sbjct: 145 SQGALAVGGFSAGGDAATATKNVTTVGRIPGGAVVERSVPFSFNEQNDITIQLSVEDFST 204

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTPAR 257
           A ++AD +N           A A D+ ++++  P+     +  LM+ +E L V+ D+ A+
Sbjct: 205 AKQVADSLNKAI----GGQYAHAQDASSIRLGVPSQYQGNIVALMASLENLEVQPDSRAK 260

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           V+++E+TGT+V+G NV ++KV VS+GNL V ++E  QV QP AF S G T     T++ V
Sbjct: 261 VVVDEKTGTVVLGANVTLAKVAVSHGNLNVVVSEQPQVSQPGAF-SPGQTAITPATEIGV 319

Query: 318 SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + +    L+    +  L+ G+N+IG     +ISIL+ +K+AGAL +++ +
Sbjct: 320 REEQRRLILMAGASIQELVDGLNAIGATPRDLISILRTMKSAGALHADLEV 370


>gi|27380949|ref|NP_772478.1| flagellar basal body P-ring protein [Bradyrhizobium japonicum USDA
           110]
 gi|27354115|dbj|BAC51103.1| flagellar P-ring protein precursor [Bradyrhizobium japonicum USDA
           110]
          Length = 391

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 160/355 (45%), Positives = 240/355 (67%), Gaps = 8/355 (2%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
             SA   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++
Sbjct: 41  VTSASATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVN 100

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
             G  + + NVAAVMVT NLP FA+ G+R+DV++++LGDA +L+GG L++T LLGADGN+
Sbjct: 101 IRGATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSALGDAKNLQGGTLLVTPLLGADGNV 160

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAVAQGS+ +SG   +G+++  + G+ T G+I NGAI+ERE+        ++ L LRN D
Sbjct: 161 YAVAQGSLAISGFQAEGEAAKIVRGVPTVGRIANGAIIEREIEFALNRLPNVRLALRNAD 220

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDT 254
           F+TA RIA  +N Y         AE  D  TV++S P     ++   ++E+E L V+ D 
Sbjct: 221 FTTAKRIAAAVNDY----LGVKTAEPIDPSTVQLSIPPEFKGNVVAFLTEIEQLQVDPDL 276

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A+++I+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   S G TV    + 
Sbjct: 277 AAKIVIDERSGIIVMGRDVRVATVAVAQGNLTVTISESPQVSQPNPL-SRGRTVVAPRSS 335

Query: 315 LKVSDNKGSFSL-IDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + V+++    +L  D   L  L+ G+N +G+    +ISILQ IKAAGA++++I +
Sbjct: 336 VSVTEDGRKLALVKDGVSLQQLVDGLNGLGIGPRDMISILQAIKAAGAIEADIEV 390


>gi|323697475|ref|ZP_08109387.1| flagellar P-ring protein [Desulfovibrio sp. ND132]
 gi|323457407|gb|EGB13272.1| flagellar P-ring protein [Desulfovibrio desulfuricans ND132]
          Length = 385

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 144/354 (40%), Positives = 223/354 (62%), Gaps = 8/354 (2%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
                  +R+KD+ S    R N+L+GYGLVVGL GTGD   SS FT +SM ++L+ +G+ 
Sbjct: 37  APVEARAARLKDIASFSGVRTNELVGYGLVVGLAGTGDGT-SSTFTMRSMSNMLEKMGVE 95

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
           T    L  KNVAAVMV+A +P  A PGS +D++++SLGDA SL GG+L++T L G DG +
Sbjct: 96  TNPDDLKPKNVAAVMVSAKMPVSAKPGSSLDITVSSLGDAKSLLGGVLLVTPLKGLDGRV 155

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAV QGS+ + G  V G ++   + I T G+I NGA+VER +P KF +   + + L   D
Sbjct: 156 YAVGQGSLTIGGFTVGGVAADAQKNIPTVGRIPNGAVVERSVPFKFNNQDHMTVNLDVRD 215

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDT 254
           F T +++ ++IN+    +F    A+A D  T+ +  P      +  LM+ +E L +  D 
Sbjct: 216 FGTTMQVVNKINASMGGQF----AKAKDISTIDLELPDRFRGDMVPLMASLEDLDISPDG 271

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A+V+++E+TGT+V+G +VR+S+V V++GNL + ++E +QV QP  F S+G TV    TD
Sbjct: 272 KAKVVVDEKTGTVVLGQDVRLSRVAVAHGNLQIVVSETQQVSQPGPF-SDGETVVTPQTD 330

Query: 315 LKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++V +      L++   L  L+ G+NSIG     +ISI++ +KAAG+L +E+ +
Sbjct: 331 IQVQEQNNKLMLMEGATLQELVDGLNSIGATPRDLISIIRTLKAAGSLHAEVEV 384


>gi|322421659|ref|YP_004200882.1| flagellar P-ring protein [Geobacter sp. M18]
 gi|320128046|gb|ADW15606.1| flagellar P-ring protein [Geobacter sp. M18]
          Length = 371

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 154/353 (43%), Positives = 220/353 (62%), Gaps = 9/353 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
              + +RIKD+ +    R NQLIGYGLVVGL GTGDS   + F  QS+   L+ +G++  
Sbjct: 24  QFALGARIKDIAAFDGVRQNQLIGYGLVVGLNGTGDSD-QTKFPVQSLVGALERMGLTVS 82

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
              +  KNVAAVMVTA LPPFA  G+R+DV ++SLGD+ SL GG L+M  L GADG +YA
Sbjct: 83  RNDITVKNVAAVMVTAQLPPFAKQGNRLDVLVSSLGDSKSLAGGTLMMAPLKGADGQVYA 142

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           VAQG+V+ +     GQ++S ++   T G +  GA+VERELP    +   L L L   DF+
Sbjct: 143 VAQGAVLTNSFSYGGQATSAVKNHPTAGTVPEGALVERELPNVLANRQGLKLNLHQSDFT 202

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTPA 256
           TA R+A  IN           A   D  +V+++ P      +   ++++E L V  D  A
Sbjct: 203 TAARVAAAINGRFQ-----GSASLSDPGSVQIAIPAEYQNRVVEFVADLERLEVNPDVMA 257

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +V++NERTGTIV+G+NVRIS V VS+GNLTV + E  +V QP  FS  G+T     TDLK
Sbjct: 258 KVVMNERTGTIVMGENVRISTVAVSHGNLTVVVKETPRVSQPAPFSKTGTTTVVPRTDLK 317

Query: 317 VSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +S+ K + SL+ +  +L  ++ G+N++G+    ++ I+Q IKAAGAL +E+ +
Sbjct: 318 ISEEKVNLSLVREGANLGEVVRGLNTLGVTPRDLLGIMQAIKAAGALNAELSV 370


>gi|166712058|ref|ZP_02243265.1| flagellar basal body P-ring protein [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 372

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 146/370 (39%), Positives = 210/370 (56%), Gaps = 8/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
                L   L      +     RIKD+  +   R N L+GYGLVVGL G+GD    +PFT
Sbjct: 6   LSFRLLATLLGACVVAAPASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFT 65

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+++LL  LG++ P       KNVAAV + A LPPFA PG  ID++++S+ +A SLRG
Sbjct: 66  VQSLKNLLGELGVNVPANVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRG 125

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+M  L GADG +YA+AQG++VV G   +G   S     + + G+I NGAIVER LP 
Sbjct: 126 GSLLMAPLKGADGQVYAMAQGNLVVGGFGAQGKDGSRVSVNVPSVGRIPNGAIVERALPD 185

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LT 239
            F  + ++ L L   DF+T  R+   I+S     F    A A D  TV V  PT+     
Sbjct: 186 VFAGTGEITLNLHQNDFTTVSRMVAAIDS----SFGAGTARAVDGVTVAVRSPTDPGARI 241

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
            L+S +E + +   D PA+V++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP
Sbjct: 242 GLLSRLENVELSPGDAPAKVVVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQP 301

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
            AFS   + VTQ +T    S+    F       L+ ++  +N +G     +++IL+ +K 
Sbjct: 302 GAFSGGRTAVTQQSTITATSEGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQ 361

Query: 359 AGALQSEIII 368
           AGAL +E+ +
Sbjct: 362 AGALSAELEV 371


>gi|315127349|ref|YP_004069352.1| flagellar basal body P-ring protein [Pseudoalteromonas sp. SM9913]
 gi|315015863|gb|ADT69201.1| flagellar basal body P-ring protein [Pseudoalteromonas sp. SM9913]
          Length = 355

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 139/362 (38%), Positives = 207/362 (57%), Gaps = 13/362 (3%)

Query: 12  LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
           ++ L         RIKDV  ++  R NQL+GYGLVVGL GTG+    S FTEQS + +L 
Sbjct: 1   MVLLGWQFTASAERIKDVSMVEGVRSNQLVGYGLVVGLPGTGE---QSRFTEQSFKGMLN 57

Query: 72  NLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLL 130
           + GI+ P   +   KNVAAV V A LPPF  PG  ID++++S+G A SLRGG L+ T L 
Sbjct: 58  SFGITLPSSLKPKIKNVAAVAVHAELPPFRKPGQTIDITVSSIGSAGSLRGGTLLQTFLK 117

Query: 131 GADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLI 189
           G DGN+YA+AQGS++V GL  +G   S  +    T G++ NGA VER +   F  +  + 
Sbjct: 118 GVDGNVYAIAQGSLIVGGLGAEGLDGSRVVINTPTVGRVPNGATVERAVKSPFMQNDYIT 177

Query: 190 LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEML 248
             L  PDF+TA R+   IN           A+A D+ +++V  P +       +S +E L
Sbjct: 178 FNLNRPDFTTAKRLEKTINDLI----GPNSAQALDAASIRVVAPRDASQRVSYLSTLENL 233

Query: 249 TVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGST 307
             +  DT A++I+N RTGTIVIG NV++    +++G LTV I E + V QPN   + G T
Sbjct: 234 EFKPADTSAKIIVNSRTGTIVIGKNVKLQPAAITHGGLTVTIAEQQNVAQPNPL-AEGET 292

Query: 308 VTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           V    + + V+ +   +F       L+ L+  +N +G     +++IL+ +K AGA+  ++
Sbjct: 293 VVTQQSIIDVNQDDSRAFVFDPGVSLDDLVRAINEVGAAPGDLMAILEALKEAGAINGQL 352

Query: 367 II 368
           ++
Sbjct: 353 VV 354


>gi|115523550|ref|YP_780461.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           BisA53]
 gi|115517497|gb|ABJ05481.1| flagellar P-ring protein [Rhodopseudomonas palustris BisA53]
          Length = 378

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 157/363 (43%), Positives = 236/363 (65%), Gaps = 8/363 (2%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           +   + L    A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS+++
Sbjct: 20  MALALALSCDLAGATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQA 79

Query: 69  LLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTS 128
           +L+ +G++  G  + + NVAAVMVT NLP F + G+R+DV++++LGD+ +L+GG L++T 
Sbjct: 80  MLERMGVNIRGATIRTGNVAAVMVTGNLPAFGTQGTRMDVTVSALGDSKNLQGGTLLVTP 139

Query: 129 LLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADL 188
           LLGADGN+YAVAQGS+ + G   +G ++    G+ T G+I NGAI+ERE+        + 
Sbjct: 140 LLGADGNVYAVAQGSLAIGGFQAEGDAAKITRGVPTVGRIANGAIIEREIEFAMNRLPNA 199

Query: 189 ILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVE 246
            L LRN DF+TA RIA  IN +         AE  D  TV+++ P     ++   ++E+E
Sbjct: 200 RLALRNADFTTAKRIAAAINDF----LGTKSAEPIDPSTVQLTIPPEFKGNVVAFLTEIE 255

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            L VE D  A++II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   S G 
Sbjct: 256 QLQVEPDLAAKIIIDERSGIIVMGRDVRVATVAVAQGNLTVTISESPQVSQPNPL-SRGR 314

Query: 307 TVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSE 365
           T    N+ + V+++    +L+     L  L+ G+N +G+    +I ILQ IKAAGA+Q++
Sbjct: 315 TAVTPNSQIGVTEDGKKLALVKAGVSLQQLVDGLNGLGIGPRDLIGILQAIKAAGAIQAD 374

Query: 366 III 368
           I +
Sbjct: 375 IEV 377


>gi|39936970|ref|NP_949246.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           CGA009]
 gi|192292798|ref|YP_001993403.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           TIE-1]
 gi|81619642|sp|Q6N2Y8|FLGI_RHOPA RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|226701955|sp|B3QIX2|FLGI_RHOPT RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|39650827|emb|CAE29350.1| flagellar P-ring protein FlgI [Rhodopseudomonas palustris CGA009]
 gi|192286547|gb|ACF02928.1| flagellar P-ring protein [Rhodopseudomonas palustris TIE-1]
          Length = 373

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 159/348 (45%), Positives = 236/348 (67%), Gaps = 8/348 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
           SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++  G  + 
Sbjct: 30  SRIKDLANIEGIRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNIRGATIR 89

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           + NVAAVMVT NLPPFA+ G+R+DV++++LGDA +L+GG L++T LLGADGN+YAVAQGS
Sbjct: 90  TGNVAAVMVTGNLPPFATQGTRMDVTVSALGDAKNLQGGTLLVTPLLGADGNVYAVAQGS 149

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           + + G   +G+++    G+ T G+I NGAI+ERE+        ++ L LRN DF+TA RI
Sbjct: 150 LAIGGFQAEGEAAKITRGVPTVGRIANGAIIEREIEFALNRLPNVRLALRNADFTTAKRI 209

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVIIN 261
           A  +N Y         AE  D  TV++S P     +   L++E+E L VE D  A+++I+
Sbjct: 210 AAAVNDY----LGTKCAEPLDPSTVQLSIPGEFKGNAVALLTEIEQLQVEPDQAAKIVID 265

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN     G TV   N+ + V+++ 
Sbjct: 266 ERSGIIVMGRDVRVATVAVAQGNLTVSISESPQVSQPNPL-GGGRTVVTPNSRIGVTEDG 324

Query: 322 GSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
                + D   L  L+ G+NS+G+    +I ILQ IKAAGA++++I +
Sbjct: 325 KKLAVVKDGVSLQQLVDGLNSLGIGPRDLIGILQAIKAAGAIEADIEV 372


>gi|221640805|ref|YP_002527067.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides KD131]
 gi|221161586|gb|ACM02566.1| Flagellar P-ring protein 2 precursor [Rhodobacter sphaeroides
           KD131]
          Length = 363

 Score =  376 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 157/356 (44%), Positives = 225/356 (63%), Gaps = 7/356 (1%)

Query: 16  HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI 75
                    RIKD+V     R N L+GYGLVVGL GTGD LR++PFTE  M +LL+ LG+
Sbjct: 13  TCPGFAEEIRIKDLVRFDGVRGNDLLGYGLVVGLNGTGDGLRNAPFTEDIMSNLLERLGV 72

Query: 76  STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
           +  G +   KNVAAV VTA LPPFA  G++IDV+++++GDA SL GG LVMT L GADG 
Sbjct: 73  NVTGEQYRPKNVAAVFVTATLPPFARAGAQIDVTVSAMGDAKSLLGGTLVMTPLNGADGQ 132

Query: 136 IYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           IYAVAQG+++  G+  +GQ++  ++G+ T G I  GA VERE+  +F     + L LR+P
Sbjct: 133 IYAVAQGTIIAGGVSAEGQAARVVQGVPTAGTIPEGARVEREVEFEFARLDRVRLALRSP 192

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTP 255
           DF+TA RI D+IN        R +A   D+ TV +         R++  +E L VE +T 
Sbjct: 193 DFTTAGRIEDRIN----RELGRGVATMLDAGTVSLDLGRLGSPARVLGRIENLAVEPETV 248

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           ARV++++R+GTIV+G++VRIS+V V+ G LT+++ E   VVQPN F S G TV    T  
Sbjct: 249 ARVVVDQRSGTIVMGEDVRISRVAVAQGGLTLRVEEQPMVVQPNPF-SRGETVVVPRTTA 307

Query: 316 KVSD--NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            +      G   +     L+ +++G+N++G+  + +I IL+ I AAGAL +E I++
Sbjct: 308 SIQQRPGTGLAEIPAETSLSRVVAGLNALGVAPNDMIDILKSIHAAGALHAEFIVR 363


>gi|58582200|ref|YP_201216.1| flagellar basal body P-ring protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624092|ref|YP_451464.1| flagellar basal body P-ring protein [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188576760|ref|YP_001913689.1| flagellar basal body P-ring protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576952|ref|YP_001913881.1| flagellar basal body P-ring protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|75435188|sp|Q5GZP0|FLGI_XANOR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|124021078|sp|Q2P2N7|FLGI_XANOM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|58426794|gb|AAW75831.1| flagellar protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368032|dbj|BAE69190.1| flagellar protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188521212|gb|ACD59157.1| flagellar P-ring protein FlgI [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521404|gb|ACD59349.1| flagellar P-ring protein FlgI [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 372

 Score =  376 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 146/370 (39%), Positives = 211/370 (57%), Gaps = 8/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
                L   L     ++     RIKD+  +   R N L+GYGLVVGL G+GD    +PFT
Sbjct: 6   LSFRLLATLLGACVVVAPASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFT 65

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+++LL  LG++ P       KNVAAV + A LPPFA PG  ID++++S+ +A SLRG
Sbjct: 66  VQSLKNLLGELGVNVPANVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRG 125

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+M  L GADG +YA+AQG++VV G   +G   S     + + G+I NGAIVER LP 
Sbjct: 126 GSLLMAPLKGADGQVYAMAQGNLVVGGFGAQGKDGSRVSVNVPSVGRIPNGAIVERALPD 185

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LT 239
            F  + ++ L L   DF+T  R+   I+S     F    A A D  TV V  PT+     
Sbjct: 186 VFAGTGEITLNLHQNDFTTVSRMVAAIDS----SFGAGTARAVDGVTVAVRSPTDPGARI 241

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
            L+S +E + +   D PA+V++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP
Sbjct: 242 GLLSRLENVELSPGDAPAKVVVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQP 301

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
            AFS   + VTQ +T    S+    F       L+ ++  +N +G     +++IL+ +K 
Sbjct: 302 GAFSGGRTAVTQQSTITATSEGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQ 361

Query: 359 AGALQSEIII 368
           AGAL +E+ +
Sbjct: 362 AGALSAELEV 371


>gi|153831661|ref|ZP_01984328.1| flagellar P-ring protein FlgI [Vibrio harveyi HY01]
 gi|148872171|gb|EDL70988.1| flagellar P-ring protein FlgI [Vibrio harveyi HY01]
          Length = 373

 Score =  376 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 150/372 (40%), Positives = 224/372 (60%), Gaps = 11/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            F    L  +L       A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      F
Sbjct: 7   FFTSFLLALTLGLPATSQAEVEIPIMDLVDVQGIRENQLVGYGLVVGLAGQGDR-NQVKF 65

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +DV ++S+GDA SLR
Sbjct: 66  TAQSITNMLRQFGVQIDDSMNPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YA+AQGSVVV GL  +G+  S       T G+I NGA +ERE+ 
Sbjct: 126 GGTLLLTPLRGIDGEVYAIAQGSVVVGGLSAEGKSGSKVEVNTPTAGRIPNGATLEREIE 185

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-L 238
             F    ++ L LR P F+TA  IA +IN    N F   +A+A +   V++  P +    
Sbjct: 186 TDFNQRDEITLNLRKPSFTTAKNIAREIN----NTFGPNVAKAINKARVEMRAPMDTQQR 241

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
             +MS +E ++VE    PAR++ N RTGT+VIG NV++ +  VS+GNLTV+I+E++QV Q
Sbjct: 242 VTMMSMLEEMSVEEGRKPARIVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESQQVSQ 301

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF ++G T   + T + V++ +          +LN++++ +NS+G     ++SILQ +
Sbjct: 302 PNAF-ADGETKVVDQTQIDVNEEQAQMVIWPPGTELNTIVNAVNSLGATPTDLMSILQAL 360

Query: 357 KAAGALQSEIII 368
             AGAL +E+++
Sbjct: 361 NEAGALNAELVV 372


>gi|316932814|ref|YP_004107796.1| flagellar P-ring protein [Rhodopseudomonas palustris DX-1]
 gi|315600528|gb|ADU43063.1| flagellar P-ring protein [Rhodopseudomonas palustris DX-1]
          Length = 373

 Score =  376 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 160/356 (44%), Positives = 238/356 (66%), Gaps = 8/356 (2%)

Query: 16  HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI 75
             ++A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G+
Sbjct: 22  SGVAAGATSRIKDLANIEGIRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGV 81

Query: 76  STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
           +  G  + + NVAAVMVT NLP FA+ G+R+DV++++LGDA +L+GG L++T LLGADGN
Sbjct: 82  NIRGATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSALGDAKNLQGGTLLVTPLLGADGN 141

Query: 136 IYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           +YAVAQGS+ + G   +G+++    G+ T G+I NGAI+ERE+        ++ L LRN 
Sbjct: 142 VYAVAQGSLAIGGFQAEGEAAKITRGVPTVGRIANGAIIEREIEFALNRLPNVRLALRNS 201

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETD 253
           DF+TA RIA  +N Y         AE  D  TV++S P     +   L++E+E L VE D
Sbjct: 202 DFTTAKRIAAAVNDY----LGIKCAEPLDPSTVQLSIPAEFKGNAVALLTEIEQLQVEPD 257

Query: 254 TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
             A++II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN     G TV   N+
Sbjct: 258 QVAKIIIDERSGIIVMGRDVRVATVAVAQGNLTVSISESPQVSQPNPL-GGGRTVVTPNS 316

Query: 314 DLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + V+++      + D   L  L+ G+NS+G+    +I ILQ IKAAGA++++I +
Sbjct: 317 RIGVTEDGKKLAVVKDGVSLQQLVDGLNSLGIGPRDLIGILQAIKAAGAIEADIEV 372


>gi|222053735|ref|YP_002536097.1| flagellar P-ring protein [Geobacter sp. FRC-32]
 gi|221563024|gb|ACM18996.1| flagellar P-ring protein [Geobacter sp. FRC-32]
          Length = 364

 Score =  376 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 152/369 (41%), Positives = 221/369 (59%), Gaps = 9/369 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
                    L+ L      +  RIKD+ +    RDNQL+GYGLVVGL G+GDS   + F 
Sbjct: 1   MTRRTCTILLLLLLLPQLALAVRIKDIAAFDGVRDNQLLGYGLVVGLNGSGDSD-QTKFP 59

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
            QS+ + L+ +GI+     +  KNVAAVMVTA+LPPFA  G+ +DV ++S+GDA SL GG
Sbjct: 60  VQSLVNTLERMGITINRADITVKNVAAVMVTASLPPFAKQGNTLDVLVSSVGDAKSLAGG 119

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L G D  IYAVAQG+V+ +     GQ++S  +   T G++  GA+VERELP   
Sbjct: 120 TLLMTPLKGGDSQIYAVAQGAVLTNSFSYGGQAASVQKNHPTAGRVPAGALVERELPNVL 179

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTR 240
                L L L  PDF+TA RIA  +N     +F   +A   D  +V+++ P         
Sbjct: 180 AGRNVLRLNLHQPDFTTASRIAAAVN----GKFKAQVASLTDPGSVQLAMPDGFIGRPVE 235

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
            ++E+E L V  D  A+V++NERTGTIVIG+NVRIS V VS+GNLT+ + E  +V QP  
Sbjct: 236 FVAELERLEVTPDVMAKVVLNERTGTIVIGENVRISAVAVSHGNLTLYVKETPKVSQPAP 295

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAA 359
             + G T     T +KV + +GS +++    +++ ++  +N++G+    +I I+Q IKAA
Sbjct: 296 LGT-GETKVVPRTSVKVKEERGSLAIVPQGTNISDVVRALNALGVTPRDLIGIMQAIKAA 354

Query: 360 GALQSEIII 368
           GAL +E+ +
Sbjct: 355 GALNAELSV 363


>gi|323139656|ref|ZP_08074698.1| flagellar P-ring protein [Methylocystis sp. ATCC 49242]
 gi|322395088|gb|EFX97647.1| flagellar P-ring protein [Methylocystis sp. ATCC 49242]
          Length = 366

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/363 (47%), Positives = 253/363 (69%), Gaps = 2/363 (0%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L+ + + L    A  + RIKD+   Q  R+ QL+GYG+VVGLQGTGD++R+SPFTEQ+  
Sbjct: 5   LVIAAVFLVVTPASALVRIKDITYPQGPREYQLVGYGVVVGLQGTGDTMRNSPFTEQATS 64

Query: 68  SLLQNLGIST-PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L  +GI+  P   + ++N+AAVMVTA+LPPF + G+ +DV+++S+GDA+SL GG LV+
Sbjct: 65  AMLDRMGINVRPNNTMRTRNIAAVMVTASLPPFMNWGTTLDVTVSSMGDATSLMGGTLVL 124

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           TSL G DG +YA+AQG + VSG   +GQS +   G++T G+I NGA +ERE P+      
Sbjct: 125 TSLSGVDGQVYAIAQGPIAVSGFAAQGQSETLTHGVATVGRIPNGATIEREPPRATTSDG 184

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVE 246
            LILQLRNPD++T++ IAD +N+Y+  R+    A   D  +V ++ P +   TR ++E+ 
Sbjct: 185 GLILQLRNPDYATSVHIADAVNNYTRKRYRMTTARERDDHSVALALPRDCHATRFLAEIG 244

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            L +  +TPARV+++ERTGT+VIG +V+I  V V++G LTV++TE  +V QP  F SNG 
Sbjct: 245 ELKIAVETPARVVMDERTGTVVIGQDVQILPVAVTHGALTVRVTETPEVSQPAPF-SNGR 303

Query: 307 TVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           TV  + T++  S+ +   ++I  P L  L+ G+N +GLK  GIISILQ IK+AGALQ+++
Sbjct: 304 TVVTSQTNIAASETEAKVAIIAGPTLKQLVKGLNQVGLKPTGIISILQAIKSAGALQADL 363

Query: 367 IIQ 369
           IIQ
Sbjct: 364 IIQ 366


>gi|242278487|ref|YP_002990616.1| flagellar basal body P-ring protein [Desulfovibrio salexigens DSM
           2638]
 gi|242121381|gb|ACS79077.1| flagellar P-ring protein [Desulfovibrio salexigens DSM 2638]
          Length = 377

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 140/360 (38%), Positives = 218/360 (60%), Gaps = 8/360 (2%)

Query: 12  LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
            I L    +    R+KD+ S    RDN L+GYGLVVGL GTGD   +S FT  SM ++L+
Sbjct: 22  FIVLMSAQSAEAVRLKDISSFSGVRDNDLVGYGLVVGLSGTGDGT-NSAFTITSMINMLE 80

Query: 72  NLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
            +G+      +  KNVAAVMVTA +P  A PG+ +DV+++S+GD+ SL GG+L+MT L G
Sbjct: 81  KMGVQVDRASIKPKNVAAVMVTAKMPVSAKPGAPLDVTVSSIGDSKSLFGGVLLMTPLKG 140

Query: 132 ADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQ 191
            DG +YA+AQG++ V G    G++++  + + T  +I +GA +ER +P  F     + + 
Sbjct: 141 IDGKVYALAQGALTVGGFSASGEAATASKNVVTVARIPSGATIERSVPFDFNRQQKITIN 200

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLT 249
           L   DF T +++  +IN      +    A A D+ TV ++ P +   ++  LM+ +E L 
Sbjct: 201 LGVSDFGTTMQVVKRINGVVGGSY----ASAVDASTVDLAIPEHFRGNMVPLMAALENLE 256

Query: 250 VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG-STV 308
           +  DT A+V+++E+TGT+V+G NVR++KV +++GNL V I E   V QP  F+  G  TV
Sbjct: 257 IAPDTKAKVVVDEKTGTVVLGRNVRLTKVAIAHGNLQVVIAEGADVSQPGPFAPEGAETV 316

Query: 309 TQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           T   T+L V ++     L++   L  L+ G+N+IG     +ISIL+ +K AGAL +E+ +
Sbjct: 317 TTPETELAVEEDNNRLMLVEGATLQELVDGLNAIGATPRDLISILRTMKVAGALHAELEV 376


>gi|296103607|ref|YP_003613753.1| Flagellar P-ring protein 1, flgI [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058066|gb|ADF62804.1| Flagellar P-ring protein 1, flgI [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 375

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 143/371 (38%), Positives = 226/371 (60%), Gaps = 8/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           I     ++   + L         RI+D+ ++Q  R N L+GYGL+VGL GTGD    +PF
Sbjct: 8   ILFFLSILLYGMTLAVPKVVHAERIRDLATVQGVRSNSLMGYGLIVGLDGTGDQTMQAPF 67

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L  LGI+ P G  +  KN+AAVMVTA LPPFA PG ++D+ ++S+G+A SLR
Sbjct: 68  TGQSLNNMLSQLGITVPPGTNMQLKNIAAVMVTAELPPFARPGDKLDIVVSSVGNAKSLR 127

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L GAD  IYA+AQG++++SG   +   S        GG+I  GA VERE+P 
Sbjct: 128 GGTLLMTPLKGADNQIYAIAQGNILISGAGAQAGGSRVQVNQLNGGRISGGATVEREVPN 187

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLT 239
            F   + + LQL   DFS A +I+D IN     R+S   A   D+RTV++  P +     
Sbjct: 188 DFATQSIVRLQLNETDFSLAQQISDAINQ----RYSGGAALPEDARTVRLFAPPDGPSRV 243

Query: 240 RLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           R +++++ + +  +   A+VI+N RTG++V+  +V +    V++G+LTV++ +N  + QP
Sbjct: 244 RFLADIQDIPLRVNVQDAKVIVNSRTGSVVMNRHVSLDACAVAHGSLTVEVMQNNIISQP 303

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           +     G TV    TD+ V D+ GS   +  + DLN++I  +NS+G   + ++S+LQ +K
Sbjct: 304 DTPFGGGETVVVPQTDISVRDSGGSLQHVRSSTDLNAVIRALNSLGATPNELMSVLQAMK 363

Query: 358 AAGALQSEIII 368
           +AG L++++ +
Sbjct: 364 SAGCLRAKLEV 374


>gi|152997578|ref|YP_001342413.1| flagellar P-ring protein [Marinomonas sp. MWYL1]
 gi|189044485|sp|A6W199|FLGI_MARMS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|150838502|gb|ABR72478.1| flagellar P-ring protein [Marinomonas sp. MWYL1]
          Length = 362

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 139/365 (38%), Positives = 219/365 (60%), Gaps = 12/365 (3%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           I  ++      +    R+KD+ S+Q  R+NQL GYGLV+GL GTGDS   + FT QS  S
Sbjct: 4   IALIVLYFLSFSVQAERLKDIASVQGVRENQLFGYGLVIGLNGTGDS---TAFTNQSFVS 60

Query: 69  LLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +L   G++ P G    SKNVAAV +TA LP F+ PG +IDV+++S+G+AS+LRGG L+++
Sbjct: 61  MLSRFGVTLPEGVNATSKNVAAVSLTATLPAFSKPGQKIDVTVSSIGNASALRGGTLLLS 120

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           +L GADG +YA+AQG++VV GL   G   S     + T G+I NGA VER +P  F    
Sbjct: 121 TLKGADGAVYAIAQGNLVVGGLGANGADGSRTTGNVPTVGRIPNGASVERIVPSSFNTGD 180

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEV 245
            L   L  PDF+TA ++ D+IN+         +A   D+ +++VS P +       +S +
Sbjct: 181 TLTFNLNRPDFTTAKQVTDKINNL----LGPGVATTLDATSIRVSAPRDSSQRVTYLSIL 236

Query: 246 EMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           E L VE  +  AR+++N RTGTI+IG +V++S   +++G+LTV I E   VV  +   + 
Sbjct: 237 ENLDVEVAEERARIVVNSRTGTIIIGQHVKVSPAAITHGSLTVTIKEVPPVVGKDGTITG 296

Query: 305 GSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G T+      ++++ N G  F       L+ ++  +N +G     +++IL+G+K AGA+ 
Sbjct: 297 GQTIVSPREGIEIAPNSGHMFVFDPGASLDDIVRAVNQVGAAPGDVMAILEGLKQAGAIN 356

Query: 364 SEIII 368
           +++++
Sbjct: 357 ADLVV 361


>gi|84028133|sp|Q89I01|FLGI1_BRAJA RecName: Full=Flagellar P-ring protein 1; AltName: Full=Basal body
           P-ring protein 1; Flags: Precursor
          Length = 374

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 160/355 (45%), Positives = 240/355 (67%), Gaps = 8/355 (2%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
             SA   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++
Sbjct: 24  VTSASATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVN 83

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
             G  + + NVAAVMVT NLP FA+ G+R+DV++++LGDA +L+GG L++T LLGADGN+
Sbjct: 84  IRGATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSALGDAKNLQGGTLLVTPLLGADGNV 143

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAVAQGS+ +SG   +G+++  + G+ T G+I NGAI+ERE+        ++ L LRN D
Sbjct: 144 YAVAQGSLAISGFQAEGEAAKIVRGVPTVGRIANGAIIEREIEFALNRLPNVRLALRNAD 203

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDT 254
           F+TA RIA  +N Y         AE  D  TV++S P     ++   ++E+E L V+ D 
Sbjct: 204 FTTAKRIAAAVNDY----LGVKTAEPIDPSTVQLSIPPEFKGNVVAFLTEIEQLQVDPDL 259

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A+++I+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   S G TV    + 
Sbjct: 260 AAKIVIDERSGIIVMGRDVRVATVAVAQGNLTVTISESPQVSQPNPL-SRGRTVVAPRSS 318

Query: 315 LKVSDNKGSFSL-IDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + V+++    +L  D   L  L+ G+N +G+    +ISILQ IKAAGA++++I +
Sbjct: 319 VSVTEDGRKLALVKDGVSLQQLVDGLNGLGIGPRDMISILQAIKAAGAIEADIEV 373


>gi|156976145|ref|YP_001447051.1| flagellar basal body P-ring protein [Vibrio harveyi ATCC BAA-1116]
 gi|156527739|gb|ABU72824.1| hypothetical protein VIBHAR_04916 [Vibrio harveyi ATCC BAA-1116]
          Length = 378

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 150/372 (40%), Positives = 225/372 (60%), Gaps = 11/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            F    L  +L       A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      F
Sbjct: 12  FFTSFLLALTLGLPATSQAEVEIPIMDLVDVQGIRENQLVGYGLVVGLAGQGDR-NQVKF 70

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +DV ++S+GDA SLR
Sbjct: 71  TAQSITNMLRQFGVQIDDSMNPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLR 130

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YA+AQGSVVV GL  +G+  S       T G+I NGA +ERE+ 
Sbjct: 131 GGTLLLTPLRGIDGEVYAIAQGSVVVGGLSAEGKSGSKVEVNTPTAGRIPNGATLEREIE 190

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-L 238
             F    ++ L LR P F+TA  IA +IN    N F   +A+A +   V++  P +    
Sbjct: 191 TDFNQRDEITLNLRKPSFTTAKNIAREIN----NTFGPNVAKAINKARVEMRAPMDTQQR 246

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
             +MS +E ++VE    PAR++ N RTGT+VIG NV++ +  VS+GNLTV+I+E++QV Q
Sbjct: 247 VTMMSMLEEMSVEEGRKPARIVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESQQVSQ 306

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF ++G T   + T ++V++ +          +LN++++ +NS+G     ++SILQ +
Sbjct: 307 PNAF-ADGETKVVDQTQIEVNEEQAQMVIWPPGTELNTIVNAVNSLGATPTDLMSILQAL 365

Query: 357 KAAGALQSEIII 368
             AGAL +E+++
Sbjct: 366 NEAGALNAELVV 377


>gi|332533171|ref|ZP_08409040.1| flagellar P-ring protein FlgI [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037453|gb|EGI73907.1| flagellar P-ring protein FlgI [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 364

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 138/371 (37%), Positives = 205/371 (55%), Gaps = 13/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
                 +  ++ L         RIKDV  ++  R NQL+GYGLVVGL GTG+    + +T
Sbjct: 1   MNSLKALCLVVLLGWQFTASAERIKDVSMVEGVRSNQLVGYGLVVGLPGTGE---QNSYT 57

Query: 63  EQSMRSLLQNLGISTPGGR-LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           +QS R +L + GI+ P  +    KNVAAV V A LP F  PG  ID++++S+G A SLRG
Sbjct: 58  QQSFRGMLNSFGITLPSTQSPKIKNVAAVAVHAELPAFRKPGQTIDITVSSIGSAGSLRG 117

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DGN+YA+AQGS++V GL  +G   S  +    T G+I NGA VER +  
Sbjct: 118 GTLLQTFLKGVDGNVYAIAQGSLIVGGLGAQGLDGSRVVINTPTVGRIPNGATVERTVES 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L  PDF+TA R+   IN           A+A DS +++V  P +     
Sbjct: 178 PFMQGDYITFNLNRPDFTTAKRLEKTINDLV----GPNSAQAIDSVSIRVIAPRDASQRV 233

Query: 240 RLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L     D  A++I+N RTGTIVIG NV++    +++G LTV I E + V QP
Sbjct: 234 SYLSTLENLEFNPADMAAKIIVNSRTGTIVIGKNVKLQPAAITHGGLTVTIAEQQNVSQP 293

Query: 299 NAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N   +NG TV    + + V+ +   +F       L+ L+  +N +G     +++IL+ +K
Sbjct: 294 NPL-ANGDTVVTQQSIIDVNQDDSRAFVFNPGVSLDDLVRAINEVGAAPGDLMAILEALK 352

Query: 358 AAGALQSEIII 368
            AGA+  ++++
Sbjct: 353 EAGAINGQLVV 363


>gi|91976155|ref|YP_568814.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           BisB5]
 gi|123749198|sp|Q13AH6|FLGI_RHOPS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|91682611|gb|ABE38913.1| flagellar P-ring protein [Rhodopseudomonas palustris BisB5]
          Length = 373

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 158/354 (44%), Positives = 237/354 (66%), Gaps = 8/354 (2%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
           ++A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++ 
Sbjct: 24  VAASATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNI 83

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
            G  + + NVAAVMVT NLP FA+ G+R+DV++++LGDA +L+GG L++T LLGADGN+Y
Sbjct: 84  RGATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSALGDAKNLQGGTLLVTPLLGADGNVY 143

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           AVAQGS+ + G   +G+++    G+ T G+I NGAI+ERE+        ++ L LRN DF
Sbjct: 144 AVAQGSLAIGGFQAEGEAAKITRGVPTVGRIANGAIIEREIEFALNRLPNVRLALRNADF 203

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTP 255
           +TA RIA  +N +         AE  D  TV++S P     +    ++E+E L VE D  
Sbjct: 204 TTAKRIAAAVNDF----LGTKSAEPIDPSTVQLSIPAEFKGNAVAFLTEIEQLQVEPDQA 259

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A++II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   S G T    N+ +
Sbjct: 260 AKIIIDERSGIIVMGRDVRVATVAVAQGNLTVSISESPQVSQPNPL-SRGRTTVTPNSRI 318

Query: 316 KVSDNKGSFSL-IDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            V+++    +L  D   L  L+ G+N +G+    +I ILQ IKAAGA++++I +
Sbjct: 319 GVTEDGKKLALVKDGVSLQQLVDGLNGLGIGPRDLIGILQAIKAAGAIEADIEV 372


>gi|292900248|ref|YP_003539617.1| flagellar P-ring protein [Erwinia amylovora ATCC 49946]
 gi|291200096|emb|CBJ47222.1| flagellar P-ring protein [Erwinia amylovora ATCC 49946]
          Length = 373

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 143/377 (37%), Positives = 221/377 (58%), Gaps = 14/377 (3%)

Query: 1   MIFRIAFL-----IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDS 55
           M+ +   L     +   + +   +A    RI+D+ ++Q  R N L+GYGLVVGL GTGD 
Sbjct: 1   MMKKQTLLMSVGMLLCSLLVALPNAACAERIRDLTTVQGVRPNTLMGYGLVVGLDGTGDQ 60

Query: 56  LRSSPFTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLG 114
              +PFT QS+ ++L  LGI+ P G  +  KN+AAVMVTA LP F+ PG RID+ ++SLG
Sbjct: 61  TMQAPFTGQSLNNMLSQLGITVPAGTNMQLKNIAAVMVTAELPAFSRPGDRIDIVVSSLG 120

Query: 115 DASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIV 174
           +A SLRGG L+MT L GAD  IYA+AQG+V++SG   +   S        GG+I  GA V
Sbjct: 121 NAKSLRGGTLLMTPLKGADTQIYALAQGNVLISGAGAQAGGSRVQVNQLNGGRISGGATV 180

Query: 175 ERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT 234
           ERE+P  F     L LQL   DFS A +I+D IN           A   D+RTV++  PT
Sbjct: 181 EREVPNDFARQTALRLQLNETDFSLAQQISDAINRRF-----SGGAVPEDARTVRLFGPT 235

Query: 235 N-IDLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
           +     R ++ ++ + +      A+VI+N RTG++V+  +V +    +++G LTV++ +N
Sbjct: 236 DGPSRVRFLANIQDIPLHVAVQDAKVIVNSRTGSVVMNRHVTLESCAIAHGGLTVEVAQN 295

Query: 293 EQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIIS 351
             + QP+   + G TV      + V D+ G+   +  + DLN+++  +N +G   + ++S
Sbjct: 296 NLISQPDTPLAGGETVVVPQAQISVRDSGGALQRVNSSADLNNVVRALNGLGATPNELMS 355

Query: 352 ILQGIKAAGALQSEIII 368
           ILQ +K+AG L++++ I
Sbjct: 356 ILQAMKSAGCLRAKLEI 372


>gi|117926376|ref|YP_866993.1| flagellar basal body P-ring protein [Magnetococcus sp. MC-1]
 gi|117610132|gb|ABK45587.1| flagellar P-ring protein [Magnetococcus sp. MC-1]
          Length = 386

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 161/367 (43%), Positives = 219/367 (59%), Gaps = 9/367 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             +  L  ++  L   S    +R+KDVV+++  RDN L GYGL+VGL GTGDS  S+ FT
Sbjct: 25  LTVLALAVTMGLLLTSSPAQATRLKDVVTIEGVRDNPLNGYGLLVGLNGTGDS--SAAFT 82

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           +QSM+ +LQ +GIS        KNVAAVMVTA LPPFA  G+++DV+I SLGDA SL GG
Sbjct: 83  QQSMQQMLQRMGISMST-LPKVKNVAAVMVTATLPPFARQGNKVDVTIASLGDAKSLEGG 141

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            LVMT L  ADG IYAVAQG V V G    G   +  +   T  +I +GA VERE+  K 
Sbjct: 142 TLVMTPLRAADGRIYAVAQGPVSVGGFSAGGAGGNVQKNFPTVARIADGATVEREVDFKL 201

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTR 240
                L L L+  DF+TA R+   IN      F  P+A A DS TVKV  P +    +  
Sbjct: 202 ARETSLQLALKEHDFTTANRVVSAINGL----FGEPLAHALDSGTVKVQVPPSYKGRVVE 257

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
            +S +E   VE DT A V++NERTGTIV+G+NVR+S V +S+G L+++IT+  QV QPN 
Sbjct: 258 FVSRMEGAEVEVDTRAVVVVNERTGTIVMGENVRVSTVALSHGALSIRITDTPQVSQPNP 317

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            +   + V           +     + +   L  L+ G+N++G+    +I+ILQ IKA+G
Sbjct: 318 LAGGDTAVVNQRDVQVTEKDARLVQMEEGVTLGDLVKGLNNLGVTPRDLIAILQAIKASG 377

Query: 361 ALQSEII 367
           ALQ+++ 
Sbjct: 378 ALQADLE 384


>gi|292489129|ref|YP_003532016.1| flagellar P-ring protein [Erwinia amylovora CFBP1430]
 gi|291554563|emb|CBA22173.1| Flagellar P-ring protein precursor [Erwinia amylovora CFBP1430]
 gi|312173287|emb|CBX81542.1| Flagellar P-ring protein precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 374

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 143/378 (37%), Positives = 221/378 (58%), Gaps = 15/378 (3%)

Query: 1   MIFRIAFLI------FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGD 54
           M+ +   L+         + +   +A    RI+D+ ++Q  R N L+GYGLVVGL GTGD
Sbjct: 1   MMMKKQTLLMSVGMLLCSLLVALPNAACAERIRDLTTVQGVRPNTLMGYGLVVGLDGTGD 60

Query: 55  SLRSSPFTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSL 113
               +PFT QS+ ++L  LGI+ P G  +  KN+AAVMVTA LP F+ PG RID+ ++SL
Sbjct: 61  QTMQAPFTGQSLNNMLSQLGITVPAGTNMQLKNIAAVMVTAELPAFSRPGDRIDIVVSSL 120

Query: 114 GDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAI 173
           G+A SLRGG L+MT L GAD  IYA+AQG+V++SG   +   S        GG+I  GA 
Sbjct: 121 GNAKSLRGGTLLMTPLKGADTQIYALAQGNVLISGAGAQAGGSRVQVNQLNGGRISGGAT 180

Query: 174 VERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP 233
           VERE+P  F     L LQL   DFS A +I+D IN           A   D+RTV++  P
Sbjct: 181 VEREVPNDFARQTALRLQLNETDFSLAQQISDAINRRF-----SGGAVPEDARTVRLFGP 235

Query: 234 TN-IDLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITE 291
           T+     R ++ ++ + +      A+VI+N RTG++V+  +V +    +++G LTV++ +
Sbjct: 236 TDGPSRVRFLANIQDIPLHVAVQDAKVIVNSRTGSVVMNRHVTLESCAIAHGGLTVEVAQ 295

Query: 292 NEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGII 350
           N  + QP+   + G TV      + V D+ G+   +  + DLN+++  +N +G   + ++
Sbjct: 296 NNLISQPDTPLAGGETVVVPQAQISVRDSGGALQRVNSSADLNNVVRALNGLGATPNELM 355

Query: 351 SILQGIKAAGALQSEIII 368
           SILQ +K+AG L++++ I
Sbjct: 356 SILQAMKSAGCLRAKLEI 373


>gi|255261799|ref|ZP_05341141.1| flagellar P-ring protein FlgI [Thalassiobium sp. R2A62]
 gi|255104134|gb|EET46808.1| flagellar P-ring protein FlgI [Thalassiobium sp. R2A62]
          Length = 369

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 165/374 (44%), Positives = 237/374 (63%), Gaps = 10/374 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVV-SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           M      LI  +IG    S      R+KD+V     R N L+GYGLVVGL G+GD LR+S
Sbjct: 1   MRATFHILISVMIGFCVSSVSASPIRLKDLVEFDGVRGNDLVGYGLVVGLNGSGDGLRNS 60

Query: 60  PFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           PFTE+ + S+L+ LG++  G +   KNVAAV+VTA LPPFA  G  IDV+++++GDA SL
Sbjct: 61  PFTEEILSSILERLGVNVAGEQFRPKNVAAVLVTATLPPFARAGGTIDVTVSAIGDAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG LVMT L  ADG IYAVAQG ++  G  V+G+++   +G+ T G I +GA VERE+ 
Sbjct: 121 RGGTLVMTPLNAADGEIYAVAQGPMIAGGAVVEGEAARVTQGVPTAGVIPSGARVEREIL 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL- 238
            +  +   + L LR PDF+TA RI   IN      F R +A+  DS TV+++  +     
Sbjct: 181 FELDELEIVRLALRTPDFTTAGRIETAINQ----SFGRSVAQMTDSGTVELNIASTRMRS 236

Query: 239 -TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
               +S VE + VE +  ARV+I++R+GTIV+GD+VRIS V VS G LT+++ E  Q VQ
Sbjct: 237 TAHALSRVENILVEPERRARVVIDQRSGTIVLGDDVRISSVAVSQGGLTLRVQELPQAVQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           PN F + G TV    T++ + +N+G+    + +   L+ +I G+N++G+  + +I IL+ 
Sbjct: 297 PNPF-APGETVVVPKTNVAIEENQGAGLAQVNEGTSLSEVIQGLNALGVAPNDMIDILKS 355

Query: 356 IKAAGALQSEIIIQ 369
           IK+AGAL +E I+Q
Sbjct: 356 IKSAGALHAEFIVQ 369


>gi|153837076|ref|ZP_01989743.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ3810]
 gi|260365776|ref|ZP_05778272.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus K5030]
 gi|260880698|ref|ZP_05893053.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AN-5034]
 gi|260897696|ref|ZP_05906192.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus Peru-466]
 gi|260899393|ref|ZP_05907788.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ4037]
 gi|90112108|sp|Q87JI2|FLGI1_VIBPA RecName: Full=Flagellar P-ring protein 1; AltName: Full=Basal body
           P-ring protein 1; Flags: Precursor
 gi|149749664|gb|EDM60409.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ3810]
 gi|308086214|gb|EFO35909.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus Peru-466]
 gi|308092366|gb|EFO42061.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AN-5034]
 gi|308109308|gb|EFO46848.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus AQ4037]
 gi|308115027|gb|EFO52567.1| flagellar P-ring protein FlgI [Vibrio parahaemolyticus K5030]
 gi|328470105|gb|EGF41016.1| flagellar basal body P-ring protein [Vibrio parahaemolyticus 10329]
          Length = 373

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 150/372 (40%), Positives = 221/372 (59%), Gaps = 11/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            F    L  +L       A+V   I D+V ++  R+NQL+GYGLVVGL G GD      F
Sbjct: 7   FFSSFLLALTLGLPATSQAEVEIPIMDLVDVRGIRENQLVGYGLVVGLAGQGDR-NQVKF 65

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +DV ++S+GDA SLR
Sbjct: 66  TSQSITNMLRQFGVQIDDSMDPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YA+AQGSVVV GL  +G+  S       T G++ NGA +ERE+ 
Sbjct: 126 GGTLLLTPLRGIDGEVYAIAQGSVVVGGLSAEGKSGSKVEVNTPTAGRVPNGATLEREIK 185

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-L 238
             F    ++ L LR P F+TA  IA +IN    N F   +A A +   V +  P +    
Sbjct: 186 TDFNQRDEITLNLRKPSFTTAKNIAREIN----NTFGPNVAVAINKARVDMRAPKDTQQR 241

Query: 239 TRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
             +MS +E ++V E   PAR++ N RTGT+VIG NV++ +  VS+GNLTV+I+E+E+V Q
Sbjct: 242 VIMMSMLEEMSVVEGRKPARIVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESEKVSQ 301

Query: 298 PNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF ++G T   N TD+ V++            +LN+++  +NS+G     ++SILQ +
Sbjct: 302 PNAF-ADGETKVVNQTDIDVNEELAQMVIWPPGTELNTIVDAVNSLGATPTDLMSILQAL 360

Query: 357 KAAGALQSEIII 368
             AGAL +E+++
Sbjct: 361 NEAGALNAELVV 372


>gi|239907789|ref|YP_002954530.1| flagellar P-ring protein precursor [Desulfovibrio magneticus RS-1]
 gi|239797655|dbj|BAH76644.1| flagellar P-ring protein precursor [Desulfovibrio magneticus RS-1]
          Length = 394

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/366 (42%), Positives = 236/366 (64%), Gaps = 8/366 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +A LI + + L  +     +RIKD+ ++   R NQL+GYGLVVGL GTGD  R S FT Q
Sbjct: 34  LAVLILAALVLGVVHTAHSARIKDLATVSGMRKNQLVGYGLVVGLSGTGDQ-RGSDFTVQ 92

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           S+ ++L  +G+      L  KNVAAVMVTA +P  +  GSR+DV+++S+GD++SL GG+L
Sbjct: 93  SIYNMLDKMGVRVDKATLKPKNVAAVMVTAQMPVSSKAGSRLDVTVSSIGDSTSLLGGVL 152

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           ++T L G DGNIYA+AQGSV+V G+  +G  +S  + I+T G +  G  +ER +P  F D
Sbjct: 153 LVTPLKGIDGNIYAIAQGSVLVGGVSAQGAGASVSKNITTVGMVPGGGNIERSVPFAFND 212

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN--IDLTRLM 242
             DL L LRNPDFSTA R+A ++N        + +A A D+ T++++ P     +L  LM
Sbjct: 213 QPDLTLSLRNPDFSTATRLAKRVNE----SLGQAMATAIDAGTIRLAVPPENQGNLAMLM 268

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           + +E L V  D  ARV+++E+TGT+V+G NV+IS V V++GNL +Q+ E+  V QP  F 
Sbjct: 269 ASIENLDVTPDHRARVVVDEKTGTVVLGQNVQISPVAVTHGNLQIQVQESADVSQPLPF- 327

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
           SNG TV    T++ V++      +I+   L  L+ G+N++G     +IS+L+ ++A+GAL
Sbjct: 328 SNGRTVVTPETNIAVNEENRKLKMIEGATLQELVEGLNALGATPRDLISVLRTLEASGAL 387

Query: 363 QSEIII 368
            +++ +
Sbjct: 388 SADLEV 393


>gi|163803173|ref|ZP_02197056.1| flagellar P-ring protein precursor [Vibrio sp. AND4]
 gi|159173073|gb|EDP57906.1| flagellar P-ring protein precursor [Vibrio sp. AND4]
          Length = 373

 Score =  375 bits (962), Expect = e-102,   Method: Composition-based stats.
 Identities = 148/372 (39%), Positives = 225/372 (60%), Gaps = 11/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            F    L  +L       A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      F
Sbjct: 7   FFSSFLLAMALGLPATSQAEVEIPIMDLVDVQGIRENQLVGYGLVVGLAGQGDR-NQVKF 65

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +DV ++S+GDA SLR
Sbjct: 66  TAQSITNMLRQFGVQIDDSMNPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YA+AQGSVVV GL  +G+  S       T G+I NGA +ERE+ 
Sbjct: 126 GGTLLLTPLRGIDGEVYAIAQGSVVVGGLSAEGKSGSKVEVNTPTAGRIPNGATIEREIE 185

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-L 238
             F    ++ L LR P F+TA  IA +IN    N F   +A+A +   V++  P +    
Sbjct: 186 TDFNQRDEITLNLRKPSFTTAKNIARKIN----NTFGPNVAKAINKARVEMRAPMDTQQR 241

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
             +MS +E ++VE    PAR++ N RTGT+VIG NV++ +  VS+GNLTV+++E++QV Q
Sbjct: 242 VTMMSMLEEMSVEEGRKPARIVFNARTGTVVIGKNVKVGEAAVSHGNLTVRVSESQQVSQ 301

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF ++G T   + + + V++++          +LN++++ +NS+G     ++SILQ +
Sbjct: 302 PNAF-ADGKTEVVDQSQIDVNEDQAKMVIWPPGTELNTIVNAVNSLGATPTDLMSILQAL 360

Query: 357 KAAGALQSEIII 368
             AGAL +E+++
Sbjct: 361 NEAGALNAELVV 372


>gi|262173358|ref|ZP_06041035.1| flagellar P-ring protein FlgI [Vibrio mimicus MB-451]
 gi|261890716|gb|EEY36703.1| flagellar P-ring protein FlgI [Vibrio mimicus MB-451]
          Length = 373

 Score =  375 bits (962), Expect = e-102,   Method: Composition-based stats.
 Identities = 149/372 (40%), Positives = 224/372 (60%), Gaps = 11/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            F    ++ +L  +    A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      F
Sbjct: 7   FFSSFLIVLTLGFVPTSQAKVEIPIMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKF 65

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +DV ++S+GDA SLR
Sbjct: 66  TAQSITNMLRQFGVQIDDNMDPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YAVAQG+VVV GL  +G+  S       T G+I NGA +ERE+ 
Sbjct: 126 GGTLLLTPLRGIDGELYAVAQGNVVVGGLSAEGKSGSKVAVNTPTAGRIPNGATLEREIS 185

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-L 238
             F     + L LR P F+TA  IA +IN    N F   +A + +  ++ +  P +    
Sbjct: 186 TDFNKRDQITLNLRKPSFTTAKNIAQEIN----NTFGPNVAVSVNKTSINMRAPKDTQQR 241

Query: 239 TRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
             +M+ +E ++V E   PARV+ N RTGT+VIG NV++ +  VS+GNLTV+I+E++QV Q
Sbjct: 242 VEMMAMLEEMSVVEGRKPARVVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESQQVSQ 301

Query: 298 PNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF + G T T + T + VS++           +LN++++ +NS+G     ++SILQ +
Sbjct: 302 PNAF-AGGETETIDQTRIDVSEDQNRMMIWPPGTELNTIVNAINSLGATPTDLMSILQAL 360

Query: 357 KAAGALQSEIII 368
             AGAL +E+++
Sbjct: 361 YEAGALNAELVV 372


>gi|75675304|ref|YP_317725.1| flagellar basal body P-ring protein [Nitrobacter winogradskyi
           Nb-255]
 gi|115311526|sp|Q3STL8|FLGI_NITWN RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|74420174|gb|ABA04373.1| Flagellar P-ring protein [Nitrobacter winogradskyi Nb-255]
          Length = 374

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 163/351 (46%), Positives = 239/351 (68%), Gaps = 8/351 (2%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
              SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PFT+QS++++L+ +G++  G 
Sbjct: 28  HATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPFTKQSLQAMLERMGVNIRGA 87

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
            + + NVAAVMVT NLP FA+ G+R+DV+++++GDA SL+GG L++T LLGADGN+YAVA
Sbjct: 88  TIRTGNVAAVMVTGNLPAFATQGTRMDVTVSAMGDARSLQGGTLLVTPLLGADGNVYAVA 147

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QGS+ + G   +G ++S  +G+ T G+I NGAIVERE+        ++ L LRN DF+TA
Sbjct: 148 QGSLAIGGFSAEGAAASVTKGVPTNGRIANGAIVEREIEFALNRMPNVRLALRNGDFTTA 207

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARV 258
            RIA  +N +         AE  D  TV++S P     ++  L++E+E L VE D  A++
Sbjct: 208 KRIAAAVNDF----LGTKTAEPIDPSTVQLSIPAEFRGNVVALLTEIEQLQVEPDITAKI 263

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN   SNG TV    TD+ V+
Sbjct: 264 IIDERSGIIVMGRDVRVATVAVAQGNLTVSISESPQVSQPNPL-SNGRTVMTPRTDVGVT 322

Query: 319 DNKGSFSL-IDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +N    +L  +   L  L+ G+N +G+    +I ILQ IKAAGA++++I +
Sbjct: 323 ENGNKLALVKNGVSLQELVDGLNGLGIGPRDLIGILQAIKAAGAIEADIEV 373


>gi|21231393|ref|NP_637310.1| flagellar basal body P-ring protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768554|ref|YP_243316.1| flagellar basal body P-ring protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|48474490|sp|Q8P9C0|FLGI_XANCP RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|81305474|sp|Q4UUH7|FLGI_XANC8 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|21113058|gb|AAM41234.1| flagellar protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66573886|gb|AAY49296.1| flagellar protein [Xanthomonas campestris pv. campestris str. 8004]
          Length = 372

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/353 (40%), Positives = 205/353 (58%), Gaps = 8/353 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
                RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P 
Sbjct: 23  PASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPA 82

Query: 80  G-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
                 KNVAAV + A LPPFA PG  ID++++S+ +A SLRGG L+M  L GADG +YA
Sbjct: 83  NVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRGGSLLMAPLKGADGQVYA 142

Query: 139 VAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           +AQG++VV G   +G   S     I + G+I NGA VER LP  F  S ++ L L   DF
Sbjct: 143 MAQGNLVVGGFGAQGKDGSRVSVNIPSVGRIPNGATVERALPDVFAGSGEITLNLHQNDF 202

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET-DTP 255
           +T  R+   I+    N F    A A D  TV V  PT+      L++ +E + +   D P
Sbjct: 203 TTVSRMVAAID----NSFGAGTARAVDGVTVSVRSPTDPSARIGLLARLENVELSPGDAP 258

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+V++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VT  +T  
Sbjct: 259 AKVVVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTPQSTIK 318

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             S+    F       L+ ++  +N +G     +++IL+ +K AGAL +E+ +
Sbjct: 319 ATSEGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAELEV 371


>gi|167647651|ref|YP_001685314.1| flagellar basal body P-ring protein [Caulobacter sp. K31]
 gi|189044483|sp|B0T853|FLGI_CAUSK RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|167350081|gb|ABZ72816.1| flagellar P-ring protein [Caulobacter sp. K31]
          Length = 371

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 166/364 (45%), Positives = 234/364 (64%), Gaps = 8/364 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L  + + +    A   SRIKD+V+ +  RDNQLIGYG+VVGL G+GDSLR++P T+QS+ 
Sbjct: 12  LALAAMTVMAAPADAKSRIKDIVAFEGVRDNQLIGYGIVVGLNGSGDSLRNAPMTKQSLE 71

Query: 68  SLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           ++L+  G++   G L +KN AAVMVTANLPPF++ G+R+DV++++LGDA SL GG L++T
Sbjct: 72  AMLERQGVNVRDGNLNTKNTAAVMVTANLPPFSAAGARMDVTVSTLGDAKSLLGGTLLVT 131

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           +L GADG  YAVAQGSV    +   G   SS  +G+ T G+I  G I+E+E   +     
Sbjct: 132 ALQGADGQTYAVAQGSVQTGSVSAGGASGSSVTKGVPTAGRIAAGGIIEKETGFQMVSMD 191

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVE 246
            L + LRNPDF+T+ RIAD IN           A+A +   V V  P  +D+   ++ +E
Sbjct: 192 VLRMTLRNPDFTTSRRIADVINGRF-----PGCAQAQNPTIVAVRPPAGMDMISFVTAIE 246

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            L VE D PA+VII+E  G IV+GD+VRIS+V ++ GNLT+ + EN  V QP  FS  G 
Sbjct: 247 NLEVEPDAPAKVIIDEVAGVIVMGDDVRISQVAIAQGNLTISVQENPAVSQPTPFSRGGQ 306

Query: 307 TVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
           TV    + + + + KG    +L     L SLI G+N++G+    +ISILQ IKA+GALQ+
Sbjct: 307 TVVVPQSAVSIEEEKGKKLLTLGGGASLKSLIGGLNALGVTPRDMISILQAIKASGALQA 366

Query: 365 EIII 368
           EI +
Sbjct: 367 EIEV 370


>gi|302878280|ref|YP_003846844.1| flagellar P-ring protein [Gallionella capsiferriformans ES-2]
 gi|302581069|gb|ADL55080.1| flagellar P-ring protein [Gallionella capsiferriformans ES-2]
          Length = 362

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 154/363 (42%), Positives = 219/363 (60%), Gaps = 8/363 (2%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           I +++ L         RIKDV S+Q  RDNQL+GYGLVVGL G+GD    +PFT QS+ S
Sbjct: 4   IIAVLLLLLPFTAFADRIKDVASIQGVRDNQLLGYGLVVGLDGSGDQTTQTPFTVQSIIS 63

Query: 69  LLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +L  +G++ P G  L  KNVAAVMVTA+LPPF+ PG  IDV+ +S+G+A SLRGG L+MT
Sbjct: 64  MLSQMGVNLPQGTSLQLKNVAAVMVTASLPPFSKPGQTIDVTASSMGNAKSLRGGTLLMT 123

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD 187
            L GADG +YA+AQG+V+V G+      +S      + G++  GA VER +P        
Sbjct: 124 PLKGADGQVYAMAQGNVLVGGVGASAGGASVQVNHLSVGRVPAGATVERAVPTLLGQGEF 183

Query: 188 LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEM 247
           + L+LR+ DF+TA RI D INS      +  IA A D R ++V  P    L   +S +E 
Sbjct: 184 IHLELRSNDFTTATRIVDVINSQI----APDIAVAQDGRMIEVRAPQGNGLVAFISRIEN 239

Query: 248 LTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
           L + +    A+VIIN RTG+IV+   V +    V++GNLTV I  +    QPNA  S+G 
Sbjct: 240 LEINQAQGIAKVIINARTGSIVMNQAVTLDACAVAHGNLTVVINTDSTASQPNA-RSDGR 298

Query: 307 TVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSE 365
           TV  + T + V  +KG    L     L+ ++  +N+IG     +++ILQ +K++GAL +E
Sbjct: 299 TVVTDKTTIDVKSDKGGLVELSKGVSLSEVVKALNAIGATPQDLLAILQAMKSSGALHAE 358

Query: 366 III 368
           + +
Sbjct: 359 LEV 361


>gi|188991637|ref|YP_001903647.1| flagellar basal body P-ring protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|226701965|sp|B0RT12|FLGI_XANCB RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|167733397|emb|CAP51598.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 372

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/353 (40%), Positives = 205/353 (58%), Gaps = 8/353 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
                RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P 
Sbjct: 23  PASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPA 82

Query: 80  G-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
                 KNVAAV + A LPPFA PG  ID++++S+ +A SLRGG L+M  L GADG +YA
Sbjct: 83  NVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRGGSLLMAPLKGADGQVYA 142

Query: 139 VAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           +AQG++VV G   +G   S     I + G+I NGA VER LP  F  S ++ L L   DF
Sbjct: 143 MAQGNLVVGGFGAQGKDGSRVSVNIPSVGRIPNGATVERALPDVFAGSGEITLNLHQNDF 202

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET-DTP 255
           +T  R+   I+    N F    A A D  TV V  PT+      L++ +E + +   D P
Sbjct: 203 TTVSRMVAAID----NSFGAGTARAVDGVTVSVRSPTDPSARIGLLARLENVELSPGDAP 258

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+V++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VT  +T  
Sbjct: 259 AKVVVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTPQSTIK 318

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             S+    F       L+ ++  +N +G     +++IL+ +K AGAL +E+ +
Sbjct: 319 ATSEGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAELEV 371


>gi|119385426|ref|YP_916482.1| flagellar basal body P-ring protein [Paracoccus denitrificans
           PD1222]
 gi|119375193|gb|ABL70786.1| flagellar P-ring protein [Paracoccus denitrificans PD1222]
          Length = 366

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 165/370 (44%), Positives = 233/370 (62%), Gaps = 9/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R   LI  L  L         RIKD+ ++   R N L+GYGLVVGL G+GDSLR+SPFT
Sbjct: 1   MRFLCLILILFSLASPGLTAPVRIKDLANIDGVRGNDLVGYGLVVGLNGSGDSLRNSPFT 60

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           E+ M  LL+ LG++        KNVAAV+VTA LPPFA  GS+IDVS+ ++GDA SL GG
Sbjct: 61  EEIMAGLLERLGVNVTDEAFRPKNVAAVIVTATLPPFARSGSQIDVSVAAIGDAKSLLGG 120

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            LVMT L  ADG IYAVAQGSV+  G    G+++S ++G+ T G I +GA +ERE+   F
Sbjct: 121 TLVMTPLNAADGEIYAVAQGSVLAGGAEASGKAASVVQGVPTTGAIPSGARIEREVAFDF 180

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP--TNIDLTR 240
               +L L LRNPDF+TA R+   IN     +  R +AE  DS T+ +       ++  R
Sbjct: 181 SQMTNLRLALRNPDFTTAARVEAAIN----RKLGRGLAELVDSGTIVIDSTVLGRVNPAR 236

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           LM ++E +TVE +  ARV+I+ ++GTIV+G++VRIS+V VS GNLT+++ E   V QPN 
Sbjct: 237 LMGQIENITVEPEMAARVVIDHKSGTIVMGEDVRISRVAVSQGNLTLRVRETPVVSQPNP 296

Query: 301 FSSNGSTVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           F + G TVT   T  +++   G     +     L+ +++G+N++G++   +I IL+ + A
Sbjct: 297 F-APGETVTLPRTQAEITQEPGIGFAEITGESSLSDVVAGLNALGIRPRDMIDILKAVHA 355

Query: 359 AGALQSEIII 368
           AGAL +E I+
Sbjct: 356 AGALHAEFIV 365


>gi|258625230|ref|ZP_05720142.1| Flagellar P-ring protein precursor [Vibrio mimicus VM603]
 gi|258582477|gb|EEW07314.1| Flagellar P-ring protein precursor [Vibrio mimicus VM603]
          Length = 378

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 149/372 (40%), Positives = 224/372 (60%), Gaps = 11/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            F    ++ +L  +    A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      F
Sbjct: 12  FFSSFLIVLTLGFVPTSQAKVEIPIMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKF 70

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +DV ++S+GDA SLR
Sbjct: 71  TAQSITNMLRQFGVQIDDNMDPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLR 130

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YAVAQG+VVV GL  +G+  S       T G+I NGA +ERE+ 
Sbjct: 131 GGTLLLTPLRGIDGELYAVAQGNVVVGGLSAEGKSGSKVAVNTPTAGRIPNGATLEREIS 190

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-L 238
             F     + L LR P F+TA  IA +IN    N F   +A + +  ++ +  P +    
Sbjct: 191 TDFNKRDQITLNLRKPSFTTAKNIAQEIN----NTFGPNVAVSVNKTSINMRAPKDTQQR 246

Query: 239 TRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
             +M+ +E ++V E   PARV+ N RTGT+VIG NV++ +  VS+GNLTV+I+E++QV Q
Sbjct: 247 VEMMAMLEEMSVVEGRKPARVVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESQQVSQ 306

Query: 298 PNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF + G T T + T + VS++           +LN++++ +NS+G     ++SILQ +
Sbjct: 307 PNAF-AGGETETIDQTRIDVSEDQNRMMIWPPGTELNTIVNAINSLGATPTDLMSILQAL 365

Query: 357 KAAGALQSEIII 368
             AGAL +E+++
Sbjct: 366 YEAGALNAELVV 377


>gi|296531746|ref|ZP_06894571.1| flagellar P-ring protein FlgI [Roseomonas cervicalis ATCC 49957]
 gi|296267929|gb|EFH13731.1| flagellar P-ring protein FlgI [Roseomonas cervicalis ATCC 49957]
          Length = 371

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 157/348 (45%), Positives = 234/348 (67%), Gaps = 9/348 (2%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
             R+KDVVS++  R NQL+GYGLV+GLQGTGD LR++PFT+QS+ ++L+ +G++    R+
Sbjct: 26  QVRLKDVVSIEGVRGNQLVGYGLVIGLQGTGDQLRNNPFTQQSLTAMLERMGVNVADARV 85

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            +KN AAV+VTA LPPF+  G+ IDV ++SLGD+ SL GG L++T LLGADG +YAVAQG
Sbjct: 86  QTKNTAAVIVTATLPPFSRQGTTIDVQVSSLGDSRSLNGGTLIVTPLLGADGEVYAVAQG 145

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
            VVV G    GQ+ S   G++T G++  G +VERE+P   ++   + L LR+PDF+TA+R
Sbjct: 146 PVVVGGFQAAGQAQSITSGVTTQGRVPGGGLVEREVPVDLRNLQSIRLSLRSPDFTTAVR 205

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL--TRLMSEVEMLTVETDTPARVII 260
           + + +N     RF    A A D  TV++  P         L++++E LT+  +TPARV++
Sbjct: 206 VEEALNQ----RFGAGSATALDLATVEMRVPPGFQERLPGLVAQMEALTIRPETPARVVV 261

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ERTGTI++G  VRI  V +++GNL +++TE+  V QPN   + G TV    T ++V D 
Sbjct: 262 DERTGTIIVGAQVRIDPVAITHGNLVIRVTESPIVSQPNPL-AGGETVVVPRTQVEVDDQ 320

Query: 321 KGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           +G    +L  A  L  L+ G+N++GL    +IS+L  +KA+GAL +E+
Sbjct: 321 RGRRLATLPPASTLKDLVDGLNALGLAPRDLISVLVALKASGALHAEL 368


>gi|255021358|ref|ZP_05293406.1| Flagellar P-ring protein flgI [Acidithiobacillus caldus ATCC 51756]
 gi|254969221|gb|EET26735.1| Flagellar P-ring protein flgI [Acidithiobacillus caldus ATCC 51756]
          Length = 381

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 144/372 (38%), Positives = 220/372 (59%), Gaps = 11/372 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             +  L+   +    I+      ++++VS+   R NQL+GYGLVVGL GTGD     P+T
Sbjct: 14  LALRILLLGALVGFGIAPVAAETVRNLVSVGGVRSNQLVGYGLVVGLNGTGDQATQVPYT 73

Query: 63  EQSMRSLLQNLGISTPGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
            QS+ ++ Q LGI+ P      L  K+VAAV+VTA+LPPFA PG  I+V+++++G+ASSL
Sbjct: 74  TQSLLNMFQRLGINLPPSVATNLQPKDVAAVIVTAHLPPFAQPGQTINVTVSAVGNASSL 133

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
            GG L+MT L GADG  YAVAQG+++VSG       +S    ++T G I NGA VER + 
Sbjct: 134 AGGTLLMTPLKGADGQTYAVAQGNIIVSGFGASANGNSTQVNVTTAGTIPNGANVERAVA 193

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-L 238
             F     L LQL  P F+TA RIAD IN     R    +A+A ++  V+V  P + +  
Sbjct: 194 SGFDQPGPLQLQLHTPSFTTAARIADVINQ----RLGYGVAQAVNAGVVQVQAPADPNAR 249

Query: 239 TRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S +E L+V+ + P A+V+++ R+GT+V+G NV +    V++GNL+V I++   V Q
Sbjct: 250 VNFLSIIENLSVDPEAPIAKVVVDARSGTVVLGQNVTLGACAVAHGNLSVTISQKYLVSQ 309

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PN     G T    +T++KV   +           L +++  +N++G     +I+ILQ +
Sbjct: 310 PNPL-GAGQTAVVPDTNVKVKQPQAKLLMFEPGVTLEAVVRALNAVGASPSDLIAILQAM 368

Query: 357 KAAGALQSEIII 368
           KAAGAL +++ +
Sbjct: 369 KAAGALHAQLEV 380


>gi|28900126|ref|NP_799781.1| flagellar basal body P-ring protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|28808409|dbj|BAC61614.1| putative flagellar P-ring protein [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 378

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 150/372 (40%), Positives = 221/372 (59%), Gaps = 11/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            F    L  +L       A+V   I D+V ++  R+NQL+GYGLVVGL G GD      F
Sbjct: 12  FFSSFLLALTLGLPATSQAEVEIPIMDLVDVRGIRENQLVGYGLVVGLAGQGDR-NQVKF 70

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +DV ++S+GDA SLR
Sbjct: 71  TSQSITNMLRQFGVQIDDSMDPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLR 130

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YA+AQGSVVV GL  +G+  S       T G++ NGA +ERE+ 
Sbjct: 131 GGTLLLTPLRGIDGEVYAIAQGSVVVGGLSAEGKSGSKVEVNTPTAGRVPNGATLEREIK 190

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-L 238
             F    ++ L LR P F+TA  IA +IN    N F   +A A +   V +  P +    
Sbjct: 191 TDFNQRDEITLNLRKPSFTTAKNIAREIN----NTFGPNVAVAINKARVDMRAPKDTQQR 246

Query: 239 TRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
             +MS +E ++V E   PAR++ N RTGT+VIG NV++ +  VS+GNLTV+I+E+E+V Q
Sbjct: 247 VIMMSMLEEMSVVEGRKPARIVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESEKVSQ 306

Query: 298 PNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF ++G T   N TD+ V++            +LN+++  +NS+G     ++SILQ +
Sbjct: 307 PNAF-ADGETKVVNQTDIDVNEELAQMVIWPPGTELNTIVDAVNSLGATPTDLMSILQAL 365

Query: 357 KAAGALQSEIII 368
             AGAL +E+++
Sbjct: 366 NEAGALNAELVV 377


>gi|114570502|ref|YP_757182.1| flagellar basal body P-ring protein [Maricaulis maris MCS10]
 gi|114340964|gb|ABI66244.1| flagellar P-ring protein [Maricaulis maris MCS10]
          Length = 371

 Score =  373 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 166/376 (44%), Positives = 242/376 (64%), Gaps = 16/376 (4%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R+   + + +      A   SRIKD++ ++  RDN L+GYGLVVGL G+GDSLR++ FT
Sbjct: 1   MRLIIALLAALS-FATPALASSRIKDMIDVEDVRDNHLVGYGLVVGLDGSGDSLRNAAFT 59

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
            QS+ ++L++  ++T    L ++NVAAVMVTA+LP F+S GSRIDV+++++GDASSL+GG
Sbjct: 60  NQSLNAMLEHFNVNTRDANLNTRNVAAVMVTASLPAFSSQGSRIDVTVSAIGDASSLQGG 119

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK-- 180
           +L+ T L  +    +AVAQGS+ V G    G  +S   G+ T G+I NGA+VE       
Sbjct: 120 VLIATPLFDSQSRAWAVAQGSLAVGGFEAAGDGASITRGVPTSGRIANGALVENPFEGSG 179

Query: 181 -----KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT- 234
                +  + A L L LRNPDF+TA R+AD IN+Y         A A +  TV + +P+ 
Sbjct: 180 IDPWAEIANRASLRLSLRNPDFTTARRMADAINAYV----GPGSARATNPSTVTLQRPSH 235

Query: 235 -NIDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENE 293
            + D+  L+SEVE L VE D PAR+II+E TGTIV+G+NVR+S V ++ GNLT+ +TE+ 
Sbjct: 236 FDGDMIDLLSEVEQLRVEADIPARIIIDENTGTIVMGENVRVSTVAIAQGNLTITVTESP 295

Query: 294 QVVQPNAFSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISI 352
              QP  F S G TV    TD+ V+++      L ++  L+ L+ G+N++G+    +I+I
Sbjct: 296 IASQPAPF-SEGETVVLPRTDVSVTEDNMQLGVLEESVSLSQLVDGLNAMGVTPRDMITI 354

Query: 353 LQGIKAAGALQSEIII 368
           LQ IKAAGALQ+EI +
Sbjct: 355 LQAIKAAGALQAEIEV 370


>gi|310764856|gb|ADP09806.1| Flagellar P-ring protein precursor [Erwinia sp. Ejp617]
          Length = 374

 Score =  373 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/378 (37%), Positives = 221/378 (58%), Gaps = 15/378 (3%)

Query: 1   MIFRIAFLI------FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGD 54
           M+ +   L+         + +   +     RI+D+ S+Q  R N L+GYGLVVGL GTGD
Sbjct: 1   MMMKKQTLLMSVSVLLCSLLVALPNMVRAERIRDLTSVQGVRPNTLMGYGLVVGLDGTGD 60

Query: 55  SLRSSPFTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSL 113
               +PFT QS+ ++L  LGI+ P G  +  KN+AAVMVTA LP F+ PG RID+ ++SL
Sbjct: 61  QTMQAPFTGQSLNNMLSQLGITVPAGTNMQLKNIAAVMVTAELPAFSRPGDRIDIVVSSL 120

Query: 114 GDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAI 173
           G+A SLRGG L+MT L GAD  IYA+AQG+V++SG   +   S        GG+I  GA 
Sbjct: 121 GNAKSLRGGTLLMTPLKGADTQIYALAQGNVLISGAGAQAGGSRVQVNQLNGGRISGGAT 180

Query: 174 VERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP 233
           VERE+P  F     L LQL   DFS A +I+D IN           A   D+RTV++  P
Sbjct: 181 VEREVPNDFAKQTALRLQLNETDFSLAQQISDAINRRF-----SGGAVPEDARTVRLFGP 235

Query: 234 TN-IDLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITE 291
           T+     R ++ ++ + +      A+VI+N RTG++V+  +V +    +++G LTV++++
Sbjct: 236 TDGPSRVRFLANIQDIPLHVAVQDAKVIVNSRTGSVVMNRHVTLESCAIAHGGLTVEVSQ 295

Query: 292 NEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGII 350
           N  + QP+   + G TV      + V D+ G+   +  + DLN+++  +N +G   + ++
Sbjct: 296 NNLISQPDTPLAGGETVVVPQAQISVRDSGGALQRVNSSADLNNVVRALNGLGATPNELM 355

Query: 351 SILQGIKAAGALQSEIII 368
           SILQ +K+AG L++++ I
Sbjct: 356 SILQAMKSAGCLRAKLEI 373


>gi|325916943|ref|ZP_08179187.1| flagellar basal-body P-ring protein [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536846|gb|EGD08598.1| flagellar basal-body P-ring protein [Xanthomonas vesicatoria ATCC
           35937]
          Length = 372

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/353 (40%), Positives = 205/353 (58%), Gaps = 8/353 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
                RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P 
Sbjct: 23  PASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPA 82

Query: 80  G-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
                 KNVAAV + A LPPFA PG  ID++++S+ +A SLRGG L+M  L GADG +YA
Sbjct: 83  NVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRGGSLLMAPLKGADGQVYA 142

Query: 139 VAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           +AQG++VV G   +G   S     I + G+I NGA VER LP  F  S ++ L L   DF
Sbjct: 143 MAQGNLVVGGFGAQGKDGSRVSVNIPSVGRIPNGATVERALPDVFAGSGEITLNLHQNDF 202

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET-DTP 255
           +T  R+   I+S     F    A A D  TV V  PT+      L++ +E + +   D P
Sbjct: 203 TTVSRMVAAIDS----SFGAGTARAVDGVTVSVRSPTDPGARIGLLARLENVELSPGDAP 258

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+V++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VT  +T  
Sbjct: 259 AKVVVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTPQSTIT 318

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             S+    F       L+ ++  +N +G     +++IL+ +K AGAL +E+ +
Sbjct: 319 ATSEGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAELEV 371


>gi|149911698|ref|ZP_01900306.1| flagellar P-ring protein precursor [Moritella sp. PE36]
 gi|149805228|gb|EDM65245.1| flagellar P-ring protein precursor [Moritella sp. PE36]
          Length = 378

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 156/371 (42%), Positives = 225/371 (60%), Gaps = 10/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +     ++     +  I++   +RIKD+ S+Q  RDNQLIGYGLVVGL GTG+  +S+ F
Sbjct: 13  VLLGMSIVLLSFFIVTINSAHAARIKDISSVQGVRDNQLIGYGLVVGLPGTGE--KSNAF 70

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           + QS +++L N GI+ P G ++  KNVAAV V+A LP F  PG  IDV++ ++G+A SLR
Sbjct: 71  SAQSFKTMLNNFGITMPDGAKVKIKNVAAVAVSAILPAFTKPGQTIDVTVAAIGEAKSLR 130

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELP 179
           GG+L+ T L GADG +YA+AQGS+VV GL V+G   S  +    T G+I  GAIVERE+ 
Sbjct: 131 GGLLLQTFLKGADGQVYALAQGSLVVGGLGVEGKDGSKVIINTPTVGRISGGAIVEREVA 190

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F D   L   L   DF+ A R+AD IN+          A   DS +V+V  P +I   
Sbjct: 191 NPFGDGDYLTFNLHRGDFTNAKRLADSINNLV----GPNTAYPMDSTSVRVLAPRDISQR 246

Query: 239 TRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S +E L ++  D  A++I+N RTGTIVIG NVR+    +++G LTV I E ++V Q
Sbjct: 247 VAYLSTLENLELKMADESAKIIVNSRTGTIVIGQNVRLKPAAITHGGLTVTINETQEVSQ 306

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           PNAF++  + VT  +T     ++   F L     L+ LI  +N +G+    ++SIL+ +K
Sbjct: 307 PNAFANGETVVTNKSTINVTQEDARMFKLDAGATLDDLIRAVNQVGIAPGDLMSILEALK 366

Query: 358 AAGALQSEIII 368
            AGAL  ++II
Sbjct: 367 DAGALDGQLII 377


>gi|21242723|ref|NP_642305.1| flagellar basal body P-ring protein [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|48474872|sp|Q8PL27|FLGI_XANAC RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|21108199|gb|AAM36841.1| flagellar protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 372

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 144/353 (40%), Positives = 206/353 (58%), Gaps = 8/353 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
                RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P 
Sbjct: 23  PASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPA 82

Query: 80  G-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
                 KNVAAV + A LPPFA PG  IDV+++S+ +A SLRGG L+M  L GADG +YA
Sbjct: 83  NVNPQLKNVAAVAIHAELPPFAKPGQPIDVTVSSIANAVSLRGGSLLMAPLKGADGQVYA 142

Query: 139 VAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           +AQG++VV G   +G   S     + + G+I NGA VER LP  F  + ++ L L   DF
Sbjct: 143 MAQGNLVVGGFGAQGKDGSRVSVNVPSVGRIPNGATVERALPDVFAGTGEITLNLHQNDF 202

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET-DTP 255
           +T  R+   I+S     F    A A D  TV V  PT+      L+S +E + +   D P
Sbjct: 203 TTVSRMVAAIDS----SFGAGTARAVDGVTVAVRSPTDPGARIGLLSRLENVELSPGDAP 258

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+V++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VTQ +T  
Sbjct: 259 AKVVVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTQQSTIT 318

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             S+    F       L+ ++  +N +G     +++IL+ +K AGAL +E+ +
Sbjct: 319 ATSEGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAELEV 371


>gi|238919263|ref|YP_002932778.1| flagellar basal body P-ring protein [Edwardsiella ictaluri 93-146]
 gi|238868832|gb|ACR68543.1| flagellar P-ring protein FlgI [Edwardsiella ictaluri 93-146]
          Length = 379

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 148/368 (40%), Positives = 216/368 (58%), Gaps = 9/368 (2%)

Query: 6   AFLIFSLIGL-HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
            +L   L+ L          RI+D+ ++Q  R N LIGYGLVVGL GTGD    +PFT Q
Sbjct: 15  FWLTGVLLALGLLSQGAQAERIRDLTTIQGVRSNALIGYGLVVGLDGTGDQTMQTPFTTQ 74

Query: 65  SMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           S+ ++L  LGI+ P G  +  KNVAAVMVTANLPPFA PG  IDV ++S+G+A SLRGG 
Sbjct: 75  SLTNMLSQLGITVPAGTNMQLKNVAAVMVTANLPPFARPGQTIDVVVSSMGNAKSLRGGT 134

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L+MT L G D  +YA+AQG+++V G       SS       GG+I  GA +ER +P  F 
Sbjct: 135 LLMTPLKGVDNQVYALAQGNILVGGAGASAGGSSVQVNQLAGGRISGGATIERSVPTTFG 194

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
               + L+L N +F+ A RI+D IN  +        A   D+RTV+V  P    +  R++
Sbjct: 195 HGNVINLELNNENFTLAERISDAINRAN----GLGSATPLDARTVQVLVPQGGSNQVRVL 250

Query: 243 SEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           + ++ + V   T  A+VIIN RTG++V+  NV +    V+ GNL+V +     V QPN  
Sbjct: 251 ANIQNIEVNAGTFDAKVIINSRTGSVVMNRNVELDSCAVAQGNLSVVVDRQLNVSQPNTP 310

Query: 302 SSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
              G TV   NT + V+ + G+   +    +LNS++  +N++G   + ++SILQ +K+AG
Sbjct: 311 LGGGQTVVTPNTQISVNQSGGALHQVRAGANLNSVVRALNALGATPNDLMSILQAMKSAG 370

Query: 361 ALQSEIII 368
            L++++ I
Sbjct: 371 CLRAKLEI 378


>gi|87119672|ref|ZP_01075569.1| flagellar P-ring protein precursor [Marinomonas sp. MED121]
 gi|86165148|gb|EAQ66416.1| flagellar P-ring protein precursor [Marinomonas sp. MED121]
          Length = 370

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 138/372 (37%), Positives = 214/372 (57%), Gaps = 13/372 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +       +            R+KD+ S++  RDNQL GYGLV+GL GTGD   +S FT
Sbjct: 5   LKTMKYWLLVCVCLLSGLVNADRLKDISSVEGVRDNQLFGYGLVIGLNGTGD---NSNFT 61

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           +QS   +L   GI  P G    S+NVAAV +TA LPPF+ PG +ID++ +S+G ASSL+G
Sbjct: 62  DQSFTGMLAQFGIVLPEGVNANSQNVAAVSLTATLPPFSKPGQKIDITASSIGSASSLQG 121

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L++++L GADG +YA+AQG++VV GL  +G   S     I T G+I NGA VER +P 
Sbjct: 122 GTLLLSTLKGADGQVYAIAQGNLVVGGLGTQGNDGSKTSLSIPTVGRIPNGASVERTVPN 181

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     L   L  PDF+TA +++D IN+         +A+  D+ +++VS P +     
Sbjct: 182 SFNRGDTLTFNLNRPDFTTAKQVSDSINAL----LGPGVAKTMDATSIRVSAPRDPSQRV 237

Query: 240 RLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L VE     A+++IN RTGTI+IG +V++S   V++G+LTV I         
Sbjct: 238 TFLSILENLEVELGQERAKIVINSRTGTIIIGQHVKVSPAAVTHGSLTVTIKNPPLNQAA 297

Query: 299 -NAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
             A  + G T+     ++ V+++ G  F       LN ++  +N +G     +++IL+G+
Sbjct: 298 VEAALTGGETIYAPREEIVVNEDSGHMFLFGPGASLNDIVRAVNQVGAAPGDVMAILEGL 357

Query: 357 KAAGALQSEIII 368
           K AGA+ +++++
Sbjct: 358 KQAGAINADLVV 369


>gi|312882655|ref|ZP_07742392.1| flagellar basal body P-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309369616|gb|EFP97131.1| flagellar basal body P-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 363

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 155/371 (41%), Positives = 220/371 (59%), Gaps = 14/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R   +I   + L  +     +RIKDV  +   RDNQLIGYGLV GL G+G+S   +PFT
Sbjct: 1   MRSLLVILVHVMLFPV-LAEAARIKDVSRVAGVRDNQLIGYGLVTGLPGSGES---TPFT 56

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           +QS  ++LQ+ GI  P G +  SKN+AAVMVTA LP F   G R+DV+I+S+G A SLRG
Sbjct: 57  DQSFIAMLQSFGIQLPAGTKPKSKNIAAVMVTAELPAFTKQGQRLDVTISSIGSAKSLRG 116

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G DG IYAVAQG++VVSG        S  +      G I NGAIVERE+P 
Sbjct: 117 GTLMQTMLKGLDGQIYAVAQGNLVVSGFSATGADGSKIVGNNPAAGIISNGAIVEREIPS 176

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L + DF+TA R+AD +N++        +A A D+ +VKV  P ++    
Sbjct: 177 PFSRGDYITFNLLDSDFTTAQRMADTVNNF----LGPQMASALDATSVKVRAPRDLTQRV 232

Query: 240 RLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L  +     A++I+N RTGTI++G +VR+    V++G +T+ I EN  V QP
Sbjct: 233 AFLSAIENLEFQPANGAAKIIVNSRTGTIIVGQHVRLKPTAVTHGGMTITIKENLNVSQP 292

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           NA    G T    +TD++V++ KG  F       LN L+S +N IG     +++ILQ ++
Sbjct: 293 NAL-GGGDTAVVPDTDIEVTEKKGKMFKFNTGLTLNDLVSAVNEIGAAPSDLMAILQALE 351

Query: 358 AAGALQSEIII 368
            AGA++ ++II
Sbjct: 352 QAGAIEGQLII 362


>gi|254500860|ref|ZP_05113011.1| flagellar P-ring protein FlgI [Labrenzia alexandrii DFL-11]
 gi|222436931|gb|EEE43610.1| flagellar P-ring protein FlgI [Labrenzia alexandrii DFL-11]
          Length = 381

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 171/369 (46%), Positives = 242/369 (65%), Gaps = 9/369 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
            +A  +  L     + A   SRIKD+   +  R+NQLIGYGLVVGL GTGDSL ++PFT+
Sbjct: 17  LVAAALVGLQLAIAVQAVASSRIKDIADFEGIRENQLIGYGLVVGLNGTGDSLNNTPFTQ 76

Query: 64  QSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           QS++++L+ LG++T    L +  VAAVMVTANLPPF++ G+RIDVS+++LGDASSL+GG 
Sbjct: 77  QSLQAMLERLGVNTRNIPLNTDTVAAVMVTANLPPFSTQGTRIDVSVSALGDASSLQGGT 136

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L++T L+GADG +YA+AQGSV + G   +G ++S + G+ T G+I NG +VEREL  K  
Sbjct: 137 LLVTPLVGADGEVYAIAQGSVAIGGFSAQGDAASIVRGVPTAGRIANGGLVERELDFKLA 196

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT--NIDLTRL 241
               + L LRNPD +TA R+A  IN         P AE  D  TV++  P   + ++  L
Sbjct: 197 SLTSVRLALRNPDLTTARRVALSINELI----GMPTAEPVDPATVQLELPRQYDGNIVDL 252

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           ++++E L VE D  ARVII+E +G IV+G +V++S V V+ GNLTV I E  +VVQP  F
Sbjct: 253 LTDIEQLIVEPDLAARVIIDENSGIIVMGQDVKVSMVAVAQGNLTVTIAETPEVVQPLPF 312

Query: 302 SSNGSTVTQNNTDLKVS--DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
            +NG T     TDL V+   +     + +   L  L+ G+N++G+    +ISILQ IKA+
Sbjct: 313 -ANGQTAIAPRTDLNVNTDPDAKLAIVPNTVTLKQLVDGLNALGIGPRDMISILQAIKAS 371

Query: 360 GALQSEIII 368
           GALQ+EI +
Sbjct: 372 GALQAEIEV 380


>gi|258622492|ref|ZP_05717514.1| Flagellar P-ring protein precursor [Vibrio mimicus VM573]
 gi|258585192|gb|EEW09919.1| Flagellar P-ring protein precursor [Vibrio mimicus VM573]
          Length = 378

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 149/372 (40%), Positives = 223/372 (59%), Gaps = 11/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            F    ++ +L       A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      F
Sbjct: 12  FFSSFLIVLTLGFAATSQAKVEIPIMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKF 70

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +DV ++S+GDA SLR
Sbjct: 71  TAQSITNMLRQFGVQIDDNMDPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLR 130

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YAVAQG+VVV GL  +G+  S       T G+I NGA +ERE+ 
Sbjct: 131 GGTLLLTPLRGIDGELYAVAQGNVVVGGLSAEGKSGSKVAVNTPTAGRIPNGATLEREIS 190

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-L 238
             F     + L LR P F+TA  IA +IN    N F   +A + +  ++ +  P +    
Sbjct: 191 TDFNKRDQITLNLRKPSFTTAKNIAQEIN----NTFGPNVAVSVNKTSINMRAPKDTQQR 246

Query: 239 TRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
             +M+ +E ++V E   PARV+ N RTGT+VIG NV++ +  VS+GNLTV+I+E++QV Q
Sbjct: 247 VEMMAMLEEMSVVEGRKPARVVFNSRTGTVVIGKNVKVGEAAVSHGNLTVRISESQQVSQ 306

Query: 298 PNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF + G T T + T + VS++           +LN++++ +NS+G     ++SILQ +
Sbjct: 307 PNAF-AGGETETIDQTRIDVSEDQNRMMIWPPGTELNTIVNAINSLGATPTDLMSILQAL 365

Query: 357 KAAGALQSEIII 368
             AGAL +E+++
Sbjct: 366 YEAGALNAELVV 377


>gi|237653579|ref|YP_002889893.1| flagellar basal body P-ring protein [Thauera sp. MZ1T]
 gi|237624826|gb|ACR01516.1| flagellar P-ring protein [Thauera sp. MZ1T]
          Length = 374

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 153/373 (41%), Positives = 221/373 (59%), Gaps = 11/373 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISA-QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           ++ R A +  +++ LH   A     RIKD+ S+   RDNQL+GYGLVVGL G+GD    +
Sbjct: 7   LLLRAAVVSLAVLILHPAQAYAAAERIKDLASVAGVRDNQLVGYGLVVGLDGSGDQTTQT 66

Query: 60  PFTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           PFT QS+ ++L NLG+S P G  L  KNVAAVMVTANLP FA PG  IDV+++S+G+A S
Sbjct: 67  PFTVQSIVNMLGNLGVSLPPGTNLQLKNVAAVMVTANLPAFARPGQAIDVTVSSIGNAKS 126

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           LRGG LVMT L GADG +YA+AQG++ V G   +G  +S +    + G+I  GA VER +
Sbjct: 127 LRGGTLVMTPLKGADGQVYAIAQGNMAVGGAGAQGGGASLVINHLSAGRIPGGATVERAV 186

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID- 237
           P        ++ +L + DF TA R+ D IN           A A D R+++V  PT+   
Sbjct: 187 PTALGQGDAVLFELNDADFGTARRVVDAINLVY-----PGAASALDGRSIQVRAPTDSSA 241

Query: 238 LTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               +  +E L V      A+VI+N RTG++V+   V +    V++GNLTV +    QV 
Sbjct: 242 RVAFLGHIENLEVTPVQQAAKVIVNSRTGSVVMNQRVTLQNCAVAHGNLTVTVNIETQVS 301

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP    S G TV      + V+   G+ F++    +L  ++  +N++G K   ++SILQ 
Sbjct: 302 QPPPL-SGGQTVVTQRGQVDVAQEGGALFNVRGGANLADVVKALNTLGAKPMDLVSILQA 360

Query: 356 IKAAGALQSEIII 368
           +KAAGAL++E+ +
Sbjct: 361 MKAAGALRAELEV 373


>gi|16126820|ref|NP_421384.1| flagellar basal body P-ring protein [Caulobacter crescentus CB15]
 gi|221235601|ref|YP_002518038.1| flagellar basal body P-ring protein [Caulobacter crescentus NA1000]
 gi|462107|sp|P33979|FLGI_CAUCR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|144241|gb|AAB83950.1| flagellin [Caulobacter crescentus CB15]
 gi|13424152|gb|AAK24552.1| flagellar P-ring protein [Caulobacter crescentus CB15]
 gi|220964774|gb|ACL96130.1| flagellar P-ring protein flgI [Caulobacter crescentus NA1000]
          Length = 370

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 164/371 (44%), Positives = 235/371 (63%), Gaps = 9/371 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +   +   + +   L    A   SRIKD+VS +  R+NQLIGYG+VVGL GTGDSLR++P
Sbjct: 5   LFRTVLTALVAASCLIAAPALAKSRIKDIVSFEGVRENQLIGYGIVVGLNGTGDSLRNAP 64

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
            T+QS+ ++L+  G++     L +KN AAVMVTANLPPF++ GS++DV++++LGDA SL 
Sbjct: 65  MTKQSLEAMLERQGVNVRDNNLNTKNTAAVMVTANLPPFSASGSKVDVTVSTLGDAKSLL 124

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELP 179
           GG L++TSL GADG  YAVAQG+V    +   G   SS  +G+ T G+I  G ++ERE  
Sbjct: 125 GGTLLVTSLQGADGQTYAVAQGTVQTGSVSAGGASGSSVTKGVPTAGRIAGGGVIERETG 184

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT 239
            +  +   + L LRNPDF+TA R+AD IN+          A+A +   +    P  +D+ 
Sbjct: 185 FQMVNMDIMRLTLRNPDFTTARRVADAINAKF-----PGCAQAQNPTIIATRPPPGMDMI 239

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             M+ +E L VE D PA+V+I+E  G IV+GD+VRIS+V ++ GNLT+ + EN  V QP 
Sbjct: 240 SFMTNIENLMVEPDGPAKVVIDEVAGVIVMGDDVRISQVAIAQGNLTITVQENPAVSQPA 299

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F S G T     + + V + KG    +L  AP L  LI G+N++G+    +ISILQ +K
Sbjct: 300 PF-SQGQTAVVPQSTVNVEEEKGKQLLTLGGAPSLKGLIGGLNALGVTPRDMISILQAVK 358

Query: 358 AAGALQSEIII 368
           AAGALQ++I +
Sbjct: 359 AAGALQADIEV 369


>gi|78047582|ref|YP_363757.1| flagellar basal body P-ring protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|294665575|ref|ZP_06730856.1| flagellar P-ring protein precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|124021077|sp|Q3BU06|FLGI_XANC5 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|78036012|emb|CAJ23703.1| flagellar basal-body P-ring protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|292604673|gb|EFF48043.1| flagellar P-ring protein precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 372

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/353 (40%), Positives = 206/353 (58%), Gaps = 8/353 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
                RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P 
Sbjct: 23  PASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPA 82

Query: 80  G-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
                 KNVAAV + A LPPFA PG  ID++++S+ +A SLRGG L+M  L GADG +YA
Sbjct: 83  NVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRGGSLLMAPLKGADGQVYA 142

Query: 139 VAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           +AQG++VV G   +G   S     + + G+I NGA VER LP  F  + ++ L L   DF
Sbjct: 143 MAQGNLVVGGFGAQGKDGSRVSVNVPSVGRIPNGATVERALPDVFAGTGEITLNLHQNDF 202

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET-DTP 255
           +T  R+   I+S     F    A A D  TV V  PT+      L+S +E + +   D P
Sbjct: 203 TTVSRMVAAIDS----SFGAGTARAVDGVTVAVRSPTDPGARIGLLSRLENVELSPGDAP 258

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+V++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VTQ +T  
Sbjct: 259 AKVVVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTQQSTIT 318

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             S+    F       L+ ++  +N +G     +++IL+ +K AGAL +E+ +
Sbjct: 319 ATSEGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAELEV 371


>gi|152980624|ref|YP_001353115.1| flagellar basal body P-ring protein [Janthinobacterium sp.
           Marseille]
 gi|151280701|gb|ABR89111.1| FlgI flagellar basal-body P-ring protein [Janthinobacterium sp.
           Marseille]
          Length = 375

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 145/371 (39%), Positives = 216/371 (58%), Gaps = 9/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + +   LI   + L    A    R+KD+ S+Q  R NQLIGYGLVVGL G+GD    +PF
Sbjct: 9   LKKSLQLIACSVCLLLPFAAHSERLKDLASVQGVRQNQLIGYGLVVGLDGSGDQTTQTPF 68

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ S++Q +G++ P G  +  KNVAAVMVT +LP FA PG  +D++++S+G+A SLR
Sbjct: 69  TIQSIVSMMQQMGVNLPQGVNMQLKNVAAVMVTTSLPAFAQPGQTLDITVSSMGNAKSLR 128

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L GADG IY +AQG+VVV G+      S         G+I  GA VER +P 
Sbjct: 129 GGTLLMTPLKGADGQIYGMAQGNVVVGGVGAAANGSKAQINHLGVGRISAGATVERAVPS 188

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLT 239
                  ++L+L++ DFSTA R+ D +N     RF    A A D R ++V  P  N +  
Sbjct: 189 SLGQGDQIVLELKDSDFSTASRVVDAVNK----RFGPDTAAAQDGRVIRVRAPISNDERV 244

Query: 240 RLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +  +E + V      A+VI+N RTG++V+   V +    VS+GNL+V I     + QP
Sbjct: 245 SFLGALESINVTPAQVSAKVILNARTGSVVMNQAVTLDTCAVSHGNLSVVINTQPVISQP 304

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
             F S G TV    + ++++ + G    L ++  L  ++  +NSIG     +++ILQ +K
Sbjct: 305 APF-SGGQTVVAQQSQIEINKDPGKVILLKNSASLADVVKALNSIGATPQDLLAILQAMK 363

Query: 358 AAGALQSEIII 368
           A+G+L++E+ I
Sbjct: 364 ASGSLRAELEI 374


>gi|260574383|ref|ZP_05842387.1| flagellar P-ring protein [Rhodobacter sp. SW2]
 gi|259023279|gb|EEW26571.1| flagellar P-ring protein [Rhodobacter sp. SW2]
          Length = 364

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 159/369 (43%), Positives = 232/369 (62%), Gaps = 9/369 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +   +F  + L   +A    RIKD+V     R N L+GYGLVVGL GTGD +R+SPFTE+
Sbjct: 1   MIRAVFLFLCLAFPAAASPIRIKDLVQFDGVRGNDLVGYGLVVGLNGTGDGIRNSPFTEE 60

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            M +LL+ LG++  G +   KNVAAV VTA LPPFA  G +IDVS++++GD+ SL GG L
Sbjct: 61  IMSNLLERLGVNVAGEQYRPKNVAAVFVTAALPPFARAGGQIDVSVSAIGDSKSLLGGTL 120

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           +MT L GADG IYAVAQG+++  G+  +G ++  ++G+ T G I +GA VERE+   F  
Sbjct: 121 IMTPLNGADGQIYAVAQGTIIAGGISAEGDAARVVQGVPTAGVIPSGARVEREVEFDFSS 180

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNIDLTRLM 242
              + L LR  DF+TA RI   IN      F R IA   DS TV +            ++
Sbjct: 181 LTSVRLALRTADFTTAGRIEQVINQ----EFGRSIAVMLDSGTVALDLSGARMASPAHVL 236

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
             VE L VE +T ARV++++R+GTIV+G++VRIS+V V+ GNLT++I E+  VVQPN F 
Sbjct: 237 GRVENLLVEPETRARVVVDQRSGTIVMGEDVRISRVAVAQGNLTLRIEESPMVVQPNPF- 295

Query: 303 SNGSTVTQNNTDLKVS--DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           ++G ++    T   ++  D  G   +    +L+ +++G+N++G+    +I IL+ I AAG
Sbjct: 296 TDGESIVVPRTRADINKGDGTGLAEITGGTNLSEVVAGLNALGVAPHDMIDILKSINAAG 355

Query: 361 ALQSEIIIQ 369
           AL +E ++Q
Sbjct: 356 ALHAEFLVQ 364


>gi|260779343|ref|ZP_05888235.1| flagellar P-ring protein FlgI [Vibrio coralliilyticus ATCC BAA-450]
 gi|260605507|gb|EEX31802.1| flagellar P-ring protein FlgI [Vibrio coralliilyticus ATCC BAA-450]
          Length = 403

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 144/366 (39%), Positives = 217/366 (59%), Gaps = 9/366 (2%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+ SL       A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      FT QS+
Sbjct: 42  LLVLSLGAALPAQAEVEIPIMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKFTAQSI 100

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++L+  G+          +NVA+V VTA + P A  G  ++V ++S+GDA SLRGG L+
Sbjct: 101 TNMLRQFGVQIDDSTNPKLRNVASVSVTATVEPMAGAGQTLNVVVSSIGDAKSLRGGTLL 160

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           +T L G DG +YAVAQG+VVV G+  +G+  S  +    T G+I  GA +ERE+P  F +
Sbjct: 161 LTPLRGIDGEVYAVAQGNVVVGGVSAEGKSGSKIVINTPTSGRIPGGATLEREVPNDFSE 220

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMS 243
             +++L LR P F+TA  IA +IN+     F   +A A ++  + V  P +      +MS
Sbjct: 221 QDNVVLNLRKPSFTTAKNIAREINNI----FGPKVAVAKNNVRISVKAPKDSQQRVVMMS 276

Query: 244 EVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E ++V E   PAR++ N RTGT+VIG +V++S+  VS+GNLTV I E++QV QPNAF+
Sbjct: 277 MLEEISVAEGRKPARIVFNSRTGTVVIGKSVKVSEAAVSHGNLTVTIAESQQVSQPNAFA 336

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
              + V   +      +           +LN+++S +NS+G     ++SILQ +  AGAL
Sbjct: 337 DGETKVVDQSLLDVSEEQAQMVIWPPGTELNTIVSAVNSLGATPTDLMSILQALHEAGAL 396

Query: 363 QSEIII 368
            +E+++
Sbjct: 397 NAELVV 402


>gi|253998484|ref|YP_003050547.1| flagellar P-ring protein [Methylovorus sp. SIP3-4]
 gi|313200559|ref|YP_004039217.1| flagellar p-ring protein [Methylovorus sp. MP688]
 gi|253985163|gb|ACT50020.1| flagellar P-ring protein [Methylovorus sp. SIP3-4]
 gi|312439875|gb|ADQ83981.1| flagellar P-ring protein [Methylovorus sp. MP688]
          Length = 374

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/355 (40%), Positives = 210/355 (59%), Gaps = 8/355 (2%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
                   R+KD+ ++Q  R NQLIGY LVVGL GTGD    +PFT QS+ S+LQ +G++
Sbjct: 24  MSLPVEAERLKDLATIQGVRSNQLIGYSLVVGLDGTGDQTTQTPFTVQSLISMLQGMGVT 83

Query: 77  TP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
            P G  L  KNVAAVMVTA LPPFA PG  +DV+++S+G+A SLRGG L+MT L GAD  
Sbjct: 84  LPQGTNLQLKNVAAVMVTATLPPFAQPGQALDVTVSSMGNAKSLRGGTLLMTPLKGADNQ 143

Query: 136 IYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           +YA+AQG++VV G+      S         G+I  GA VER +P        + L+L++ 
Sbjct: 144 VYAMAQGNLVVGGVGASANGSQTQINHLGVGRISAGATVERAVPVALNQGTGINLELKDS 203

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVET-DT 254
           DFSTA ++ D IN     RF    A A D R ++V+ P +      ++ +E + V   ++
Sbjct: 204 DFSTASKVVDAINQ----RFGTGTAAAQDGRVIRVNAPADSSRVSFLAALESINVNPAES 259

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A+VI+N RTG++V+  +V +    VS+GNL+V I     + QP A  S G TV+   ++
Sbjct: 260 SAKVILNARTGSVVMNRSVSLEDCAVSHGNLSVVINTAPVISQPGAL-SGGQTVSTARSE 318

Query: 315 LKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + +    G    L     L+ +I  +N+IG     +++ILQ +K+AGAL++E+ +
Sbjct: 319 ISIEKEPGKVLKLDGGASLSDVIKALNAIGATPQDLLAILQAMKSAGALRAELEV 373


>gi|163794158|ref|ZP_02188131.1| Flagellar P-ring protein [alpha proteobacterium BAL199]
 gi|159180772|gb|EDP65291.1| Flagellar P-ring protein [alpha proteobacterium BAL199]
          Length = 361

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 167/364 (45%), Positives = 244/364 (67%), Gaps = 8/364 (2%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           ++ +  +    A   +RIKD+V  +  R+N LIGYGL VGL+GTGD + S+ FT +S+  
Sbjct: 1   MWVIFAVSLGGASAQTRIKDIVDFEGVRENLLIGYGLAVGLKGTGDDIGSAIFTRESLVG 60

Query: 69  LLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTS 128
           +L+ LG++     L +KNVAAVMVTA LPPFA+ G+RID++++++GDA SL GG L++T 
Sbjct: 61  MLERLGVNARDDNLDTKNVAAVMVTAILPPFATQGTRIDITVSAIGDADSLLGGQLLVTP 120

Query: 129 LLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADL 188
           L+GADG +YAVAQG V VSG   +G ++S   G++TGG+I NGAIVERE+         +
Sbjct: 121 LIGADGEVYAVAQGPVAVSGFSAQGAAASVSRGVTTGGRISNGAIVEREVSFALNQMETV 180

Query: 189 ILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVE 246
            + LRNPDF+T+ RIA  IN++       PIA++ DS TV++  P     +   L+++VE
Sbjct: 181 RIALRNPDFTTSRRIAQAINAFV----GGPIAQSTDSGTVRMLVPDAYRNNAVALITDVE 236

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            L V  DT A+V+I+E+TG IV+G+NVRI+ V ++ GNLT++ITE  QV QP  F+  G 
Sbjct: 237 QLRVTPDTIAKVVIDEQTGVIVMGENVRINTVAIAQGNLTIRITETPQVSQPQPFAQTGE 296

Query: 307 TVTQNNTDLKVSD--NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
           TVT   T +++ D  +K    L     L  L++G+N++G+    +ISILQ IKAAGALQ+
Sbjct: 297 TVTVPRTQIEIDDDKDKKLTVLPRQVTLQELVNGLNALGVGPRDMISILQAIKAAGALQA 356

Query: 365 EIII 368
           E+ +
Sbjct: 357 ELEV 360


>gi|85715045|ref|ZP_01046030.1| flagellar P-ring protein precursor [Nitrobacter sp. Nb-311A]
 gi|85698242|gb|EAQ36114.1| flagellar P-ring protein precursor [Nitrobacter sp. Nb-311A]
          Length = 374

 Score =  371 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 159/364 (43%), Positives = 242/364 (66%), Gaps = 8/364 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           +    +      A   SRIKD+ +++  R NQLIGYGLVVGL G+GD+L + PFT+QS++
Sbjct: 15  IALMALASLGTPAHATSRIKDLANIEGVRQNQLIGYGLVVGLNGSGDTLNNIPFTKQSLQ 74

Query: 68  SLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           ++L+ +G++  G  + + NVAAVMVT NLP FA+ G+R+DV+++++GDA SL+GG L++T
Sbjct: 75  AMLERMGVNIRGATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSAMGDAKSLQGGTLLVT 134

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD 187
            LLGADGN+YAVAQGS+ + G   +G ++S  +G+ T G+I NGAIVERE+        +
Sbjct: 135 PLLGADGNVYAVAQGSLAIGGFAAEGAAASVTKGVPTNGRIANGAIVEREIEFALNRMPN 194

Query: 188 LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEV 245
           + L LRN DF+TA RIA  +N +         AE  D  TV++S P     ++  L++E+
Sbjct: 195 VRLALRNGDFTTAKRIAAAVNDF----LGTKTAEPIDPSTVQLSIPGEYKGNVVALLTEI 250

Query: 246 EMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
           E L VE D  A+++I+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN  +  G
Sbjct: 251 EQLQVEPDIAAKIVIDERSGVIVMGRDVRVATVAVAQGNLTVSISESPQVSQPNPLAR-G 309

Query: 306 STVTQNNTDLKVSDNKGSFSL-IDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
            TV    TD+ V+++    +L  +   L  L+ G+N +G+    +I+ILQ IKAAGA+++
Sbjct: 310 RTVVTPRTDVGVTEDGRKLALVKNGVSLQELVDGLNGLGIGPRDLIAILQAIKAAGAIEA 369

Query: 365 EIII 368
           +I +
Sbjct: 370 DIEV 373


>gi|86750903|ref|YP_487399.1| flagellar basal body P-ring protein [Rhodopseudomonas palustris
           HaA2]
 gi|123098399|sp|Q2ITH2|FLGI_RHOP2 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|86573931|gb|ABD08488.1| Flagellar P-ring protein [Rhodopseudomonas palustris HaA2]
          Length = 373

 Score =  371 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 162/371 (43%), Positives = 246/371 (66%), Gaps = 8/371 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +I ++A    S + L  ++A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + P
Sbjct: 7   VILKLAAAALSALLLSGVAANATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIP 66

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FT+QS++++L+ +G++  G  + + NVAAVMVT NLP FA+ G+R+DV++++LGDA +L+
Sbjct: 67  FTKQSLQAMLERMGVNIRGATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSALGDAKNLQ 126

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L++T LLGADGN+YAVAQGS+ + G   +G+++    G+ T G+I NGAI+ERE+  
Sbjct: 127 GGTLLVTPLLGADGNVYAVAQGSLAIGGFQAEGEAAKITRGVPTVGRIANGAIIEREIEF 186

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DL 238
                  + L LRN DF+TA RIA  +N +         AE  D  TV+++ P     + 
Sbjct: 187 ALNRLPMVRLALRNADFTTAKRIAAAVNDF----LGTKSAEPIDPSTVQLTIPAEFKGNA 242

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
              ++E+E L VE D  A++II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QP
Sbjct: 243 VAFVTEIEQLQVEPDQAAKIIIDERSGIIVMGRDVRVATVAVAQGNLTVSISESPQVSQP 302

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSL-IDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N   +NG TV   N+ + V+++    +L  D   L  L+ G+N +G+    +I ILQ IK
Sbjct: 303 NPL-ANGRTVVTPNSRIGVTEDGKKLALVKDGVSLQQLVDGLNGLGIGPRDLIGILQAIK 361

Query: 358 AAGALQSEIII 368
           AAGA++++I +
Sbjct: 362 AAGAIEADIEV 372


>gi|288958681|ref|YP_003449022.1| flagellar P-ring protein precursor [Azospirillum sp. B510]
 gi|288910989|dbj|BAI72478.1| flagellar P-ring protein precursor [Azospirillum sp. B510]
          Length = 380

 Score =  371 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 165/368 (44%), Positives = 237/368 (64%), Gaps = 9/368 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +   + +       +    +RIKD+V ++  RDN LIGYGLVVGL GTGDSL +SPFTEQ
Sbjct: 17  LLTALLAFGVPAAPAVAASARIKDIVDVEGVRDNMLIGYGLVVGLNGTGDSLNNSPFTEQ 76

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           S+  +L+ +G++T G  L +KNVAAVMVTA L  +A+ G+RIDV+++++GD+ SL GG L
Sbjct: 77  SLTGMLERMGVNTRGTNLRTKNVAAVMVTATLNAYAAQGTRIDVTVSAMGDSKSLLGGTL 136

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           ++T ++GADG +YAVAQG + VSG   +GQ +S   G+ T G+I +GAIVERE+     +
Sbjct: 137 LVTPMMGADGEVYAVAQGPIAVSGFTAQGQGASVTRGVPTSGRISSGAIVEREIQFSLAE 196

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP--TNIDLTRLM 242
              L L LRNPDF+TA R+A  IN           A+A D  +V ++ P     D+  L+
Sbjct: 197 LPVLRLSLRNPDFTTAQRVATAINIQLR----GNRAQATDPASVLINVPEARRGDVVGLV 252

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +E+E L +  D  ARV+++E++G IV+G+NVRIS V ++ GNLT++ITE  QV QP  F 
Sbjct: 253 TEIEQLRITPDQVARVVVDEKSGVIVMGENVRISTVAIAQGNLTIRITETPQVSQPGPF- 311

Query: 303 SNGSTVTQNNTDLKVSD--NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           S G T     TD++V D  N     +     L  L+  +N++G+    +I+ILQ IKAAG
Sbjct: 312 SQGQTAVVPRTDIQVDDQSNNRLAVMNSGVTLQELVQSLNALGVGPRDMIAILQSIKAAG 371

Query: 361 ALQSEIII 368
           ALQ+EI +
Sbjct: 372 ALQAEIEV 379


>gi|325923278|ref|ZP_08184951.1| flagellar basal-body P-ring protein [Xanthomonas gardneri ATCC
           19865]
 gi|325546205|gb|EGD17386.1| flagellar basal-body P-ring protein [Xanthomonas gardneri ATCC
           19865]
          Length = 372

 Score =  371 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/366 (39%), Positives = 209/366 (57%), Gaps = 8/366 (2%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L  ++      +     RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+
Sbjct: 10  LLAAAVAVCAIAAPASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSL 69

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           ++LL  LG++ P       KNVAAV + A LPPFA PG  ID++++S+ +A SLRGG L+
Sbjct: 70  KNLLGELGVNVPANVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRGGSLL 129

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           M  L GADG +YA+AQG++VV G   +G   S     I + G+I NGA VER LP  F  
Sbjct: 130 MAPLKGADGQVYAMAQGNLVVGGFGAQGKDGSRVSVNIPSVGRIPNGATVERALPDVFAG 189

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMS 243
           + ++ L L   DF+T  R+   I+    N F    A A D  TV V  PT+      L++
Sbjct: 190 TGEITLNLHQNDFTTVSRMVAAID----NSFGAGTARAVDGVTVSVRSPTDPGARIGLLA 245

Query: 244 EVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E + +   D PA+V++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS
Sbjct: 246 RLENVELSPGDAPAKVVVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFS 305

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
              + VT  +T    S+    F       L+ ++  +N +G     +++IL+ +K AGAL
Sbjct: 306 GGRTAVTPQSTITATSEGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGAL 365

Query: 363 QSEIII 368
            +E+ +
Sbjct: 366 TAELEV 371


>gi|283477480|emb|CAY73396.1| Flagellar P-ring protein precursor [Erwinia pyrifoliae DSM 12163]
          Length = 374

 Score =  371 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/378 (37%), Positives = 220/378 (58%), Gaps = 15/378 (3%)

Query: 1   MIFRIAFLI------FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGD 54
           M+ +   L+         + +   +     RI+D+ S+Q  R N L+GYGLVVGL GTGD
Sbjct: 1   MMMKKQTLLMSVSVLLCSLLVALPNMVRAERIRDLTSVQGVRANTLMGYGLVVGLDGTGD 60

Query: 55  SLRSSPFTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSL 113
               +PFT QS+ ++L  LGI+ P G  +  KN+AAVMVTA LP F+ PG RID+ ++SL
Sbjct: 61  QTMQAPFTGQSLNNMLSQLGITVPAGTNMQLKNIAAVMVTAELPAFSRPGDRIDIVVSSL 120

Query: 114 GDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAI 173
           G+A SLRGG L+MT L GAD  IYA+AQG+V++SG   +   S        GG+I  GA 
Sbjct: 121 GNAKSLRGGTLLMTPLKGADTQIYALAQGNVLISGAGAQAGGSRVQVNQLNGGRISGGAT 180

Query: 174 VERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP 233
           VERE+P  F     L LQL   DFS A +I+D IN           A   D+RTV++  P
Sbjct: 181 VEREVPNDFAKQTALRLQLNETDFSLAQQISDAINRRF-----SGGAVPEDARTVRLFGP 235

Query: 234 TN-IDLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITE 291
           T+     R ++ ++ + +      A+VI+N RTG++V+  +V +    +++G LTV++ +
Sbjct: 236 TDGPSRVRFLANIQDIPLHVAVQDAKVIVNSRTGSVVMNRHVTLESCAIAHGGLTVEVAQ 295

Query: 292 NEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGII 350
           N  + QP+   + G TV      + V D+ G+   +  + DLN+++  +N +G   + ++
Sbjct: 296 NNLISQPDTPLAGGETVVVPQAQISVRDSGGALQRVNSSADLNNVVRALNGLGATPNELM 355

Query: 351 SILQGIKAAGALQSEIII 368
           SILQ +K+AG L++++ I
Sbjct: 356 SILQAMKSAGCLRAKLEI 373


>gi|253702429|ref|YP_003023618.1| flagellar basal body P-ring protein [Geobacter sp. M21]
 gi|251777279|gb|ACT19860.1| flagellar P-ring protein [Geobacter sp. M21]
          Length = 398

 Score =  371 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 148/351 (42%), Positives = 218/351 (62%), Gaps = 9/351 (2%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
              +RIKD+ +    R+NQLIGYGLVVGL G+GDS   + F  QS+   L+ +GI+    
Sbjct: 53  AFGARIKDIAAFDGVRENQLIGYGLVVGLNGSGDSD-QTKFPVQSLVGALERMGITVNRN 111

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
            +  KN+A+VMVTA LPPFA  G+R+DV ++S+GDA SL GG L+M  L GAD  +YAVA
Sbjct: 112 DITVKNIASVMVTAQLPPFAKQGNRLDVLVSSMGDAKSLAGGTLMMAPLKGADNQVYAVA 171

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+V+ +     GQ++S M+   T G +  GA++ERE+P      + L L L   DF+TA
Sbjct: 172 QGAVLTNSFSYGGQAASAMKNHPTAGTVPGGALIEREIPNVLASRSQLKLNLHQSDFTTA 231

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARV 258
            R+A  IN     RF   +A   D  +V+++ P      +   ++ +E L V  D  ARV
Sbjct: 232 SRVASAINE----RFQGQVATLTDPGSVQIAVPAEYRNRVVEFVANLERLEVNPDVLARV 287

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++NERTGTIV+G+NVRIS V VS+GNLTV I E+ +V QP A +  G+T     T+L+V+
Sbjct: 288 VMNERTGTIVMGENVRISTVAVSHGNLTVVIKESPKVSQPRALAQ-GTTTVVPRTELRVA 346

Query: 319 DNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + K     + +  +L  ++  +N++G+    ++ I+Q IKAAGAL +E+ +
Sbjct: 347 EEKVNLSMVREGANLGEVVRALNTLGVTPRDLLGIMQAIKAAGALNAELSV 397


>gi|23092319|gb|AAN08644.1| FlgI [Aeromonas hydrophila]
          Length = 365

 Score =  371 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/370 (38%), Positives = 214/370 (57%), Gaps = 10/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +   L+  L  L  +     SRIKD +S++  R+NQLIGYGLVVGL GTG+   ++ FT
Sbjct: 1   MKSLRLVTLLCCLMPLGMAHASRIKDSISVEGVRNNQLIGYGLVVGLPGTGE--NNNAFT 58

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQ+ R++L N GI  P   +    ++A V + A+LPPF+ PG  IDV+++++G+A SLRG
Sbjct: 59  EQTFRTMLNNFGIKVPDNVKPIINDLAPVAIFADLPPFSKPGQTIDVTVSAIGEAKSLRG 118

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVK-GQSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ + L G DG +YAVAQG++VV GL  +    S  +    T G+I NGA V+RE   
Sbjct: 119 GTLLQSFLKGLDGRVYAVAQGTLVVCGLGAEWADGSKVVVNTPTVGRISNGATVQRECRT 178

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   L  PDF+TA R+AD +N           A A D+ +VKV  P +     
Sbjct: 179 PFFHGDTITFNLNRPDFTTARRLADVVNDLV----GPNTAHALDATSVKVYAPRDPGQRV 234

Query: 240 RLMSEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++ +E L V+  + A ++I+N RTGTIVIG  VR+    +S+G LTV I EN+QV QP
Sbjct: 235 SYLATIENLEVDPASEAAKIIVNSRTGTIVIGSQVRLKPAAISHGGLTVTIAENQQVSQP 294

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           N  S   + VT N+T     +    F L     L+ ++  +N +G+    +++IL+ ++ 
Sbjct: 295 NPLSGGQTAVTNNSTINVQQEQGRMFKLDTGATLDDMVRAVNQVGVAPGDLMAILEALQQ 354

Query: 359 AGALQSEIII 368
           AGA+  +++I
Sbjct: 355 AGAIVGQLVI 364


>gi|325927971|ref|ZP_08189192.1| flagellar basal-body P-ring protein [Xanthomonas perforans 91-118]
 gi|325541656|gb|EGD13177.1| flagellar basal-body P-ring protein [Xanthomonas perforans 91-118]
          Length = 372

 Score =  371 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 144/353 (40%), Positives = 206/353 (58%), Gaps = 8/353 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
                RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++ P 
Sbjct: 23  PASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVNVPA 82

Query: 80  G-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
                 KNVAAV + A LPPFA PG  ID++I+S+ +A SLRGG L+M  L GADG +YA
Sbjct: 83  NVNPQLKNVAAVAIHAELPPFAKPGQPIDITISSIANAVSLRGGSLLMAPLKGADGQVYA 142

Query: 139 VAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           +AQG++VV G   +G   S     + + G+I NGA VER LP  F  + ++ L L   DF
Sbjct: 143 MAQGNLVVGGFGAQGKDGSRVSVNVPSVGRIPNGATVERALPDVFAGTGEITLNLHQNDF 202

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET-DTP 255
           +T  R+   I+S     F    A A D  TV V  PT+      L+S +E + +   D P
Sbjct: 203 TTVSRMVAAIDS----SFGAGTARAVDGVTVAVRSPTDPGARIGLLSRLENVELSPGDAP 258

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+V++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VTQ +T  
Sbjct: 259 AKVVVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTQQSTIT 318

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             S+    F       L+ ++  +N +G     +++IL+ +K AGAL +E+ +
Sbjct: 319 ATSEGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAELEV 371


>gi|89067520|ref|ZP_01155033.1| flagellar P-ring protein precursor [Oceanicola granulosus HTCC2516]
 gi|89047089|gb|EAR53143.1| flagellar P-ring protein precursor [Oceanicola granulosus HTCC2516]
          Length = 365

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 151/352 (42%), Positives = 226/352 (64%), Gaps = 9/352 (2%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
            +  R+KD+V     R N L+GYGLVVGL GTGD LR+SPFTE+ M ++L+ LG++  G 
Sbjct: 18  AMPVRLKDLVEFDGVRSNDLVGYGLVVGLNGTGDGLRNSPFTEEIMTNILERLGVNVTGE 77

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
           +   KNVAAV+VTA+LPPFA  GS IDV+++++GDA SL GG L+MT +  ADG IYAVA
Sbjct: 78  QFRPKNVAAVIVTASLPPFARAGSPIDVTVSAIGDAGSLLGGTLIMTPMNAADGQIYAVA 137

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG+++  G   +G +++ ++G+ T G I +GA VERE+   F     + L LR PDF+TA
Sbjct: 138 QGTIIAGGASAEGDAAAVVQGVPTSGVIPSGATVEREVAFDFAALDQMRLALRTPDFTTA 197

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNIDLTRLMSEVEMLTVETDTPARV 258
            RI   +N      F   +A   DS TV+++            +  +E + VE +  ARV
Sbjct: 198 ARIEAAVNRA----FGAHVALMIDSGTVEINVAGTGAASPAHAIGRIENILVEPERRARV 253

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           ++++R+GTIV+G++VRIS+V VS GNLT++I E   VVQPN F + G TV    ++ +++
Sbjct: 254 VVDQRSGTIVMGEDVRISRVAVSQGNLTLRIEEAPLVVQPNPF-APGETVVVPRSEAEIA 312

Query: 319 DNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +    G   +     L+ +++G+N++G+    +I IL+ IKAAGAL +E I+
Sbjct: 313 EEPGIGLAEVQGGTSLSEVVAGLNALGVSPRDMIDILKSIKAAGALHAEFIV 364


>gi|238758106|ref|ZP_04619286.1| Flagellar P-ring protein [Yersinia aldovae ATCC 35236]
 gi|238703644|gb|EEP96181.1| Flagellar P-ring protein [Yersinia aldovae ATCC 35236]
          Length = 370

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 147/373 (39%), Positives = 220/373 (58%), Gaps = 9/373 (2%)

Query: 1   MIFRIAFLIFSLIGLHEI-SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           M+ + +  I  +  +  +       RI+D+V++Q  RDN LIGYGLVVGL G+GD    +
Sbjct: 1   MMRKQSLFILCITLISLVWMPAKAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQT 60

Query: 60  PFTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           PFT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF+  G  ID+ ++S+G+A S
Sbjct: 61  PFTTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPPFSRAGQTIDIVVSSMGNAKS 120

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           +RGG L+MT L G D  +YA+AQG+V+V G       SS      TGG+I  GA +EREL
Sbjct: 121 IRGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISGGATIEREL 180

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NID 237
           P  F     + LQL N DF+ A +++D IN           A A D+RT++V  P  N  
Sbjct: 181 PTTFGTDGVINLQLNNEDFTLAQQVSDAINRQR----GFGSATALDARTIQVRVPRGNSS 236

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
             R +++++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V 
Sbjct: 237 QVRFLADIQNIPVNVDAGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP+     G TV   NT + V    G    +  +P+LN+++  +NS+G     ++SILQ 
Sbjct: 297 QPDTPFGGGQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQA 356

Query: 356 IKAAGALQSEIII 368
           +++AG L++++ I
Sbjct: 357 MQSAGCLRAKLEI 369


>gi|159045916|ref|YP_001534710.1| flagellar basal body P-ring protein [Dinoroseobacter shibae DFL 12]
 gi|157913676|gb|ABV95109.1| flagellar P-ring protein FlgI [Dinoroseobacter shibae DFL 12]
          Length = 367

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 153/372 (41%), Positives = 230/372 (61%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + R+   IF  + L   +     R+KD+V     R N L+GYGLVVGL GTGD +R++PF
Sbjct: 1   MTRLFLAIFMSLNLAATAMATPIRLKDLVEFDGVRGNDLVGYGLVVGLNGTGDGIRNAPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE+ + ++L+ LG++  G +   KNVAAV+VTA LPPFA  GS+IDV+++++GDA SL G
Sbjct: 61  TEEILGNILERLGVNVSGEQFRPKNVAAVIVTAELPPFARVGSQIDVTVSAIGDAKSLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT +  ADG IYAVAQG+++  G  V G +   + G+ T G I  GA VE+E+   
Sbjct: 121 GTLIMTPMNAADGEIYAVAQGTIIAGGEAVAGGNEEIVTGVPTAGVIPAGARVEQEVDFV 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL 241
           F D   L L LR PDF+TA RI   IN +    F R +A   DS TV++        +  
Sbjct: 181 FGDLTSLRLALRAPDFTTAGRIESAINEF----FDRQVALMLDSGTVEIDISRTRLRSAA 236

Query: 242 MS--EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +   +E L +E +  ARV++++R+GTIV+G+NVR+S+V VS GNLT++I +   +  PN
Sbjct: 237 HAIGRIENLLIEPELRARVVVDQRSGTIVMGENVRVSRVAVSQGNLTLRIEDQPVIAVPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F S G T+      + + +    G   + +  +L+ +ISG+N++G+    +I IL+ IK
Sbjct: 297 PF-SRGDTIVVPRQVVTMEEEPGIGLAEVKEGTNLSEVISGLNALGVSPRDMIDILKSIK 355

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E +++
Sbjct: 356 AAGALHAEFVVR 367


>gi|149189840|ref|ZP_01868120.1| flagellar P-ring protein precursor I [Vibrio shilonii AK1]
 gi|148836326|gb|EDL53283.1| flagellar P-ring protein precursor I [Vibrio shilonii AK1]
          Length = 373

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 147/372 (39%), Positives = 225/372 (60%), Gaps = 11/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
            F    L F+L  +    A+V   I D+V +Q  R NQL+GYGLVVGL G GD      F
Sbjct: 7   FFTSILLAFALGMMSSARAEVEIPIMDLVDVQGVRTNQLVGYGLVVGLDGQGDR-NQVKF 65

Query: 62  TEQSMRSLLQNLGIST-PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA++ P A PG  +D+ ++S+GDA SLR
Sbjct: 66  TAQSITNMLRQFGVQIGDDANPKLRNVASVSVTASVDPMAGPGQMLDIVVSSIGDAKSLR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YAVAQG+VVV G+  +G+  S       T G++ NGA +ERE+P
Sbjct: 126 GGTLLLTPLRGVDGEVYAVAQGNVVVGGVSAEGRSGSKIAVNTPTAGRVPNGATLEREIP 185

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-L 238
             F   + + L LR   F+TA  IA +IN      F   +A A +   V +  P +    
Sbjct: 186 SDFNSRSQITLNLRKASFTTAKNIAREIN----GTFGPDVAIAINKVRVDMRAPKDTQQR 241

Query: 239 TRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
             +MS +E ++V E   PAR++ N RTGT+V+G NV++++  VS+GNLTV ITE++QV Q
Sbjct: 242 VTMMSMLEEMSVVEGRKPARIVFNSRTGTVVVGQNVKVTEAAVSHGNLTVSITESQQVSQ 301

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF ++G TV  + + + +S+++       +  +LN++++ +NS+G     ++SILQ +
Sbjct: 302 PNAF-ADGDTVVVDQSKIDISEDQAQMVIWPEGTELNTIVNAVNSLGATPTDLMSILQAL 360

Query: 357 KAAGALQSEIII 368
             AGAL +E+++
Sbjct: 361 HEAGALNAELVV 372


>gi|259907638|ref|YP_002647994.1| Flagellar P-ring protein 1, flgI [Erwinia pyrifoliae Ep1/96]
 gi|224963260|emb|CAX54744.1| Flagellar P-ring protein 1, flgI [Erwinia pyrifoliae Ep1/96]
          Length = 372

 Score =  370 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 141/371 (38%), Positives = 218/371 (58%), Gaps = 9/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +     ++   + +   +     RI+D+ S+Q  R N L+GYGLVVGL GTGD    +PF
Sbjct: 6   LLMSVSVLLCSLLVALPNMVRAERIRDLTSVQGVRANTLMGYGLVVGLDGTGDQTMQAPF 65

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L  LGI+ P G  +  KN+AAVMVTA LP F+ PG RID+ ++SLG+A SLR
Sbjct: 66  TGQSLNNMLSQLGITVPAGTNMQLKNIAAVMVTAELPAFSRPGDRIDIVVSSLGNAKSLR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L GAD  IYA+AQG+V++SG   +   S        GG+I  GA VERE+P 
Sbjct: 126 GGTLLMTPLKGADTQIYALAQGNVLISGAGAQAGGSRVQVNQLNGGRISGGATVEREVPN 185

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLT 239
            F     L LQL   DFS A +I+D IN           A   D+RTV++  PT+     
Sbjct: 186 DFAKQTALRLQLNETDFSLAQQISDAINRRF-----SGGAVPEDARTVRLFGPTDGPSRV 240

Query: 240 RLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           R ++ ++ + +      A+VI+N RTG++V+  +V +    +++G LTV++ +N  + QP
Sbjct: 241 RFLANIQDIPLHVAVQDAKVIVNSRTGSVVMNRHVTLESCAIAHGGLTVEVAQNNLISQP 300

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           +   + G TV      + V D+ G+   +  + DLN+++  +N +G   + ++SILQ +K
Sbjct: 301 DTPLAGGETVVVPQAQISVRDSGGALQRVNSSADLNNVVRALNGLGATPNELMSILQAMK 360

Query: 358 AAGALQSEIII 368
           +AG L++++ I
Sbjct: 361 SAGCLRAKLEI 371


>gi|91776313|ref|YP_546069.1| flagellar basal body P-ring protein [Methylobacillus flagellatus
           KT]
 gi|122399642|sp|Q1GZV9|FLGI_METFK RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|91710300|gb|ABE50228.1| flagellar P-ring protein [Methylobacillus flagellatus KT]
          Length = 368

 Score =  370 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 143/349 (40%), Positives = 211/349 (60%), Gaps = 8/349 (2%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-R 81
             RIKD+ ++Q  R NQLIGYGLVVGL GTGD    +PFT QS+ S++Q +GI+ P G  
Sbjct: 24  AERIKDLTTIQGVRSNQLIGYGLVVGLDGTGDQTTQTPFTVQSIVSMMQQMGINLPSGTN 83

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
           L  +NVAAVMVT NLPPFA PG  +DV+++S+G+A SLRGG L+MT L GAD  +YA+AQ
Sbjct: 84  LQLRNVAAVMVTGNLPPFAQPGQPMDVTVSSMGNARSLRGGTLLMTPLKGADNQVYAMAQ 143

Query: 142 GSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           G++V+ G       +S        G+I  GAIVER +P +  +++ + L+L+  DFSTA 
Sbjct: 144 GNLVIGGAGAGASGTSTQINHLGAGRISAGAIVERAVPSQLTETSTIRLELKEADFSTAS 203

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDT-PARVII 260
            + D IN     RF    A   D R ++V  P +I+    +  +E L V+    PA+VI+
Sbjct: 204 MVVDAINK----RFGNGTATPLDGRVIQVQPPMDINRIAFIGNLENLDVKPSQGPAKVIL 259

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG++V+   V +    +S+GNL+V I     + QP  F S G TV    + ++++  
Sbjct: 260 NARTGSVVMNQAVTLDDCAISHGNLSVVINTAPAISQPGPF-SGGQTVATQVSQVEINKE 318

Query: 321 KGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G    L     L  ++  +N+IG     +++ILQ +KAAG+L++++ I
Sbjct: 319 PGQVIKLDKGTSLADVVKALNAIGATPQDLVAILQAMKAAGSLRADLEI 367


>gi|197103393|ref|YP_002128771.1| flagellar basal-body P-ring protein [Phenylobacterium zucineum
           HLK1]
 gi|196480669|gb|ACG80196.1| flagellar basal-body P-ring protein [Phenylobacterium zucineum
           HLK1]
          Length = 377

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 174/369 (47%), Positives = 238/369 (64%), Gaps = 9/369 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
           F     +F++  L   S+   SRIKD+V ++  R+N L+GYGLVVGL GTGD+LR++PFT
Sbjct: 14  FAAFVSLFAVGLLAAPSSAATSRIKDIVQVEGVRENALVGYGLVVGLAGTGDALRNAPFT 73

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           +QS+ ++L+ LG++T   RL +KNVAAVMVTA LPPFA+ GS++D +++++G A SL GG
Sbjct: 74  QQSLEAMLERLGVNTRDARLNTKNVAAVMVTAKLPPFAAAGSQVDATVSAMGSAKSLMGG 133

Query: 123 ILVMTSLLGADGNIYAVAQGSVVV-SGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
            L++T LLGADG  YAVAQGSV   +        SS  +G+ T G+I +GAIVERE   +
Sbjct: 134 TLLVTPLLGADGQTYAVAQGSVQTGAVSASGASGSSVTKGVPTSGRIASGAIVERETGFQ 193

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRL 241
           F     L L LRNPDF+TA+R+AD IN           A A     V++S P     +  
Sbjct: 194 FNAMRQLRLNLRNPDFTTAVRVADAINRRF-----PDAARAQSPTIVQLSVPATSTTSGF 248

Query: 242 MSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           ++ VE L VETDTPARV+I+E  G IV+G +VRIS V +S GNLT+ + E   V QP+ F
Sbjct: 249 VTAVEALPVETDTPARVVIDEVAGVIVMGADVRISTVAISQGNLTISVRETPAVSQPSPF 308

Query: 302 SSNGSTVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
              G TV    + ++V + KG     L     L SL+SG+N++G+    +ISILQ IKAA
Sbjct: 309 -GQGETVVTPQSSVEVDEEKGRGLVRLPAGASLGSLVSGLNALGVTPRDMISILQAIKAA 367

Query: 360 GALQSEIII 368
           GALQ+EI +
Sbjct: 368 GALQAEIEV 376


>gi|289666052|ref|ZP_06487633.1| flagellar basal body P-ring protein [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 353

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 144/356 (40%), Positives = 207/356 (58%), Gaps = 8/356 (2%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
             +     RIKD+  +   R N L+GYGLVVGL G+GD    +PFT QS+++LL  LG++
Sbjct: 1   IAAPASAERIKDLAQVGGVRGNALVGYGLVVGLDGSGDRTSQAPFTVQSLKNLLGELGVN 60

Query: 77  TPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
            P       KNVAAV + A LPPFA PG  ID++++S+ +A SLRGG L+M  L GADG 
Sbjct: 61  VPANVNPQLKNVAAVAIHAELPPFAKPGQPIDITVSSIANAVSLRGGSLLMAPLKGADGQ 120

Query: 136 IYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRN 194
           +YA+AQG++VV G   +G   S     I + G+I NGA VER LP  F  + ++ L L  
Sbjct: 121 VYAMAQGNLVVGGFGAQGKDGSRVSVNIPSVGRIPNGATVERALPDVFAGTGEITLNLHQ 180

Query: 195 PDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET- 252
            DF+T  R+   I+S     F    A A D  TV V  PT+      L+S +E + +   
Sbjct: 181 NDFTTVSRMVAAIDS----SFGAGTARAVDGVTVAVRSPTDPGARIGLLSRLENVELSPG 236

Query: 253 DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNN 312
           D PA+V++N RTGT+VIG  VR+    +++G+LTV I+EN  V QP AFS   + VTQ +
Sbjct: 237 DAPAKVVVNARTGTVVIGQLVRVMPAAIAHGSLTVTISENTNVSQPGAFSGGRTAVTQQS 296

Query: 313 TDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           T    S+    F       L+ ++  +N +G     +++IL+ +K AGAL +E+ +
Sbjct: 297 TITATSEGSRMFKFEGGTTLDQIVRAVNEVGAAPGDLVAILEALKQAGALTAELEV 352


>gi|146278772|ref|YP_001168931.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557013|gb|ABP71626.1| flagellar P-ring protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 365

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 160/373 (42%), Positives = 229/373 (61%), Gaps = 12/373 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ R+  L   L      ++    RIKD+V     R N L+GYGLVVGL GTGD LR+SP
Sbjct: 1   MLIRLLILFLCL---TSSASAGQIRIKDLVRFDGVRGNDLVGYGLVVGLNGTGDGLRNSP 57

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTE  M +LL+ LG++  G     KNVAAV VTA LPPFA  G++IDV+++++GDA SL 
Sbjct: 58  FTEDIMSNLLERLGVNVTGEEYRPKNVAAVFVTATLPPFARAGAQIDVTVSAMGDAKSLL 117

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG LVMT L GADG IYAVAQG+++  G+  +GQ++  + G+ T G I  GA VERE+  
Sbjct: 118 GGTLVMTPLNGADGQIYAVAQGAIIAGGIAAEGQAARVVLGVPTAGMIPEGARVEREVDF 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNIDL 238
            F    ++ L LR PDF+TA RI ++IN        R +A   D+ TV +      +   
Sbjct: 178 DFASLNNVRLALRTPDFTTAGRIEERIN----RELGRGVAAMLDAGTVSLDLVRVRSPSP 233

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
              +S +E L VE    ARV++++R+GTIVIG+ VRIS+V V+ G LT+++ E   VVQP
Sbjct: 234 AHTLSRIENLAVEPQMVARVVVDQRSGTIVIGEEVRISRVAVAQGGLTLRVEEQPAVVQP 293

Query: 299 NAFSSNGSTVTQNNT--DLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           N F S G T+    T   ++  +  G   +     L+ +++G+N++G+  + +I IL+ I
Sbjct: 294 NPF-SQGETIVVPRTRASIEEREGTGLAEIPSETTLSRVVAGLNALGVAPNDMIDILKSI 352

Query: 357 KAAGALQSEIIIQ 369
            AAGAL +E I++
Sbjct: 353 HAAGALHAEFIVK 365


>gi|291613042|ref|YP_003523199.1| flagellar P-ring protein [Sideroxydans lithotrophicus ES-1]
 gi|291583154|gb|ADE10812.1| flagellar P-ring protein [Sideroxydans lithotrophicus ES-1]
          Length = 380

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 156/381 (40%), Positives = 222/381 (58%), Gaps = 17/381 (4%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +I  L F+L+ L  +SA    RIKD+ ++   R+NQLIGYGLVVGL G+GD    +PFT
Sbjct: 1   MKIRSLAFALLMLVSLSAA-AERIKDLATVLGVRENQLIGYGLVVGLDGSGDQTTQTPFT 59

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+ ++L  +GI+ P G  L  KNVAAV VTA+LPPF+ PG  IDV+++S+G+A SLRG
Sbjct: 60  VQSIVTMLSQMGITLPPGTSLQLKNVAAVTVTASLPPFSRPGQTIDVTVSSIGNAKSLRG 119

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L GADG +YA+AQG+++VSG       S  +      G+I  GA VER +P  
Sbjct: 120 GTLLMTPLKGADGQVYAMAQGNMLVSGAGAAAGGSKTVVNHLDVGRIPGGATVERSVPTA 179

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLN------------RFSRPIAEAYDSRTVK 229
                 + L+L   DF+TA R+AD IN   L               + P A   D+RT++
Sbjct: 180 LGQGDYIYLELNTADFTTATRLADVINHEVLPVQDITAAASGVVPATVPAAAPVDARTIQ 239

Query: 230 VSKPTNIDLTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQ 288
           V  P        +S +E L V      A+VIIN RTG++V+  +V +    V++GNLTV 
Sbjct: 240 VKAPEGSARVAFISRIENLEVNAAAGSAKVIINARTGSVVMNQHVSLDDCAVAHGNLTVV 299

Query: 289 ITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTD 347
           I     V QP    S G T   +N  +++  +KG+   L    DLN ++  +NSIG    
Sbjct: 300 INSENTVSQPAPL-SQGQTAGVSNASIEIKADKGNLLHLKSGVDLNDVVKALNSIGATPQ 358

Query: 348 GIISILQGIKAAGALQSEIII 368
            +++ILQ +KAAGAL++E+ +
Sbjct: 359 DMLAILQAMKAAGALRAELEV 379


>gi|295097199|emb|CBK86289.1| Flagellar basal-body P-ring protein [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 371

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 148/355 (41%), Positives = 219/355 (61%), Gaps = 8/355 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           +     RI+D+ ++Q  R N L+GYGLVVGL GTGD    +PFT QS+ ++L  LGI+ P
Sbjct: 21  TPAQAERIRDLATVQGVRSNSLMGYGLVVGLDGTGDQTMQAPFTGQSLNNMLSQLGITVP 80

Query: 79  GG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
            G  +  KN+AAVMVTA LPPFA  G +ID+ ++SLG+A SLRGG L+MT L GAD  IY
Sbjct: 81  AGTNMQLKNIAAVMVTAELPPFARSGDKIDIVVSSLGNAKSLRGGTLLMTPLKGADNQIY 140

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           A+AQG+V++SG   +   S        GG+I  GA VERE+P  F     L LQL   DF
Sbjct: 141 AMAQGNVLISGAGAQAGGSRVQVNQLNGGRISGGATVEREVPNDFATQNTLRLQLNESDF 200

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVETD-TP 255
           S A +I+D+IN     R+S   A   D+RTV++  P +     R ++ ++ + +  +   
Sbjct: 201 SLAQQISDEIN----RRYSGGAAIPEDARTVRLFAPPDGPSRVRFLANIQDIPLRVEIQD 256

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+VI+N RTG +V+  +V +    V+YG+LTV++T+N  V QP+     G TV    TD+
Sbjct: 257 AKVIVNSRTGAVVMNRHVSLDACAVAYGSLTVEVTQNNVVSQPDTPLGGGQTVVVPQTDI 316

Query: 316 KVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
            V D  GS   +  + DLN++I  +N++G   + ++SILQ +K AG L++++ ++
Sbjct: 317 SVRDRGGSLQSVRSSTDLNAVIRALNTLGATPNELMSILQSMKNAGCLRAKLEVE 371


>gi|332531622|ref|ZP_08407519.1| flagellar basal body P-ring protein [Hylemonella gracilis ATCC
           19624]
 gi|332038985|gb|EGI75414.1| flagellar basal body P-ring protein [Hylemonella gracilis ATCC
           19624]
          Length = 376

 Score =  369 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 146/356 (41%), Positives = 210/356 (58%), Gaps = 11/356 (3%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           S    +RIK+V S++  R NQL GYGLV+GL GTGD     P+T Q++ + LQ LGI+  
Sbjct: 25  STAHAARIKEVASIEGVRSNQLTGYGLVIGLDGTGDQTTQMPYTSQTLANYLQQLGITLD 84

Query: 79  G---GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
                RL  KNVAAV+VTA LP FA PG RID++++SLG+A SL+GG LV T L GADG 
Sbjct: 85  PTLASRLQLKNVAAVLVTAELPAFARPGQRIDITVSSLGNAKSLKGGTLVATPLRGADGQ 144

Query: 136 IYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           IYA+ QGS+VV+G       SS      + G++  GA+VER +P    +   + L L + 
Sbjct: 145 IYALGQGSLVVAGAGASAAGSSVQINHLSAGRVPGGALVERSVPTPLMEGGSVRLSLNSD 204

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVETDT 254
           DF TA R+A+ IN     RF   +A A D R++ V  PT  +     ++++E L V+  T
Sbjct: 205 DFLTASRVAEAINQ----RFGTGVANAMDGRSIDVRAPTAPNDRIAFLAQMEELNVQDTT 260

Query: 255 P-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
           P A+VIIN RTG+IV+   V +    +++GNL+V I     + QP    S G TV     
Sbjct: 261 PAAKVIINSRTGSIVLNQAVTLGPCAIAHGNLSVSINSTPVISQPAPL-SQGQTVVTEQA 319

Query: 314 DLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            ++V+   G+   +   P L  ++  +N++G     +++ILQ IKAAGAL +E+ +
Sbjct: 320 SIQVTQEPGNLINVPGSPTLQEVVRALNALGATPQDLLAILQAIKAAGALNAELEV 375


>gi|160896075|ref|YP_001561657.1| flagellar basal body P-ring protein [Delftia acidovorans SPH-1]
 gi|160361659|gb|ABX33272.1| flagellar P-ring protein [Delftia acidovorans SPH-1]
          Length = 382

 Score =  369 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 145/372 (38%), Positives = 217/372 (58%), Gaps = 12/372 (3%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           R  ++  +L           +RIK+V ++Q  R NQL GYGLVVGL GTGD     P+T+
Sbjct: 15  RPFWVAAALGASMLTLPAHATRIKEVAAIQGVRSNQLTGYGLVVGLDGTGDQTTQMPYTK 74

Query: 64  QSMRSLLQNLGISTPG----GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           Q++ + L+ +GIS P     G+L  KNVAAV+VTA LP FA PG  IDV ++S+G+A SL
Sbjct: 75  QALANYLEQMGISLPATGNSGQLQLKNVAAVIVTAELPAFAQPGQAIDVVVSSVGNAKSL 134

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           +GG LV T L GADG IYA+AQG++VV G       S       + G++  GA VER +P
Sbjct: 135 KGGTLVATPLRGADGEIYALAQGNLVVGGAGASAGGSKVQINHLSAGRVPQGAQVERAVP 194

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
               +   + L L   DF TA ++   IN     R  + +A+A D RTV+VS P +    
Sbjct: 195 TPINEGDSITLGLNATDFQTADKVVRAINQ----RMGQGVAQALDGRTVRVSAPQDPGSR 250

Query: 239 TRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R+++E++ + +ET  P A+V+IN RTG+IV+   V +    +++GNL + I+    + Q
Sbjct: 251 VRMIAEIQEMPIETSKPSAKVVINARTGSIVLNQAVTLGPCAIAHGNLAITISTTPVISQ 310

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGI 356
           P AF S G TV    +D+++    G+   +   P L  ++  +N++G     +++ILQ I
Sbjct: 311 PGAF-SQGQTVVAQKSDIQIKQEPGNIINMPGSPQLTDVVRALNTLGATPQDLLAILQAI 369

Query: 357 KAAGALQSEIII 368
           KAAGAL +E+ +
Sbjct: 370 KAAGALNAELEV 381


>gi|332187875|ref|ZP_08389608.1| flagellar P-ring family protein [Sphingomonas sp. S17]
 gi|332012036|gb|EGI54108.1| flagellar P-ring family protein [Sphingomonas sp. S17]
          Length = 365

 Score =  369 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 153/373 (41%), Positives = 218/373 (58%), Gaps = 14/373 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           MIFR  FL+  L      +     RIKD+   Q  R NQL GYG+VVGL GTGD   +  
Sbjct: 1   MIFR--FLLALLATFAIAAPAQADRIKDLGGFQGIRSNQLTGYGVVVGLPGTGD--DNLE 56

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +T QS+++++   G+  P     G KN A VMVTA LPPFA PG ++D+++ S+G A SL
Sbjct: 57  YTVQSLKAVVSRFGLQLPPNANPGMKNAAVVMVTAELPPFAKPGQKLDITVASMGKAKSL 116

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L++T L GADG IYA+AQG++ V GL  +G   S  +  + + G+I  GA VER +
Sbjct: 117 RGGSLILTPLQGADGQIYAMAQGNLAVGGLGAEGADGSKIVVNVPSAGRIPEGATVERAV 176

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID- 237
              F+ +  L   L   DF+TA  +A  IN+    R    IA+A D+ +V V  P   D 
Sbjct: 177 ATGFESAPMLTFNLARADFTTAQNVAQAINA----RLGMGIAQAMDAVSVAVRAPMGADV 232

Query: 238 LTRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
              LMSE+E L V   + PA+VI+N RTGT+VI   VR+    V++G LTV+I EN++V 
Sbjct: 233 RATLMSEIENLDVVSAEPPAKVIVNARTGTVVINSAVRVGPAAVTHGKLTVKIDENQRVS 292

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP    S G TV    + + V + +   F L   P L  ++  +N+IG     +++IL+ 
Sbjct: 293 QPAPL-SGGQTVVTPKSGVAVEEERRPMFLLNPGPKLADVVKAVNAIGAAPSDLVAILEA 351

Query: 356 IKAAGALQSEIII 368
           +K AGAL++E+I+
Sbjct: 352 LKEAGALKAELIV 364


>gi|294675567|ref|YP_003576182.1| flagellar P-ring protein FlgI [Rhodobacter capsulatus SB 1003]
 gi|294474387|gb|ADE83775.1| flagellar P-ring protein FlgI [Rhodobacter capsulatus SB 1003]
          Length = 365

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/348 (45%), Positives = 227/348 (65%), Gaps = 9/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKD+V     R N L+GYGLVVGL GTGD +R++PFTE+ M ++L+ LG++  G +   
Sbjct: 22  RIKDLVEFDGVRGNDLVGYGLVVGLNGTGDGIRNAPFTEEIMANILERLGVNVSGEQFRP 81

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KNVAAVMVTA LPPFA  GS+IDV+++++GDA SL GG L+MT L  ADG IYAVAQG+V
Sbjct: 82  KNVAAVMVTAALPPFARAGSKIDVTVSAIGDAKSLLGGTLIMTPLNAADGEIYAVAQGAV 141

Query: 145 VVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIA 204
           +  G+  +GQ++S ++G+ T G I +GA VERE+  +    +D+ L LR PDF+TA RI 
Sbjct: 142 IAGGVSAQGQAASVVQGVPTSGTIPSGAHVEREIGFELDSLSDVRLALRTPDFTTAARIE 201

Query: 205 DQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL--TRLMSEVEMLTVETDTPARVIINE 262
             IN      F   IA   DS TV VS           ++  +E LTVE +  ARV++++
Sbjct: 202 KAIN----REFGSRIAAMEDSGTVSVSIANANMRSAAHVLERLENLTVEPEQRARVVVDQ 257

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           R+GTIV+G++VRIS+V VS GNLT+++ E    VQPN F+  G TV    T+  + +  G
Sbjct: 258 RSGTIVMGEDVRISRVAVSQGNLTLRVQEAPIAVQPNPFAR-GETVVVPRTEASIEEGAG 316

Query: 323 --SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
                + +   L+ +++G+N++G+    +I IL+ I AAGAL +E ++
Sbjct: 317 LKMAEVGETSSLSDVVAGLNALGVSPRDMIDILKSINAAGALHAEFVV 364


>gi|188582479|ref|YP_001925924.1| flagellar basal body P-ring protein [Methylobacterium populi BJ001]
 gi|179345977|gb|ACB81389.1| flagellar P-ring protein [Methylobacterium populi BJ001]
          Length = 376

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 171/372 (45%), Positives = 243/372 (65%), Gaps = 9/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +   +A        L    A  +SR+KD+ +++  R NQL+GYG+VVGL GTGD+L + P
Sbjct: 9   IRRLVAVFACLAALLPPAPASALSRVKDLAAVEGVRTNQLVGYGIVVGLNGTGDTLNNIP 68

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FT+QS++++L+ LGI+T G  + ++N+AAVMVTANLPPFA+ G+ IDV+++SLGDA SL+
Sbjct: 69  FTKQSLQAMLERLGINTRGATMRTQNLAAVMVTANLPPFATQGTHIDVTVSSLGDAKSLQ 128

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG LV TSLLGADG IYA+AQGSV ++G   +G+++    G+ T G+I NGA++ERE+  
Sbjct: 129 GGTLVATSLLGADGEIYALAQGSVAIAGFAAEGEAAKITRGVPTNGRISNGALIEREMAF 188

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DL 238
           K  ++  L L LRNPDF+TA RIA  IN +         AE  D  T+ +  P     ++
Sbjct: 189 KLNEARSLRLSLRNPDFTTAKRIASAINDF----MGADTAEPTDPATITLQIPAKYRGNM 244

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
            RL++EVE L VE D  ARV+++ER+G IV+G +VR+S V ++ GNLTV ITE   V QP
Sbjct: 245 IRLITEVEQLKVEPDQTARVVVDERSGIIVMGRDVRVSTVAIAQGNLTVTITEQPMVSQP 304

Query: 299 NAFSSNGSTVTQNNTDLKVS--DNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
               SNG T     T +KV   D      + +   L  L+ G+N++G+    +ISILQ I
Sbjct: 305 APL-SNGQTAIVPRTGVKVDTGDGNKLALVKEGVSLRELVDGLNALGVGPRDLISILQAI 363

Query: 357 KAAGALQSEIII 368
           K AGALQ++I +
Sbjct: 364 KTAGALQADIEL 375


>gi|119899023|ref|YP_934236.1| flagellar basal body P-ring protein [Azoarcus sp. BH72]
 gi|119671436|emb|CAL95349.1| flagellar P-ring protein precursor [Azoarcus sp. BH72]
          Length = 370

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 148/360 (41%), Positives = 217/360 (60%), Gaps = 9/360 (2%)

Query: 13  IGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQN 72
           +G+   +     RIK++ S+   RDNQL+GYGLVVGL G+GD    +PFT QS+ ++L N
Sbjct: 15  VGMAVAAPASAERIKELASVAGVRDNQLVGYGLVVGLDGSGDQTTQTPFTVQSVINMLGN 74

Query: 73  LGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
           +G++ P G  L  KNVAAVMVTA LPPFA PG  +DV+++S+G+A SLRGG LVMT L G
Sbjct: 75  MGVTLPPGTNLQLKNVAAVMVTATLPPFARPGQAVDVTVSSMGNAKSLRGGTLVMTPLKG 134

Query: 132 ADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQ 191
           ADG IYA+AQG++VV G    G  +S      + G+I  GA VER +P        ++ +
Sbjct: 135 ADGQIYAIAQGNMVVGGAGASGGGASQTINHLSAGRIPGGATVERAVPTMLGQGDHILFE 194

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTV 250
           L + DF TA R+ D IN  +        AEA D RT++V  P +       + ++E L V
Sbjct: 195 LNDTDFGTARRVVDAINQSA----GHGSAEALDGRTIRVRAPADSSARVAFLGQLENLEV 250

Query: 251 ET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
                 A+VI+N RTG++V+   V +    V++GNLTV +  + +V QP    S G TVT
Sbjct: 251 TPVQQAAKVIVNSRTGSVVMNQRVTVQNCAVAHGNLTVSVNTDTRVSQPAPL-SGGQTVT 309

Query: 310 QNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             +  + +    G+ F++    +L  ++  +NS+G K   ++SILQ +KAAGAL++E+ +
Sbjct: 310 TQSGQVAIEQGAGTLFNVKAGANLADVVKALNSLGAKPMDLVSILQAMKAAGALRAELEV 369


>gi|311105939|ref|YP_003978792.1| flagellar P-ring protein [Achromobacter xylosoxidans A8]
 gi|310760628|gb|ADP16077.1| flagellar P-ring protein [Achromobacter xylosoxidans A8]
          Length = 378

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 154/372 (41%), Positives = 221/372 (59%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++  +A +  S+  +    A    R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R +P
Sbjct: 10  LLSLLARVCVSVGLVAGAGAAHAERLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTP 69

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+QS+ ++L  LGI+ P G  +  KNVAAVMVT  LP FA PG  +DV ++S+G+A SL
Sbjct: 70  FTQQSLTNMLSQLGITVPAGSNMQLKNVAAVMVTTTLPAFARPGQTLDVVVSSMGNAKSL 129

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L GAD  +YA+AQG+++V G       SS       GG+I  GAIVER +P
Sbjct: 130 RGGTLLMTPLKGADSQVYAIAQGNILVGGAGASAGGSSVQINQLNGGRISAGAIVERGVP 189

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDL 238
             F     + ++L N DF TA  +A  +N     +F    A A D R V+V  P      
Sbjct: 190 TTFSRDGYIHVELNNTDFGTAQNVAMALN----RKFGAGTATALDGRVVQVRTPMEQASQ 245

Query: 239 TRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +S+VE L V    T A+VIIN RTG++V+   V I +  V++GNL+V I    QV Q
Sbjct: 246 ARFLSQVEDLQVARAPTVAKVIINARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVSQ 305

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P+   + G TV   NT ++V    GS   +  + +L  ++ G+N++G     +++ILQ +
Sbjct: 306 PDTPFTEGQTVVVPNTQIEVRQENGSLQRVSTSANLADVVKGLNALGATPQDLLAILQAM 365

Query: 357 KAAGALQSEIII 368
           K AGAL++E+ I
Sbjct: 366 KTAGALRAELEI 377


>gi|315498273|ref|YP_004087077.1| flagellar p-ring protein [Asticcacaulis excentricus CB 48]
 gi|315416285|gb|ADU12926.1| flagellar P-ring protein [Asticcacaulis excentricus CB 48]
          Length = 370

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 156/368 (42%), Positives = 226/368 (61%), Gaps = 9/368 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
              FL           A   SRIKD+V ++  R NQL+GYGLVVGL GTGD++R++P  +
Sbjct: 8   LTTFLSLCAPVFGFAEASAASRIKDIVDIEGVRKNQLVGYGLVVGLNGTGDTVRNAPMLK 67

Query: 64  QSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           Q+M S++  L ++     L +KN A VMVTA LPPFA+PG+RIDV+++++GDA SL GG 
Sbjct: 68  QTMESMMGRLDVNIRDASLNTKNAAVVMVTAELPPFAAPGARIDVTVSAMGDAKSLLGGT 127

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKF 182
           L++T LLGADG  YA AQGS+    +   G   SS  +G+ T G+I +G I+ERE    F
Sbjct: 128 LLVTPLLGADGEAYAAAQGSIQTGSVSAGGASGSSVTKGVPTAGRIASGGIIERETGFDF 187

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLM 242
                + L L+NPDF+TA RIAD +N           A A +   V V     +++   +
Sbjct: 188 NAMPIVRLTLKNPDFTTAKRIADTVNKAY-----PGTAFADNPTVVSVRNRPEMNMMSFI 242

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           + +E + V  DTPA+V+I+E  G IVIG+NVR+S+V ++ GNLT+++ E   V QP  F 
Sbjct: 243 TAIEQMAVTVDTPAKVVIDEVNGVIVIGENVRVSRVAIAQGNLTIRVDERPFVSQPAPF- 301

Query: 303 SNGSTVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           S G T    ++ + V + KG   F L +   L  L++G+N++G+    +ISILQ IKA+G
Sbjct: 302 SQGQTTAVPDSSVSVEEEKGKRLFELQETTSLTDLVNGLNALGVSPRDMISILQTIKASG 361

Query: 361 ALQSEIII 368
           ALQ++I +
Sbjct: 362 ALQADIEV 369


>gi|300722677|ref|YP_003711967.1| putative flagella basal body protein [Xenorhabdus nematophila ATCC
           19061]
 gi|297629184|emb|CBJ89780.1| putative flagella basal body protein [Xenorhabdus nematophila ATCC
           19061]
          Length = 372

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 141/372 (37%), Positives = 221/372 (59%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++  +   +  L      ++    RI+D+ +++  RDN LIGYGLVVGL GTGD    +P
Sbjct: 4   LVASLFTFLLVLFNTFASASAFAERIRDLTTIEGVRDNALIGYGLVVGLDGTGDQTMQTP 63

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPFA  G  IDV ++SLG+A SL
Sbjct: 64  FTTQSLSNMLSQLGITVPSGTNMQLKNVAAVMVTAKLPPFARTGQNIDVVVSSLGNAKSL 123

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+++V G       +S       GG+I NGA++ERELP
Sbjct: 124 RGGTLLMTPLKGVDNQVYALAQGNILVGGAGASAGGNSIKINQLAGGRISNGAVIERELP 183

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDL 238
            +F     L LQL + DFS A +I+D +N           A   DSRTV++  P  N + 
Sbjct: 184 TQFGQKDTLNLQLNDDDFSLAQQISDAVNRLK----GTGTATPLDSRTVQLRLPIENSEQ 239

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            + +S+V+ L +  D   A+VI N RTG++V+  NV +    +++G+L+V +     V Q
Sbjct: 240 VKFLSQVQNLVIRVDAGDAKVIFNSRTGSVVMNRNVTLDSCAIAHGSLSVTVERQTAVNQ 299

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P+   + G+TV   NT++ + +  G+   +  + +L  ++  +N++G     +++ILQ +
Sbjct: 300 PDTPLAGGNTVVTRNTNIGIQEQGGALQQVNASANLAQVVRALNALGATPTDLMTILQAM 359

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 360 ESAGCLRAKLEI 371


>gi|303248236|ref|ZP_07334499.1| flagellar P-ring protein [Desulfovibrio fructosovorans JJ]
 gi|302490374|gb|EFL50285.1| flagellar P-ring protein [Desulfovibrio fructosovorans JJ]
          Length = 383

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 153/354 (43%), Positives = 228/354 (64%), Gaps = 8/354 (2%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
                  +RIKD+ S+   R NQL+GYGLVVGL GTGD  R S FT QS+ ++L  +G+ 
Sbjct: 35  TAGTAHGARIKDIASVSGMRRNQLVGYGLVVGLSGTGDQ-RGSDFTVQSIFNMLDKMGVR 93

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
                L  KNVAAVMVTA +P  A PGSR+DV+++S+GDA+SL GG+L++T + G DGNI
Sbjct: 94  VDKATLKPKNVAAVMVTAQMPVSARPGSRLDVTVSSIGDATSLLGGVLLVTPMKGVDGNI 153

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YA+AQGSV+V G+  +G  +S  + I+T G +  GA VER +   F D ADL L LRNPD
Sbjct: 154 YAIAQGSVLVGGVSAQGAGASVSKNITTVGLLPGGANVERAVAFSFNDQADLTLSLRNPD 213

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN--IDLTRLMSEVEMLTVETDT 254
           FSTA R+A ++N          +A A D+ T++++ P     +L  LM+ +E + V  D 
Sbjct: 214 FSTATRVAKRVNE----TMGAAMATAIDAGTIRLAVPPENQGNLAPLMASIENIEVTPDH 269

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            ARV+++E+TGT+V+G NV+IS V +++GNL +Q+ E+  V QP  F S G TV    T+
Sbjct: 270 RARVVVDEKTGTVVLGQNVQISPVAITHGNLQIQVQESADVSQPLPF-SGGQTVVTPQTN 328

Query: 315 LKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + V++      +I+   L  L+ G+N++G     +ISIL+ ++++GAL +++ +
Sbjct: 329 IGVTEENRKLKMIEGATLQELVEGLNALGATPRDLISILRTLESSGALAADLEV 382


>gi|308535386|ref|YP_002140547.2| flagellar basal body P-ring protein [Geobacter bemidjiensis Bem]
 gi|308052731|gb|ACH40751.2| flagellar P-ring protein FlgI [Geobacter bemidjiensis Bem]
          Length = 367

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 149/354 (42%), Positives = 219/354 (61%), Gaps = 9/354 (2%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
                 +RIKD+ +    R+NQLIGYGLVVGL G+GDS   + F  QS+   L+ +GI+ 
Sbjct: 19  PQVVFGARIKDIAAFDGVRENQLIGYGLVVGLNGSGDSD-QTKFPVQSLVGALERMGITV 77

Query: 78  PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
               +  KN+AAVMVTA LPPFA  G+R+DV ++S+GDA SL GG L+M  L GAD  +Y
Sbjct: 78  NRNDITVKNIAAVMVTAQLPPFAKQGNRLDVLVSSMGDAKSLAGGTLMMAPLKGADNQVY 137

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           AVAQG+V+ +     GQ++S M+   T G +  GA++ERE+P    + + L L L   DF
Sbjct: 138 AVAQGAVLTNSFSYGGQAASAMKNHPTAGTVPGGALIEREIPNVLANRSQLKLNLHQSDF 197

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVETDTP 255
           +TA R+A  IN     RF   +A   D  +V+++ P+     +   ++ +E L V  D  
Sbjct: 198 TTASRVAAAINE----RFQGQVATLTDPGSVQIAVPSEYQNRVVEFIANLERLEVNPDVL 253

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           ARV++NERTGTIV+G+NVRIS V VS+GNLTV + E  +V QP A +  G+T     TDL
Sbjct: 254 ARVVMNERTGTIVMGENVRISTVAVSHGNLTVVVKETPKVSQPRALAQ-GTTTVVPRTDL 312

Query: 316 KVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +V++ K     + +  +L  ++  +N++G+    ++ I+Q IKAAGAL +E+ +
Sbjct: 313 RVAEEKVNLSMVREGANLGEVVRALNTLGVTPRDLLGIMQAIKAAGALNAELSV 366


>gi|89072311|ref|ZP_01158890.1| flagellar P-ring protein precursor [Photobacterium sp. SKA34]
 gi|89051843|gb|EAR57295.1| flagellar P-ring protein precursor [Photobacterium sp. SKA34]
          Length = 373

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 148/374 (39%), Positives = 220/374 (58%), Gaps = 11/374 (2%)

Query: 1   MIFRIAFLIFSLIGL--HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS 58
           M++ I   +    G     +SA+    + D+V +Q  R NQL+GYGLVVGL G+GD    
Sbjct: 4   MVYFILSFLCVTFGWMPFNVSAKTAVPMMDLVDVQGIRSNQLVGYGLVVGLDGSGDR-NQ 62

Query: 59  SPFTEQSMRSLLQNLGIST-PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
             FT QS+ ++L+  G+          KNVA+V VTA +   A PG  +++ ++S+GDA 
Sbjct: 63  VKFTSQSITNMLRQFGVQIGDRIDPKLKNVASVSVTATVEAMAGPGQELNIVVSSIGDAK 122

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVER 176
           SLRGG L++T L G DG +YAVAQG+VVV G+  +GQ  S       T G+I NGA +ER
Sbjct: 123 SLRGGTLLLTPLRGIDGEVYAVAQGNVVVGGVKAEGQSGSKITVNTPTTGRIPNGATLER 182

Query: 177 ELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI 236
           E+P  F +S+ + L LR P F+TA  I+  IN+     F   +A A     V++  P ++
Sbjct: 183 EIPTDFNNSSIVTLNLRQPSFTTAKNISRAINA----TFGPKVATAISKGRVEMRAPQDL 238

Query: 237 D-LTRLMSEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQ 294
                 MS +E L V T   A RV+ N RTGT+V+G NVR+S+  VS+GNLTV I+E++Q
Sbjct: 239 QQRVTFMSMLEDLKVMTGRKAARVVFNARTGTVVVGKNVRVSEAAVSHGNLTVTISESDQ 298

Query: 295 VVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQ 354
           + QPNAFS   +    N+      D    +   +  +LN++++ +NS+G   D ++SILQ
Sbjct: 299 ISQPNAFSQGTTERVNNSNVDINQDEAQMYIWPEGTELNTIVNAVNSLGASPDDLMSILQ 358

Query: 355 GIKAAGALQSEIII 368
            +  AGAL +E+++
Sbjct: 359 ALHEAGALNAELVV 372


>gi|71279538|ref|YP_268226.1| flagellar basal body P-ring protein [Colwellia psychrerythraea 34H]
 gi|115311519|sp|Q485N9|FLGI_COLP3 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|71145278|gb|AAZ25751.1| flagellar P-ring protein FlgI [Colwellia psychrerythraea 34H]
          Length = 363

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 154/371 (41%), Positives = 216/371 (58%), Gaps = 14/371 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +    IF L       +    RIKD+  +   R NQLIGYGLVVGL GTG+    SPFT
Sbjct: 1   MKTVINIFILFTFLASLSANAQRIKDLADVAGVRSNQLIGYGLVVGLPGTGE---QSPFT 57

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           EQS +++L N GI+ P   +   KNVAAV V A L  F  PG  IDV+++S+G A SLRG
Sbjct: 58  EQSFKTMLSNFGITMPDKLKPKIKNVAAVAVHAELSAFTKPGQTIDVTVSSMGSAQSLRG 117

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L+G DGN YAVAQGS++VSGL  +G   S  +  I T G+I NG IVERE+  
Sbjct: 118 GTLIQTILMGIDGNAYAVAQGSLIVSGLGAQGLDGSQVLVNIPTVGRIANGGIVEREVKS 177

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            F     +   LR+ DF+TA  ++D IN           A+A D+ +V+V  P +I D  
Sbjct: 178 PFSSGDHITFNLRHSDFTTAKLLSDTINDLI-----EGSAKALDATSVRVRAPRDISDRV 232

Query: 240 RLMSEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S +E L  E  +PA ++I+N RTGTIVIG  V +    +++G +TV I E + V QP
Sbjct: 233 SFLSVLENLEFEPASPAAKIIVNSRTGTIVIGSEVTLLAAAITHGGITVTINEIQDVSQP 292

Query: 299 NAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           NAF + G TV  N +D+ VS+ +   F       L +L+  +N +G     +++IL+ + 
Sbjct: 293 NAF-AEGETVVTNQSDINVSNSDARMFVFKPGVTLETLVRAINEVGAGPGDVMAILEALD 351

Query: 358 AAGALQSEIII 368
            AGA++ E++I
Sbjct: 352 QAGAIRGELVI 362


>gi|78485808|ref|YP_391733.1| flagellar basal body P-ring protein [Thiomicrospira crunogena
           XCL-2]
 gi|124021074|sp|Q31FL4|FLGI_THICR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|78364094|gb|ABB42059.1| Flagellar P-ring protein FlgI [Thiomicrospira crunogena XCL-2]
          Length = 366

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 139/373 (37%), Positives = 216/373 (57%), Gaps = 14/373 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F    +I   + L   +     R+KD+ ++   R NQLIGYGLVVGL GTGD      +
Sbjct: 1   MFTRKSVILMAVLLIWSAVSYAERVKDLANVAGVRPNQLIGYGLVVGLSGTGDKTS---Y 57

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
            +QS+ S+L   GI+ P G +  SKNVAAV V A+LP F+  G RIDV+++SLG+A SLR
Sbjct: 58  ADQSLMSMLNKFGINLPPGTKTNSKNVAAVAVHADLPAFSKSGQRIDVTVSSLGNAKSLR 117

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DGN+YA+AQG+++V GL   G   S     + + G++  G IVE+ + 
Sbjct: 118 GGTLLLTPLKGVDGNVYALAQGNLIVGGLDASGADGSRITVNVPSVGRVPGGGIVEKTVN 177

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     + L L+N DF+TA  + + IN+    +  +  A A D+ +V+V  P      
Sbjct: 178 TGFDLGNTITLNLKNSDFTTATNLVNAINA----KLGKGTAYATDAESVEVMAPRIPNQR 233

Query: 239 TRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +S +E + V      A+VIIN RTGT+VIG NV++S   V++GNL V+++E++ V Q
Sbjct: 234 VAFLSVIENIEVTPGVDSAKVIINSRTGTVVIGSNVKVSAAAVTHGNLVVKVSESKDVSQ 293

Query: 298 PNAFSSNGSTVTQNNTDLKVSDN--KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           PN F + G+T     T+L V        F       L+ ++  +N +G     +++IL+ 
Sbjct: 294 PNPF-AGGNTQVTPKTELSVESEGKGRMFKFPKGVTLDDIVQAVNKVGAAPGDLVAILEA 352

Query: 356 IKAAGALQSEIII 368
           +K +GAL +++++
Sbjct: 353 LKQSGALSADLMV 365


>gi|94265703|ref|ZP_01289442.1| Flagellar P-ring protein [delta proteobacterium MLMS-1]
 gi|93453789|gb|EAT04161.1| Flagellar P-ring protein [delta proteobacterium MLMS-1]
          Length = 394

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/370 (34%), Positives = 207/370 (55%), Gaps = 17/370 (4%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +  +       + L  + AQ  +RIKD+ ++Q  R NQL+GYG+VVGL GTGD  R++ F
Sbjct: 38  VLALVTAGLLCLLLFTMEAQAAARIKDLAAVQGVRSNQLVGYGIVVGLDGTGDG-RNAVF 96

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T   + + ++N+G++     +  +NVA V+VTA LPPFA  G  +DV+++S+GDASSL+G
Sbjct: 97  TTTGLANAMRNMGLNFDPDNIQVRNVAGVIVTAKLPPFAKAGQNVDVTVSSIGDASSLQG 156

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G D  +YA+AQG V + G  ++G       E   T  +I  GA VERE+P 
Sbjct: 157 GTLLATPLKGLDNQVYAIAQGPVSIGGFELQGPAQPDRQENHPTVARIPAGASVEREVPL 216

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--L 238
            F+   ++++ L  PDF+T +R+   IN           A A D  TV ++ P       
Sbjct: 217 SFEQRDEIVISLNQPDFTTVMRMTRAINGL----LGAGSARARDGATVTIAVPEEYRDEE 272

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             L++ VE L +  D+ ARV+++ERTGT+V+G NVR+ ++ +S+GNL +         Q 
Sbjct: 273 ISLLAAVENLEIVPDSAARVVLDERTGTVVMGKNVRVRELALSHGNLNL---------QV 323

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
            A +     +        + ++     L +   L  ++  +NS+G+    +I+I Q +KA
Sbjct: 324 AAPAPGQEMLVPGEQPEMIEEDHNLVHLEEGATLGEVVQALNSVGVAPRDLIAIFQSMKA 383

Query: 359 AGALQSEIII 368
           +GAL +E+ I
Sbjct: 384 SGALNAELEI 393


>gi|94263284|ref|ZP_01287100.1| Flagellar P-ring protein [delta proteobacterium MLMS-1]
 gi|93456367|gb|EAT06491.1| Flagellar P-ring protein [delta proteobacterium MLMS-1]
          Length = 394

 Score =  368 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/370 (34%), Positives = 208/370 (56%), Gaps = 17/370 (4%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +  +       + L  + AQ  +RIKD+ ++Q  R NQL+GYG+VVGL GTGD  R++ F
Sbjct: 38  VLALVTAGLLCLLLFTMEAQAAARIKDLAAVQGVRSNQLVGYGIVVGLDGTGDG-RNAVF 96

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T   + + ++N+G++     +  +NVA V+VTA LPPFA  G  +DV+++S+GDASSL+G
Sbjct: 97  TTTGLANAMRNMGLNFDPDNIQVRNVAGVIVTAKLPPFAKAGQNVDVTVSSIGDASSLQG 156

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPK 180
           G L+ T L G D  +YA+AQG V + G  ++G       E   T  +I  GA VERE+P 
Sbjct: 157 GTLLATPLKGLDNQVYAIAQGPVSIGGFELQGPAQPDRQENHPTVARIPAGASVEREVPL 216

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--L 238
            F+   ++++ L  PDF+T +R+   IN           A A D  TV ++ P       
Sbjct: 217 SFEQRDEIVISLNQPDFTTVMRMTRAINGL----LGAGSARARDGATVTIAVPEEYRDDE 272

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             L++ VE L +  D+ ARV+++ERTGT+V+G NVR+ ++ +S+GNL +Q+         
Sbjct: 273 ISLLAAVENLEIVPDSAARVVLDERTGTVVMGKNVRVRELALSHGNLNLQV--------- 323

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
            A +     +        + ++     L +   L  ++  +NS+G+    +I+I Q +KA
Sbjct: 324 AAPAPGQEMLVPGEQPEMIEEDHNLVHLEEGATLGEVVQALNSVGVAPRDLIAIFQSMKA 383

Query: 359 AGALQSEIII 368
           +GAL +E+ I
Sbjct: 384 SGALNAELEI 393


>gi|92116899|ref|YP_576628.1| flagellar basal body P-ring protein [Nitrobacter hamburgensis X14]
 gi|123265353|sp|Q1QNM9|FLGI_NITHX RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|91799793|gb|ABE62168.1| flagellar P-ring protein [Nitrobacter hamburgensis X14]
          Length = 374

 Score =  368 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 166/370 (44%), Positives = 243/370 (65%), Gaps = 8/370 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           I RIA      +      A   SRIKD+ +++  R NQLIGYGLVVGL GTGD+L + PF
Sbjct: 9   IVRIAVAALVALAPLMTPAHATSRIKDLANIEGVRQNQLIGYGLVVGLNGTGDTLNNIPF 68

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T+QS++++L+ +G++  G  + + NVAAVMVT NLP FA+ G+R+DV+++++GDA SL G
Sbjct: 69  TKQSLQAMLERMGVNIRGATIRTGNVAAVMVTGNLPAFATQGTRMDVTVSAMGDAKSLHG 128

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L++T LLGADGN+YAVAQGS+ + G   +G ++S  +G+ T G+I NGAIVERE+   
Sbjct: 129 GTLLVTPLLGADGNVYAVAQGSLAIGGFAAEGAAASVTKGVPTNGRIANGAIVEREIEFA 188

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLT 239
                ++ L LRN DF+TA RIA  +N +         AE  D  TV++S P     ++ 
Sbjct: 189 LNKMPNVRLALRNGDFTTAKRIAAAVNDF----LGTKTAEPIDPSTVQLSIPAEFKGNVV 244

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            L++E+E L VE DT A++II+ER+G IV+G +VR++ V V+ GNLTV I+E+ QV QPN
Sbjct: 245 ALLTEIEQLQVEPDTAAKIIIDERSGIIVMGRDVRVATVAVAQGNLTVSISESPQVSQPN 304

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSL-IDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
              S G TV    T + V+++    +L  +   L  L+ G+N +G+    +I ILQ IKA
Sbjct: 305 PL-SRGRTVVTPRTAVGVTEDGKKLALVKNGVSLQELVDGLNGLGIGPRDLIGILQAIKA 363

Query: 359 AGALQSEIII 368
           AGA++++I +
Sbjct: 364 AGAIEADIEV 373


>gi|90577348|ref|ZP_01233159.1| flagellar P-ring protein precursor [Vibrio angustum S14]
 gi|90440434|gb|EAS65614.1| flagellar P-ring protein precursor [Vibrio angustum S14]
          Length = 373

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 149/374 (39%), Positives = 220/374 (58%), Gaps = 11/374 (2%)

Query: 1   MIFRIAFLIFSLIGL--HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS 58
           M++ I   +    G     +SA+    + D+V +Q  R NQL+GYGLVVGL G+GD    
Sbjct: 4   MVYFILSFLCVTFGWMPLNVSAKTAVPMMDLVDVQGIRSNQLVGYGLVVGLDGSGDR-NQ 62

Query: 59  SPFTEQSMRSLLQNLGIST-PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
             FT QS+ ++L+  G+          KNVA+V VTA +   A PG  ++V ++S+GDA 
Sbjct: 63  VKFTSQSITNMLRQFGVQIGDRIDPKLKNVASVSVTATVEAMAGPGQELNVVVSSIGDAK 122

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVER 176
           SLRGG L++T L G DG +YAVAQG+VVV G+  +GQ  S       T G+I NGA +ER
Sbjct: 123 SLRGGTLLLTPLRGIDGEVYAVAQGNVVVGGVKAEGQSGSKITVNTPTTGRIPNGATLER 182

Query: 177 ELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI 236
           E+P  F +S+ + L LR P F+TA  I+  IN+     F   +A A     V++  P ++
Sbjct: 183 EIPTDFNNSSIVTLNLRQPSFTTAKNISRAINA----TFGPKVATAISKGRVEMRAPQDL 238

Query: 237 D-LTRLMSEVEMLTVETDTPA-RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQ 294
                 MS +E L V T   A RV+ N RTGT+V+G NVR+S+  VS+GNLTV I+E++Q
Sbjct: 239 QQRVTFMSMLEDLKVMTGRKAARVVFNARTGTVVVGKNVRVSEAAVSHGNLTVTISESDQ 298

Query: 295 VVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQ 354
           + QPNAFS   +    N+      D    +   +  +LN++++ +NS+G   D ++SILQ
Sbjct: 299 ISQPNAFSQGTTERVNNSKVDINQDEAQMYIWPEGTELNTIVNAVNSLGASPDDLMSILQ 358

Query: 355 GIKAAGALQSEIII 368
            +  AGAL +E+++
Sbjct: 359 ALHEAGALNAELVV 372


>gi|290474978|ref|YP_003467862.1| putative flagella basal body protein [Xenorhabdus bovienii SS-2004]
 gi|289174295|emb|CBJ81085.1| putative flagella basal body protein [Xenorhabdus bovienii SS-2004]
          Length = 372

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 147/372 (39%), Positives = 222/372 (59%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++  +  L+ +L  +         RI+D+V+++  RDN LIGYGLVVGL GTGD    +P
Sbjct: 4   LVASLFTLLLALSSIFVSGTASAERIRDLVTIEGVRDNALIGYGLVVGLDGTGDQTMQTP 63

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPFA  G  IDV ++SLG+A SL
Sbjct: 64  FTTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPPFARSGQNIDVVVSSLGNAKSL 123

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+++V G  V    +S       GG+I NGA++ERELP
Sbjct: 124 RGGTLLMTPLKGIDNQVYALAQGNILVGGAGVSAGGNSIKINQLAGGRISNGAVIERELP 183

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
            +F     L LQL N DFS A +I+D +N        +  A   DSRTV++  P  N + 
Sbjct: 184 TQFGQKGTLNLQLNNDDFSLAEQISDAVNRLQ----GKGTATPLDSRTVQLRLPRENSEQ 239

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +S+++ L +  D   A+VI N RTG++V+  NV +    +++G+L+V +     V Q
Sbjct: 240 VRFLSQIQNLNIRVDAGDAKVIFNSRTGSVVMNRNVTLDSCAIAHGSLSVTVERQTAVNQ 299

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PN   + G+TV   NT + + +  G+   +  + +L  ++  +N +G     ++SILQ +
Sbjct: 300 PNTPLAGGNTVVTRNTGVGIQEQGGALQQVNASANLTQVVRALNVLGATPTDLMSILQAM 359

Query: 357 KAAGALQSEIII 368
           + AG L++++ I
Sbjct: 360 ETAGCLRAKLEI 371


>gi|134095093|ref|YP_001100168.1| flagellar basal body P-ring protein [Herminiimonas arsenicoxydans]
 gi|133738996|emb|CAL62044.1| Flagellar P-ring protein precursor (Basal body P-ring protein)
           [Herminiimonas arsenicoxydans]
          Length = 377

 Score =  368 bits (944), Expect = e-99,   Method: Composition-based stats.
 Identities = 146/372 (39%), Positives = 214/372 (57%), Gaps = 9/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +I +   ++     L    A    R+KD+ S+Q  R NQLIGYGLVVGL G+GD    +P
Sbjct: 10  IIKKSLQMLACSACLLMPLASQAERLKDLTSVQGVRQNQLIGYGLVVGLDGSGDQTTQTP 69

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ S++Q +GI+ P G  L  KNVAAVMVT++LP FA PG  +D++++S+G+A SL
Sbjct: 70  FTVQSVISMMQQMGINLPQGTNLQLKNVAAVMVTSSLPAFAQPGQTLDITVSSMGNAKSL 129

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L GADG IY +AQG+VVV G       S       + G+I  GA VER + 
Sbjct: 130 RGGTLLMTPLKGADGQIYGMAQGNVVVGGAGAAANGSKAQINHLSVGRISAGATVERAVA 189

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
                   + L+L+  DFSTA R+ D +N+    RF    A A D R ++V  P  N + 
Sbjct: 190 TTLGQGDVIFLELKESDFSTASRVVDAVNA----RFGPQTAAAQDGRVIRVRAPASNDER 245

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +  +E + V      A+VI+N RTG++V+   V +    VS+GNL+V I     + Q
Sbjct: 246 VSFLGALESINVTPAQVSAKVIMNARTGSVVMNQAVTLDACAVSHGNLSVTINTQPVISQ 305

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P  F S G TV    + +++S   G    L ++  L  ++  +NSIG     +++ILQ +
Sbjct: 306 PAPF-SGGQTVVAQQSQIEISKEPGKVILLKNSTSLADVVKALNSIGATPQDLLAILQAM 364

Query: 357 KAAGALQSEIII 368
           KA+G+L++E+ I
Sbjct: 365 KASGSLRAELEI 376


>gi|323492334|ref|ZP_08097487.1| flagellar basal body P-ring protein [Vibrio brasiliensis LMG 20546]
 gi|323313381|gb|EGA66492.1| flagellar basal body P-ring protein [Vibrio brasiliensis LMG 20546]
          Length = 403

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 139/366 (37%), Positives = 217/366 (59%), Gaps = 9/366 (2%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+ SL       A+    + D+V +Q  R+NQL+GYGLVVGL G GD      FT QS+
Sbjct: 42  LLMLSLGASASAQAEATIPVMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKFTSQSV 100

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++L+  G+          +NVA+V VTA + P A PG +++V ++S+GDA SLRGG L+
Sbjct: 101 TNMLRQFGVQIDDTTDPKLRNVASVSVTATVEPMAGPGQKLNVVVSSIGDAKSLRGGTLL 160

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           +T L G DG +YA+AQG+VVV G+  +G+  S  +    T G+I  GA +ERE+   F +
Sbjct: 161 LTPLRGIDGEVYAIAQGNVVVGGVSAEGKSGSKIVINTPTSGRIPGGATLEREVASDFSE 220

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMS 243
              ++L LR P F+TA  IA ++N+     F   +A A ++  + +  P +      +MS
Sbjct: 221 QQHIVLNLRKPSFTTAKNIAREVNNI----FGPEVAVAKNNVRINIRAPKDSQQRVVMMS 276

Query: 244 EVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E ++V E   PAR++ N RTGT+VIG +V++S+  VS+GNLTV I E++QV QPNAF+
Sbjct: 277 MLEEISVVEGRKPARIVFNSRTGTVVIGKSVKVSEAAVSHGNLTVTIAESQQVSQPNAFA 336

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
              +TV   +      +           +LN++++ +NS+G     ++SILQ +  AGAL
Sbjct: 337 DGETTVVDQSQLDVSEERAQMAIWPPGTELNTIVNAVNSLGATPTDLMSILQALHEAGAL 396

Query: 363 QSEIII 368
            +E+++
Sbjct: 397 NAELVV 402


>gi|289523329|ref|ZP_06440183.1| flagellar P-ring protein FlgI [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503021|gb|EFD24185.1| flagellar P-ring protein FlgI [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 374

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 149/378 (39%), Positives = 215/378 (56%), Gaps = 20/378 (5%)

Query: 2   IFRIAFLIFSLIGLH--------EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTG 53
           ++++ F    + G+                 R+KD+  ++  R NQL G GLVVGL GTG
Sbjct: 5   LYKVVFCFLCVFGILGAILVESEASELAPSVRLKDLAVVEGARSNQLTGIGLVVGLPGTG 64

Query: 54  DSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSL 113
           D    S    + +R++ +  G+S     + S+NVAAV VT NLPPF   G  +DV +++L
Sbjct: 65  DR---SGMATRMIRNMAEQYGLSLGTREIRSRNVAAVTVTCNLPPFTREGQTVDVLVSTL 121

Query: 114 GDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAI 173
           GDA SL GG+L+ T L  A+GN+YAVAQG V   G  V G ++     I+T G+I  GAI
Sbjct: 122 GDAKSLDGGVLLQTPLKAANGNVYAVAQGPVTTGGFAVGGAATQVSRNITTTGRIPGGAI 181

Query: 174 VERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP 233
           VER++P ++   + L L LR PDF+TA R+A  IN+         IA   D+  V+V+ P
Sbjct: 182 VERDVPMEYASDSKLSLLLRQPDFTTAQRLALSINNKFG-----QIAVPLDAARVEVAFP 236

Query: 234 TNI--DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITE 291
                     ++ +E L V  D+ ARV++NERTGT+V+G NV+IS V VS+GNLTV + E
Sbjct: 237 PAYAQYPASFVASLEQLEVRPDSVARVVVNERTGTVVMGGNVKISAVAVSHGNLTVAVAE 296

Query: 292 NEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAP-DLNSLISGMNSIGLKTDGII 350
             QVVQP  F + G T     T++ V + +G    + A   +  L+  +NSIG     +I
Sbjct: 297 APQVVQPEPF-AGGQTAVVPRTEIAVEEQQGRVISMPATATVTELVDALNSIGATPRDVI 355

Query: 351 SILQGIKAAGALQSEIII 368
           +ILQ I  AGAL  E+++
Sbjct: 356 TILQAINEAGALHGELVV 373


>gi|161526182|ref|YP_001581194.1| flagellar basal body P-ring protein [Burkholderia multivorans ATCC
           17616]
 gi|189349102|ref|YP_001944730.1| flagellar basal body P-ring protein [Burkholderia multivorans ATCC
           17616]
 gi|160343611|gb|ABX16697.1| flagellar P-ring protein [Burkholderia multivorans ATCC 17616]
 gi|189333124|dbj|BAG42194.1| flagellar P-ring protein precursor [Burkholderia multivorans ATCC
           17616]
          Length = 390

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 148/375 (39%), Positives = 214/375 (57%), Gaps = 19/375 (5%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L+ ++       A    R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ 
Sbjct: 20  LLIAVACALGAPAAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLA 79

Query: 68  SLLQNLGISTPG----------GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           ++L NLGIS               +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A 
Sbjct: 80  NMLANLGISINNGSANGGTSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAK 139

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SLRGG L++T L GADG +YA+AQG++ V G       S         G+IV GAIVER 
Sbjct: 140 SLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERS 199

Query: 178 LPKKFKDSA-DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI 236
           +P         L LQL + D+ TA RI   +NS     F   +A A D RT++++ P + 
Sbjct: 200 VPNALAQMNGMLQLQLNDMDYGTAQRIVAAVNS----SFGPGVATALDGRTIQLAAPADP 255

Query: 237 -DLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQ 294
                 M+ ++ L V  D   ARVI+N RTG+IV+   V +    V++GNL+V +     
Sbjct: 256 AQQVAFMARLQNLDVSPDKAAARVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPV 315

Query: 295 VVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISIL 353
           V QP  F SNG TV    + +++  + G+  ++    +L  ++  +N++G     ++SIL
Sbjct: 316 VSQPGPF-SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSIL 374

Query: 354 QGIKAAGALQSEIII 368
           Q +KAAGAL++++ I
Sbjct: 375 QAMKAAGALRADLEI 389


>gi|269138586|ref|YP_003295286.1| flagellar basal body P-ring protein [Edwardsiella tarda EIB202]
 gi|267984246|gb|ACY84075.1| flagellar basal body P-ring protein [Edwardsiella tarda EIB202]
 gi|304558596|gb|ADM41260.1| Flagellar P-ring protein FlgI [Edwardsiella tarda FL6-60]
          Length = 379

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 150/368 (40%), Positives = 219/368 (59%), Gaps = 9/368 (2%)

Query: 6   AFLIFSLIGL-HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           A+L   L+ L          RI+D+ S+Q  R+N LIGYGLVVGL GTGD    +PFT Q
Sbjct: 15  AWLTGMLLALGLLSQGAQAERIRDLTSIQGVRNNALIGYGLVVGLDGTGDQTMQTPFTTQ 74

Query: 65  SMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           S+ ++L  LGI+ P G  +  KNVAAVMVTANLPPF+ PG  IDV ++S+G+A SLRGG 
Sbjct: 75  SLNNMLSQLGITVPPGTNMQLKNVAAVMVTANLPPFSRPGQTIDVVVSSMGNAKSLRGGT 134

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L+MT L G D  +YA+AQG+V+V G       SS      +GG+I  GA +ER +P  F 
Sbjct: 135 LLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLSGGRISGGATIERAVPTTFG 194

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLM 242
           +S  + L+L N DF+ A  I+D IN  +        A   D+RTV+V  P    +  R +
Sbjct: 195 NSNVINLELNNEDFTLAQHISDAINRAN----GLGAATPLDARTVQVLVPQGGSNQVRAL 250

Query: 243 SEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           + ++ + V   T  A+VIIN RTG++V+  NV +    V+ GNL+V +     V QPN  
Sbjct: 251 ANIQNIEVNVGTFDAKVIINSRTGSVVMNRNVELDSCAVAQGNLSVVVDRQLNVSQPNTP 310

Query: 302 SSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
              G TV   NT + V+ + G+   +    +LNS++  +N++G   + ++SILQ +++AG
Sbjct: 311 FGGGQTVVTPNTQISVNQSGGALHQVRAGANLNSVVRALNALGATPNDLMSILQAMQSAG 370

Query: 361 ALQSEIII 368
            L++++ I
Sbjct: 371 CLRAKLEI 378


>gi|288962670|ref|YP_003452964.1| flagellar P-ring protein precursor [Azospirillum sp. B510]
 gi|288914936|dbj|BAI76420.1| flagellar P-ring protein precursor [Azospirillum sp. B510]
          Length = 390

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 168/350 (48%), Positives = 237/350 (67%), Gaps = 9/350 (2%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
            +R+KD+V+    R NQL+GYGLVVGL GTGD L ++PFTEQS++ +++ LGI+T G  L
Sbjct: 45  QTRVKDLVTFDGVRRNQLVGYGLVVGLNGTGDRLINTPFTEQSLKGMMERLGINTRGETL 104

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            ++N AAVMVTA+LPPF   G+ +DV++++LGDA+SL GG LV+T LLGADG  YAVAQG
Sbjct: 105 RTRNAAAVMVTASLPPFPRQGTNVDVTVSALGDATSLLGGTLVVTPLLGADGEAYAVAQG 164

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
            + VSG    G +++  +G+ T  +I NGA VEREL     D   + + LRNPDF+TAIR
Sbjct: 165 PLSVSGYTAGGAAATVTKGVPTTARIANGATVERELKFALNDVGAVRMALRNPDFTTAIR 224

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDTPARVII 260
           IAD +NS    R     A   D  TV V    +   +++RL+ E+E L V  D  ARV++
Sbjct: 225 IADAVNS----RLGAGNARVVDLTTVDVRITGSYVGNVSRLIGEIEQLPVRPDAIARVVV 280

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +ER+GTIVIGD+VR+S+V ++ GNLTV++ E  QV QP  F SNGSTV    TD++V + 
Sbjct: 281 DERSGTIVIGDDVRVSRVAITQGNLTVRVVETPQVSQPQPF-SNGSTVVVPRTDVQVQEG 339

Query: 321 KGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G    ++     L  L++G+N++G+    +++ILQ IKAAGAL +++ I
Sbjct: 340 NGRQFVTVGGNVSLQQLVNGLNALGVGPRDMVAILQAIKAAGALHADLEI 389


>gi|134297194|ref|YP_001120929.1| flagellar basal body P-ring protein [Burkholderia vietnamiensis G4]
 gi|134140351|gb|ABO56094.1| flagellar P-ring protein [Burkholderia vietnamiensis G4]
          Length = 390

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 145/374 (38%), Positives = 209/374 (55%), Gaps = 19/374 (5%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
              +      +     R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ +
Sbjct: 21  FMLIACAFGAAGAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLAN 80

Query: 69  LLQNLGISTPG----------GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           +L NLGIS               +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A S
Sbjct: 81  MLANLGISINNGSANGGSSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKS 140

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           LRGG L++T L GADG +YA+AQG++ V G       S         G+I  GAIVER +
Sbjct: 141 LRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSV 200

Query: 179 PKKFKDSAD-LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI- 236
           P         L LQL + D+ TA RI   +NS     F    A A D RT++++ P +  
Sbjct: 201 PNAVAQMNGVLQLQLNDMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLAAPADPS 256

Query: 237 DLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V
Sbjct: 257 QQVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVV 316

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQ 354
            QP  F SNG TV    + +++  + GS  ++    +L  ++  +N++G     ++SILQ
Sbjct: 317 SQPGPF-SNGQTVVAQQSQIQLKQDNGSLKMVTAGANLADVVKALNTLGATPADLMSILQ 375

Query: 355 GIKAAGALQSEIII 368
            +KAAGAL++++ I
Sbjct: 376 AMKAAGALRADLEI 389


>gi|295688539|ref|YP_003592232.1| flagellar P-ring protein [Caulobacter segnis ATCC 21756]
 gi|295430442|gb|ADG09614.1| flagellar P-ring protein [Caulobacter segnis ATCC 21756]
          Length = 374

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 157/350 (44%), Positives = 230/350 (65%), Gaps = 9/350 (2%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR 81
             SRIKD+V+ +  R+NQL+GYG+VVGL G+GDSLR++P T+QS+ ++L+  G++     
Sbjct: 30  AKSRIKDIVAFEGVRENQLVGYGVVVGLNGSGDSLRNAPMTKQSLEAMLERQGVNVRDAT 89

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
           L +KN A VMVTA+LPPF++ GS++DV++++LGDA SL GG L++TSL GADG  YAVAQ
Sbjct: 90  LNTKNTATVMVTASLPPFSAAGSKLDVTVSALGDAKSLLGGTLLVTSLQGADGQTYAVAQ 149

Query: 142 GSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           G+V    +   G   SS  +G+ T G+I +G I+ERE   +  +   L + LRNPDF+TA
Sbjct: 150 GTVQTGSVSAGGASGSSVTKGVPTAGRIASGGIIERETGFQMVNMDILRMTLRNPDFTTA 209

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVII 260
            RIAD +N           A+A +   V V  P  +D+   ++ +E L VE D PA+V+I
Sbjct: 210 RRIADAVNKKF-----PNCAQAQNPTIVAVRAPPGMDMISFVTNIENLEVEPDFPAKVVI 264

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           +E  G IV+GD+VRIS+V ++ GNLT+ + E+  V QP  F S G T     + + V + 
Sbjct: 265 DEVAGVIVMGDDVRISQVAIAQGNLTITVQESPAVSQPAPF-SQGQTAVVPQSAVSVEEE 323

Query: 321 KGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           KG    +L  +P L SL+ G+N++G+    +ISILQ +KAAGALQ++I +
Sbjct: 324 KGKKLITLGGSPSLKSLVGGLNALGVTPRDMISILQAVKAAGALQADIEV 373


>gi|107023949|ref|YP_622276.1| flagellar basal body P-ring protein [Burkholderia cenocepacia AU
           1054]
 gi|116691036|ref|YP_836659.1| flagellar basal body P-ring protein [Burkholderia cenocepacia
           HI2424]
 gi|105894138|gb|ABF77303.1| flagellar P-ring protein [Burkholderia cenocepacia AU 1054]
 gi|116649125|gb|ABK09766.1| flagellar P-ring protein [Burkholderia cenocepacia HI2424]
          Length = 391

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 144/377 (38%), Positives = 210/377 (55%), Gaps = 19/377 (5%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
                    +   +     R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q+
Sbjct: 19  FAAFVLAACMLGAAPAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQT 78

Query: 66  MRSLLQNLGISTPG----------GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGD 115
           + ++L NLGIS               +  KNVAAVMVTA LPPFA PG  +DV+++SLG+
Sbjct: 79  LANMLANLGISINNGSANGGPSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGN 138

Query: 116 ASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVE 175
           A SLRGG L++T L GADG +YA+AQG++ V G       S         G+IV GAIVE
Sbjct: 139 AKSLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVE 198

Query: 176 RELPKKFKDSAD-LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT 234
           R +P         L LQL + D+ TA RI   +NS     F    A A D RT++++ P 
Sbjct: 199 RAVPNAIAQMNGVLQLQLNDMDYGTAQRIVSAVNS----NFGPGTATALDGRTIQLAAPA 254

Query: 235 N-IDLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
           +       M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +   
Sbjct: 255 DSAQQVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQ 314

Query: 293 EQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIIS 351
             V QP  F SNG TV    + +++  + G+  ++    +L  ++  +N++G     ++S
Sbjct: 315 PVVSQPGPF-SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMS 373

Query: 352 ILQGIKAAGALQSEIII 368
           ILQ +KAAGAL++++ +
Sbjct: 374 ILQAMKAAGALRADLEV 390


>gi|170734370|ref|YP_001766317.1| flagellar basal body P-ring protein [Burkholderia cenocepacia
           MC0-3]
 gi|254246968|ref|ZP_04940289.1| Flagellar P-ring protein [Burkholderia cenocepacia PC184]
 gi|124871744|gb|EAY63460.1| Flagellar P-ring protein [Burkholderia cenocepacia PC184]
 gi|169817612|gb|ACA92195.1| flagellar P-ring protein [Burkholderia cenocepacia MC0-3]
          Length = 391

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 144/377 (38%), Positives = 210/377 (55%), Gaps = 19/377 (5%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
                    +   +     R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q+
Sbjct: 19  FAAFVLAACVLGAAPAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQT 78

Query: 66  MRSLLQNLGISTPG----------GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGD 115
           + ++L NLGIS               +  KNVAAVMVTA LPPFA PG  +DV+++SLG+
Sbjct: 79  LANMLANLGISINNGSANGGPSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGN 138

Query: 116 ASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVE 175
           A SLRGG L++T L GADG +YA+AQG++ V G       S         G+IV GAIVE
Sbjct: 139 AKSLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVE 198

Query: 176 RELPKKFKDSAD-LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT 234
           R +P         L LQL + D+ TA RI   +NS     F    A A D RT++++ P 
Sbjct: 199 RAVPNAIAQMNGVLQLQLNDMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLAAPA 254

Query: 235 N-IDLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
           +       M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +   
Sbjct: 255 DSAQQVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQ 314

Query: 293 EQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIIS 351
             V QP  F SNG TV    + +++  + G+  ++    +L  ++  +N++G     ++S
Sbjct: 315 PVVSQPGPF-SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMS 373

Query: 352 ILQGIKAAGALQSEIII 368
           ILQ +KAAGAL++++ +
Sbjct: 374 ILQAMKAAGALRADLEV 390


>gi|146277704|ref|YP_001167863.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555945|gb|ABP70558.1| flagellar P-ring protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 371

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 142/378 (37%), Positives = 227/378 (60%), Gaps = 20/378 (5%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R A ++  L+ L         R+KD+ S+   R N L+GYG+VVGL GTGD   +S  T
Sbjct: 1   MRGALILAVLMAL--APPAWADRLKDLTSVAGVRANPLVGYGVVVGLSGTGDG--NSQLT 56

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           +QSM+SL+  LG+S   G L +KN AAVMVTA+LPPF   G  +DV+++++G A SL+GG
Sbjct: 57  QQSMQSLISRLGLSVETGDLKAKNAAAVMVTADLPPFLKIGQTLDVTVSTVGQAKSLKGG 116

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKK 181
            L+MT L+GADG +YA+AQG++VV GL V+G   SS    I T G++  G +VER +   
Sbjct: 117 TLLMTPLMGADGEVYAIAQGNLVVGGLGVEGRDGSSLTVNIPTVGRVPRGGMVERMVETP 176

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
           F ++  LIL L   DFSTA  +A+ +N      F   +A A D  +++V  P +      
Sbjct: 177 FLETDHLILNLNRGDFSTAAAVAEGVN----RTFGPDVAVALDGTSIRVRAPADPAQRVT 232

Query: 241 LMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP- 298
            MS +E + ++   P A+V++N RTGT+VIG  V+++   V++G+LTV++TE+++V Q  
Sbjct: 233 FMSLLENVEIDPAPPVAKVVVNARTGTVVIGGTVKVTPAAVTHGSLTVRVTEDQRVSQGA 292

Query: 299 -------NAFSSNGSTVTQNNTDLKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGII 350
                      + G  V   ++ + V++    +F       L+SL+  +N++G     ++
Sbjct: 293 SVVVGNNATVVAPGEPVITPDSGIDVTEEPARAFVFDPGVSLSSLVDAINAVGASPSDLV 352

Query: 351 SILQGIKAAGALQSEIII 368
           +IL+ ++ AGAL++E+++
Sbjct: 353 AILEALREAGALRAELVV 370


>gi|74101662|gb|AAZ99752.1| FlgIL [Aeromonas hydrophila]
          Length = 385

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 144/373 (38%), Positives = 210/373 (56%), Gaps = 11/373 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSR-IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           M      LI   +     +A    R + D+  +Q  R NQL+GYGLVVGL GTGD     
Sbjct: 18  MNKWFITLICLSLPWWANAAPPAKRALLDIADVQGMRTNQLVGYGLVVGLSGTGDRS-QV 76

Query: 60  PFTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
            FT QSM ++L+  G+  P       KNVAAV V A LP  A  G  +DV++ S+GDA S
Sbjct: 77  KFTGQSMANMLKQFGVQLPDDLDPKLKNVAAVSVQATLPALAGKGQLVDVTVTSIGDAKS 136

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERE 177
           LRGG L++T L G DG++YAVAQG++VV+G+  +GQ  SS    + T G I NGAI+ERE
Sbjct: 137 LRGGSLLLTPLRGIDGDVYAVAQGNLVVAGVKAEGQSGSSVTINVPTAGIIPNGAIIERE 196

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-I 236
               F D  ++ L L  P+F TA  +  +IN         P+A A  +  ++V+ P +  
Sbjct: 197 AVSNFADKPEVTLNLHQPNFKTARNVEREINRQLG-----PVARAVSAGRIQVTAPKDES 251

Query: 237 DLTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                M+ ++ + V+      RV+ N RTGT+V+G  V++ K  VS+G+LTV I E++ V
Sbjct: 252 QRISFMALLQDIQVDMGKERPRVVFNSRTGTVVMGQGVKVHKAAVSHGSLTVTIGESQNV 311

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
            QPNAFS+  +T T N+      +    F   D   L  ++  +NS+G   D +++ILQ 
Sbjct: 312 SQPNAFSNGQTTTTPNSKVQVDRERNNMFVWPDGTSLEVIVKAVNSLGATPDDVMAILQA 371

Query: 356 IKAAGALQSEIII 368
           +  AGAL+ E+++
Sbjct: 372 LDEAGALEGELVV 384


>gi|27381982|ref|NP_773511.1| flagellar basal body P-ring protein [Bradyrhizobium japonicum USDA
           110]
 gi|81735146|sp|Q89F30|FLGI2_BRAJA RecName: Full=Flagellar P-ring protein 2; AltName: Full=Basal body
           P-ring protein 2; Flags: Precursor
 gi|27355152|dbj|BAC52136.1| flagellar P-ring protein precursor [Bradyrhizobium japonicum USDA
           110]
          Length = 376

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 185/374 (49%), Positives = 256/374 (68%), Gaps = 12/374 (3%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+  ++ +   SAQ   RIKD+  ++  R+NQ++GYGLV+GL GTGD+LR++PFTEQS+
Sbjct: 4   LLLALILVVSAASAQAAVRIKDIADIKGLRENQIVGYGLVIGLNGTGDTLRNAPFTEQSL 63

Query: 67  RSLLQNLGISTP-----------GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGD 115
           +S+L+N+GI+                L ++NVAAVMVTA+L P    G R+DV+++SLGD
Sbjct: 64  QSMLENMGINVRNETTSTTNPARPTTLRTRNVAAVMVTADLQPSIGAGERMDVTVSSLGD 123

Query: 116 ASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVE 175
           A+SL GG LVMTSL  ADG +YAVAQG+V V+G  V GQ+ +  +G  T G+I+NGA+VE
Sbjct: 124 ATSLLGGTLVMTSLRAADGAVYAVAQGAVTVAGYSVGGQAQNVSQGTPTAGRILNGALVE 183

Query: 176 RELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN 235
           RE+     +   L+L+L+NPDF TA RI D IN Y+  R+   IA   D RT+ +SKP +
Sbjct: 184 REVQGSLHEMEFLVLELKNPDFVTATRILDAINRYAGGRYRAQIAFERDYRTIVLSKPRH 243

Query: 236 IDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
           I   R ++E+  LTVE DTPARV+INERTGT+VIG +VRIS V V++GNLTV++TE   V
Sbjct: 244 IGPVRFLAEIGELTVEPDTPARVVINERTGTVVIGRDVRISTVAVTHGNLTVRVTEMPVV 303

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
            QP  F S G TV    T ++ ++     +++   DL  L+ G+N IGLK  GII+ILQ 
Sbjct: 304 SQPAPF-SRGQTVVVPQTVVEANEAGSQVAILSGVDLQRLVRGLNQIGLKPSGIIAILQA 362

Query: 356 IKAAGALQSEIIIQ 369
           IK AGALQ+++I+Q
Sbjct: 363 IKTAGALQADVIVQ 376


>gi|317406197|gb|EFV86446.1| flagellar P-ring protein [Achromobacter xylosoxidans C54]
          Length = 378

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 154/372 (41%), Positives = 223/372 (59%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++  +A +  +   L   SA    R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R +P
Sbjct: 10  LLSLLARVCVAAGLLAGASAAHAERLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTP 69

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+QS+ ++L  LGI+ P G  +  KNVAAVMVT  LP FA PG  +DV ++S+G+A SL
Sbjct: 70  FTQQSLTNMLSQLGITVPAGSNMQLKNVAAVMVTTTLPAFARPGQTLDVVVSSMGNAKSL 129

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L GAD  +YA+AQG+++V G       SS       GG+I  GAIVER +P
Sbjct: 130 RGGTLLMTPLKGADSQVYAIAQGNILVGGAGASAGGSSVQINQLNGGRISGGAIVERGVP 189

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDL 238
             F     + L++ N DF TA  + + +N     +F +  A A D R V+V  P      
Sbjct: 190 TTFARDGYIYLEMNNTDFGTAQNVVNALN----RKFGQGTATALDGRVVQVRTPMEQASQ 245

Query: 239 TRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +S+VE L V    T A+VIIN RTG++V+   V I +  V++GNL+V I    QV Q
Sbjct: 246 ARFLSQVEDLQVTRAPTVAKVIINARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVSQ 305

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P+   + G TV   NT ++V  + GS   +  + +L  ++ G+N++G     +++ILQ +
Sbjct: 306 PDTPFTEGQTVVVPNTQIEVRQDNGSLQRVTTSANLADVVKGLNALGATPQDLLAILQAM 365

Query: 357 KAAGALQSEIII 368
           K AGAL++E+ I
Sbjct: 366 KTAGALRAELEI 377


>gi|312884830|ref|ZP_07744522.1| flagellar basal body P-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367482|gb|EFP95042.1| flagellar basal body P-ring protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 396

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 144/367 (39%), Positives = 223/367 (60%), Gaps = 11/367 (2%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
            L+  L+     + +  + I D+V +Q  R+NQL+GYGLVVGL G GD      FT QS+
Sbjct: 35  LLLACLVSSSVFATKTTTPIMDLVDVQGVRENQLVGYGLVVGLDGQGDR-NQVKFTAQSI 93

Query: 67  RSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
            ++L+  G+          +NVA+V VTA++ P A PG +++V ++S+GDA SLRGG L+
Sbjct: 94  TNMLRQFGVQIDDSTNPKLRNVASVSVTASVDPMAGPGQKLNVVVSSIGDAKSLRGGTLL 153

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           +T L G DG +YAVAQG+VVV G+  +G+  S  +    T G+I  GA++ERE+   F D
Sbjct: 154 LTPLRGIDGEVYAVAQGNVVVGGISAEGKSGSKVVINTPTSGRIPGGAMLEREVVSDFAD 213

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMS 243
              +IL LR P F+TA  I  ++N+     F   +A A ++  + +  P +      +MS
Sbjct: 214 KEHIILNLRKPSFTTAKNIVREVNAV----FGPKVAVAKNNVRIDIQAPKDSQQRVVMMS 269

Query: 244 EVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            +E + V +   PAR++ N RTGT+VIG +V++S+  VS+GNLTV I E ++V QPNAF 
Sbjct: 270 MLEEIQVTQGRKPARIVFNSRTGTVVIGKSVQVSEAAVSHGNLTVTIAEAKKVSQPNAF- 328

Query: 303 SNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           SNG T T + + L VS+ +          +LN++++ +NS+G     ++SILQ +  AGA
Sbjct: 329 SNGQTQTTDQSKLDVSEERAQMVVWPAGTELNTIVNAVNSLGATPTDLMSILQALHEAGA 388

Query: 362 LQSEIII 368
           L +E+++
Sbjct: 389 LNAELVV 395


>gi|326319101|ref|YP_004236773.1| flagellar P-ring protein [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323375937|gb|ADX48206.1| flagellar P-ring protein [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 388

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 140/354 (39%), Positives = 201/354 (56%), Gaps = 8/354 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
                RIK+V ++Q  R NQL GYGLVVGL GTGD     P T Q++ + LQ +GIS P 
Sbjct: 37  PAHALRIKEVAAVQGVRSNQLTGYGLVVGLDGTGDQTTQMPITTQALTNYLQQMGISLPP 96

Query: 80  GR--LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
           G      KNVA V+VTA LP FA PG  IDV+++S+G+A SL+GG L+ T L GADG IY
Sbjct: 97  GTAAPQLKNVATVIVTAQLPAFAQPGQFIDVNVSSMGNAKSLKGGTLIATPLRGADGEIY 156

Query: 138 AVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           A+AQG++VV G       S       + G+I  GA VER +P    D   + L L   DF
Sbjct: 157 ALAQGNLVVGGAGAAAGGSKVQINHLSAGRIPEGAQVERSVPTPLNDGDTINLGLNASDF 216

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP- 255
            TA ++A  IN          IA A D RTV+V  P +       ++++E + +   TP 
Sbjct: 217 QTARKVARAINDKLGK--GASIATALDGRTVQVRAPQDPGGRVNFIADLEEIPLADATPA 274

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+V+IN RTG+IV+   V +    +++GNL++ I+    + QPN   S G TV    +D+
Sbjct: 275 AKVVINARTGSIVLNQAVTLGPCAIAHGNLSITISSTPVISQPNPL-SQGQTVVAQKSDI 333

Query: 316 KVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            +    G+   +  +P L  ++  +N++G     +++ILQ IKAAGAL +E+ +
Sbjct: 334 AIKQEPGNIIQMPPSPQLADVVRALNTLGATPQDLLAILQAIKAAGALNAELEV 387


>gi|238764396|ref|ZP_04625346.1| Flagellar P-ring protein [Yersinia kristensenii ATCC 33638]
 gi|238697422|gb|EEP90189.1| Flagellar P-ring protein [Yersinia kristensenii ATCC 33638]
          Length = 373

 Score =  366 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 147/371 (39%), Positives = 218/371 (58%), Gaps = 8/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +  +  +   ++           RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PF
Sbjct: 6   LITLFIMQLIVLFTLVSFPASAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPF 65

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+R
Sbjct: 66  TTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRTGQTIDVVVSSMGNAKSIR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L G D  +YA+AQG+V+V G       SS      TGG+I NGA +ERELP 
Sbjct: 126 GGTLLMTPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISNGATIERELPT 185

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLT 239
            F     + LQL   DF+TA +++D IN           A A D+RT++V  P  N    
Sbjct: 186 TFGTDGVINLQLNTEDFTTAQQVSDAINRQR----GFGSATAIDARTIQVLVPRGNSSQV 241

Query: 240 RLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           R +++++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V I +   V QP
Sbjct: 242 RFLADIQNIPVNIDAGDAKVIINSRTGSVVMNRNVMLDSCAVAQGNLSVVIDKQNTVSQP 301

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           +     G TV   NT + V    G+   +  +P+LN+++  +NS+G     ++SILQ ++
Sbjct: 302 DTPFGGGQTVVTPNTQISVQQQGGALQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQ 361

Query: 358 AAGALQSEIII 368
           +AG L++++ I
Sbjct: 362 SAGCLRAKLEI 372


>gi|254227987|ref|ZP_04921417.1| flagellar P-ring protein FlgI [Vibrio sp. Ex25]
 gi|262396031|ref|YP_003287884.1| flagellar P-ring protein FlgI [Vibrio sp. Ex25]
 gi|151939483|gb|EDN58311.1| flagellar P-ring protein FlgI [Vibrio sp. Ex25]
 gi|262339625|gb|ACY53419.1| flagellar P-ring protein FlgI [Vibrio sp. Ex25]
          Length = 370

 Score =  366 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 149/372 (40%), Positives = 223/372 (59%), Gaps = 11/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
                 L+ +L       A+V   I D+V ++  R+NQL+GYGLVVGL G GD      F
Sbjct: 4   FLTSFLLVLTLGLPTTSHAEVEIPIMDLVDVRGIRENQLVGYGLVVGLAGQGDR-NQVKF 62

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L+  G+          +NVA+V VTA + P A PG  +DV ++S+GDA SLR
Sbjct: 63  TSQSITNMLRQFGVQIDDSMNPKLRNVASVSVTATVDPMAGPGQTLDVVVSSIGDAKSLR 122

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DG +YA+AQG+VVV GL  +G+  S       T G++ NGA +ERE+ 
Sbjct: 123 GGTLLLTPLRGIDGEVYAIAQGNVVVGGLSAEGRSGSKVEVNTPTAGRVPNGATLEREIK 182

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F    ++ L LR P F+TA  IA +IN    N F   +A A +   + +  P +    
Sbjct: 183 TDFNQRDEVTLNLRKPSFTTAKNIAREIN----NTFGPNVAVAINKARIDMRAPKDTQQR 238

Query: 239 TRLMSEVEMLT-VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
             +MS +E ++ VE   PAR++ N RTGT+VIG +V++S+  VS+GNLTV+I+E++QV Q
Sbjct: 239 VVMMSMLEEMSVVEGRKPARIVFNSRTGTVVIGKSVKVSEAAVSHGNLTVRISESQQVSQ 298

Query: 298 PNAFSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF +NG T   N TDL V+++           +LN++++ +NS+G     ++SILQ +
Sbjct: 299 PNAF-ANGDTKVVNQTDLDVNEDLAQMVIWPPGTELNTIVTAVNSLGATPTDLMSILQAL 357

Query: 357 KAAGALQSEIII 368
             AGAL +E+++
Sbjct: 358 SEAGALNAELVV 369


>gi|221215575|ref|ZP_03588538.1| flagellar P-ring protein FlgI [Burkholderia multivorans CGD1]
 gi|221164563|gb|EED97046.1| flagellar P-ring protein FlgI [Burkholderia multivorans CGD1]
          Length = 394

 Score =  366 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 146/369 (39%), Positives = 210/369 (56%), Gaps = 19/369 (5%)

Query: 14  GLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNL 73
                 A    R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NL
Sbjct: 30  CALGAPAAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANL 89

Query: 74  GISTPG----------GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           GIS               +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SLRGG 
Sbjct: 90  GISINNGSANGGTSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSLRGGT 149

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L++T L GADG +YA+AQG++ V G       S         G+IV GAIVER +P    
Sbjct: 150 LLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERSVPNALA 209

Query: 184 DSA-DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRL 241
                L LQL + D+ TA RI   +NS     F   +A A D RT++++ P +       
Sbjct: 210 QMNGMLQLQLNDMDYGTAQRIVAAVNS----SFGPGVATALDGRTIQLAAPADPAQQVAF 265

Query: 242 MSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  
Sbjct: 266 MARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGP 325

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           F SNG TV    + +++  + G+  ++    +L  ++  +N++G     ++SILQ +KAA
Sbjct: 326 F-SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSILQAMKAA 384

Query: 360 GALQSEIII 368
           GAL++++ I
Sbjct: 385 GALRADLEI 393


>gi|145297458|ref|YP_001140299.1| flagellar basal body P-ring protein [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850230|gb|ABO88551.1| lateral flagellar P-ring protein, LfgI [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 368

 Score =  366 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 143/373 (38%), Positives = 210/373 (56%), Gaps = 11/373 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSR-IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           M      L+   +     +A    R + D+  +Q  R NQL+GYGLVVGL GTGD     
Sbjct: 1   MNKWFITLLCLSLPWWANAAPPAKRALLDIADVQGMRTNQLVGYGLVVGLSGTGDRS-QV 59

Query: 60  PFTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
            FT QSM ++L+  G+  P       KNVAAV V A LP  A  G  +DV++ S+GDA S
Sbjct: 60  KFTGQSMANMLKQFGVQLPDDLDPKLKNVAAVSVQATLPALAGKGQLVDVTVTSIGDAKS 119

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERE 177
           LRGG L++T L G DG++YAVAQG++VV+G+  +GQ  SS    + T G I NGAI+ERE
Sbjct: 120 LRGGSLLLTPLRGIDGDVYAVAQGNLVVAGVKAEGQSGSSVTINVPTAGIIPNGAIIERE 179

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-I 236
               F D  ++ L L  P+F TA  +  +IN         P+A A  +  ++V+ P +  
Sbjct: 180 AVSNFADKPEVTLNLHQPNFKTARNVEREINRQLG-----PVARAVSAGRIQVTAPKDES 234

Query: 237 DLTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                M+ ++ + V+      RV+ N RTGT+V+G  V++ K  VS+G+LTV I E++ V
Sbjct: 235 QRISFMALLQDIQVDMGKERPRVVFNSRTGTVVMGQGVKVHKAAVSHGSLTVTIGESQNV 294

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
            QPNAFS+  +T T N+      +    F   D   L  ++  +NS+G   D +++ILQ 
Sbjct: 295 SQPNAFSNGQTTTTPNSKVQVDRERNNMFVWPDGTSLEVIVKAVNSLGATPDDVMAILQA 354

Query: 356 IKAAGALQSEIII 368
           +  AGAL+ E+++
Sbjct: 355 LDEAGALEGELVV 367


>gi|260767927|ref|ZP_05876861.1| flagellar P-ring protein FlgI [Vibrio furnissii CIP 102972]
 gi|260615957|gb|EEX41142.1| flagellar P-ring protein FlgI [Vibrio furnissii CIP 102972]
          Length = 373

 Score =  366 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 146/353 (41%), Positives = 214/353 (60%), Gaps = 9/353 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      FT QS+ ++L+  G+    
Sbjct: 25  AEVEIPIMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKFTAQSITNMLRQFGVQIDE 83

Query: 80  G-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
                 +NVA+V VTA + P A PG  +++ ++S+GDA SLRGG L++T L G DG +YA
Sbjct: 84  STDPKLRNVASVSVTATVDPMAGPGQTLNIVVSSIGDAKSLRGGTLLLTPLRGIDGEVYA 143

Query: 139 VAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           VAQG+VVV G+  +G+  S       T G+I NGA +ERE+P  F D   + L LR P F
Sbjct: 144 VAQGNVVVGGVSAEGRSGSKIAVNTPTSGRIPNGATLEREIPTDFNDRDTVTLNLREPSF 203

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTV-ETDTP 255
           +TA  IA +IN      F   +A A +   V++  P +      +MS +E ++V E   P
Sbjct: 204 TTAKNIAREIND----TFGPQVAVAINKGRVEMRAPKDTQQRVTMMSMLEEMSVMEGRKP 259

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           AR++ N RTGT+VIG NV++ +  VS+GNLTV ITE++QV QPNAF+S  + V   +   
Sbjct: 260 ARIVFNSRTGTVVIGKNVKVGQAAVSHGNLTVSITESQQVSQPNAFASGDTQVVDQSQID 319

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              DN       +  +LN++++ +NS+G     ++SILQ +  AGAL +E+++
Sbjct: 320 INEDNAQMVIWPEGTELNTIVNAVNSLGATPTDLMSILQALHEAGALNAELVV 372


>gi|167585198|ref|ZP_02377586.1| flagellar basal body P-ring protein [Burkholderia ubonensis Bu]
          Length = 392

 Score =  366 bits (941), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 148/377 (39%), Positives = 211/377 (55%), Gaps = 19/377 (5%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
             L    +     +A    R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q+
Sbjct: 20  CALAACCVLALVPAAARAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQT 79

Query: 66  MRSLLQNLGISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGD 115
           + ++L NLGIS   G           +  KNVAAVMVTA LPPFA PG  +DV+++SLG+
Sbjct: 80  LANMLANLGISINNGSANGGGSSLSNMQLKNVAAVMVTATLPPFARPGEAVDVTVSSLGN 139

Query: 116 ASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVE 175
           A SLRGG L++T L GADG +YA+AQG++ V G       S         G+I  GAIVE
Sbjct: 140 AKSLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLASGRIAGGAIVE 199

Query: 176 RELPKKFKDSA-DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT 234
           R +P         L LQL + D+ TA RI   IN      F    A A D RT++++ P 
Sbjct: 200 RSVPNAVAQMNGMLQLQLNDMDYGTAQRIVSAIN----GSFGPNTATALDGRTIQLAAPA 255

Query: 235 N-IDLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
           +       M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +   
Sbjct: 256 DSAQQVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQ 315

Query: 293 EQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIIS 351
             V QP  F SNG TV    + +++  + G+  ++    +L  ++  +NS+G     ++S
Sbjct: 316 PVVSQPGPF-SNGQTVAAQQSQIQLKQDNGALKMVTAGANLADVVKALNSLGATPADLMS 374

Query: 352 ILQGIKAAGALQSEIII 368
           ILQ +KAAGAL++++ I
Sbjct: 375 ILQAMKAAGALRADLEI 391


>gi|326403260|ref|YP_004283341.1| flagellar P-ring protein [Acidiphilium multivorum AIU301]
 gi|325050121|dbj|BAJ80459.1| flagellar P-ring protein [Acidiphilium multivorum AIU301]
          Length = 384

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 165/372 (44%), Positives = 234/372 (62%), Gaps = 10/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +  IA+    ++      A    RIKD+  +Q  RDNQLIGYGLVVGL+GTGDSL +S F
Sbjct: 19  VLLIAWAAVCILVQCMRPAFSEVRIKDITDIQGIRDNQLIGYGLVVGLRGTGDSLNNSIF 78

Query: 62  TEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T QS+  +L+ LG++T      L +K++AAVMVTANLP FA  G  IDV+++++GDA+ L
Sbjct: 79  TRQSLIGMLERLGVNTQNQAQNLQTKDIAAVMVTANLPAFAHSGETIDVTVSAMGDATDL 138

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
            GG L++T LLGADG +YAVAQGS+V   +   G ++SF +G+ T G+I NGAIVER + 
Sbjct: 139 TGGTLLVTPLLGADGRVYAVAQGSLVTGAIQAAGANASFTQGVPTVGRITNGAIVERSVS 198

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT 239
            K        L+LRNPDF+TA+RI+  I+     R    IA   D RT+ +      ++ 
Sbjct: 199 FKLASEKTPKLELRNPDFTTAMRISRVIDE----RLGPGIATVDDPRTITLDL-KGRNVV 253

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             ++E+E L V+  TPA V+++E TGTIV+G NVRIS V +  GN+TV +     V QPN
Sbjct: 254 SDLAEIEDLRVQPSTPAVVVVDEATGTIVMGANVRISTVAIDEGNITVTVKNTPVVSQPN 313

Query: 300 AFSSNGSTVTQNNTDLKVSDNKG--SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
              + G+TV  + T + V  ++G     +     L  L+S +NS+G+    +ISILQ IK
Sbjct: 314 PL-AGGTTVATSQTSISVKKDRGKKMDIVHGNISLQQLVSSLNSLGVAPHDMISILQAIK 372

Query: 358 AAGALQSEIIIQ 369
           AAGALQ+ +++Q
Sbjct: 373 AAGALQARLVVQ 384


>gi|115353114|ref|YP_774953.1| flagellar basal body P-ring protein [Burkholderia ambifaria AMMD]
 gi|115283102|gb|ABI88619.1| flagellar P-ring protein [Burkholderia ambifaria AMMD]
          Length = 392

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 146/367 (39%), Positives = 209/367 (56%), Gaps = 19/367 (5%)

Query: 16  HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI 75
                    R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGI
Sbjct: 30  FGAPGAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGI 89

Query: 76  STPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           S   G           +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SLRGG L+
Sbjct: 90  SINNGSANGGPSSLSNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSLRGGTLL 149

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           +T L GADG +YA+AQG++ V G       S         G+IV GAIVER +P      
Sbjct: 150 LTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERAVPNAIAQM 209

Query: 186 AD-LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMS 243
              L LQL + D+ TA RI   +NS     F    A A D RT++++ P +       M+
Sbjct: 210 NGVLQLQLNDMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLAAPADSAQQVAFMA 265

Query: 244 EVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F 
Sbjct: 266 RLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPF- 324

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           SNG TV    + +++  + G+  ++    +L  ++  +NS+G     ++SILQ +KAAGA
Sbjct: 325 SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGA 384

Query: 362 LQSEIII 368
           L++++ +
Sbjct: 385 LRADLEV 391


>gi|148259772|ref|YP_001233899.1| flagellar basal body P-ring protein [Acidiphilium cryptum JF-5]
 gi|146401453|gb|ABQ29980.1| flagellar P-ring protein [Acidiphilium cryptum JF-5]
          Length = 384

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 164/372 (44%), Positives = 233/372 (62%), Gaps = 10/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +  I +    ++      A    RIKD+  +Q  RDNQLIGYGLVVGL+GTGDSL +S F
Sbjct: 19  VLLIVWAAVCILVQCMRPAFSEVRIKDITDIQGIRDNQLIGYGLVVGLRGTGDSLNNSIF 78

Query: 62  TEQSMRSLLQNLGISTPGG--RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           T QS+  +L+ LG++T      L +K++AAVMVTANLP FA  G  IDV+++++GDA+ L
Sbjct: 79  TRQSLIGMLERLGVNTQNQAQNLQTKDIAAVMVTANLPAFAHSGETIDVTVSAMGDATDL 138

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
            GG L++T LLGADG +YAVAQGS+V   +   G ++SF +G+ T G+I NGAIVER + 
Sbjct: 139 TGGTLLVTPLLGADGRVYAVAQGSLVTGAIQAAGANASFTQGVPTVGRITNGAIVERSVS 198

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT 239
            K        L+LRNPDF+TA+RI+  I+     R    IA   D RT+ +      ++ 
Sbjct: 199 FKLASEKTPKLELRNPDFTTAMRISRVIDE----RLGPGIATVDDPRTITLDL-KGRNVV 253

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             ++E+E L V+  TPA V+++E TGTIV+G NVRIS V +  GN+TV +     V QPN
Sbjct: 254 SDLAEIEDLRVQPSTPAVVVVDEATGTIVMGANVRISTVAIDEGNITVTVKNTPVVSQPN 313

Query: 300 AFSSNGSTVTQNNTDLKVSDNKG--SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
              + G+TV  + T + V  ++G     +     L  L+S +NS+G+    +ISILQ IK
Sbjct: 314 PL-AGGTTVATSQTSISVKKDRGKKMDIVHGNISLQQLVSSLNSLGVAPHDMISILQAIK 372

Query: 358 AAGALQSEIIIQ 369
           AAGALQ+ +++Q
Sbjct: 373 AAGALQARLVVQ 384


>gi|172061968|ref|YP_001809620.1| flagellar basal body P-ring protein [Burkholderia ambifaria MC40-6]
 gi|171994485|gb|ACB65404.1| flagellar P-ring protein [Burkholderia ambifaria MC40-6]
          Length = 394

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 145/367 (39%), Positives = 208/367 (56%), Gaps = 19/367 (5%)

Query: 16  HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI 75
                    R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGI
Sbjct: 32  FGAPGAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGI 91

Query: 76  STPG----------GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           S               +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SLRGG L+
Sbjct: 92  SINNGSANGGPSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSLRGGTLL 151

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           +T L GADG +YA+AQG++ V G       S         G+IV GAIVER +P      
Sbjct: 152 LTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERSVPNAIAQM 211

Query: 186 AD-LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMS 243
              L LQL + D+ TA RI   +NS     F    A A D RT++++ P +       M+
Sbjct: 212 NGVLQLQLNDMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLAAPADSAQQVAFMA 267

Query: 244 EVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F 
Sbjct: 268 RLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPF- 326

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           SNG TV    + +++  + G+  ++    +L  ++  +NS+G     ++SILQ +KAAGA
Sbjct: 327 SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGA 386

Query: 362 LQSEIII 368
           L++++ +
Sbjct: 387 LRADLEV 393


>gi|221199743|ref|ZP_03572786.1| flagellar P-ring protein FlgI [Burkholderia multivorans CGD2M]
 gi|221208652|ref|ZP_03581652.1| flagellar P-ring protein FlgI [Burkholderia multivorans CGD2]
 gi|221171463|gb|EEE03910.1| flagellar P-ring protein FlgI [Burkholderia multivorans CGD2]
 gi|221179982|gb|EEE12386.1| flagellar P-ring protein FlgI [Burkholderia multivorans CGD2M]
          Length = 394

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 149/375 (39%), Positives = 216/375 (57%), Gaps = 19/375 (5%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L+ ++ G     A    R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ 
Sbjct: 24  LLIAVAGALGAPAAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLA 83

Query: 68  SLLQNLGISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDAS 117
           ++L NLGIS   G           +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A 
Sbjct: 84  NMLANLGISINNGSANGGTSSLSNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAK 143

Query: 118 SLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERE 177
           SLRGG L++T L GADG +YA+AQG++ V G       S         G+IV GAIVER 
Sbjct: 144 SLRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERS 203

Query: 178 LPKKFKDSA-DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI 236
           +P         L LQL + D+ TA RI   +NS     F   +A A D RT++++ P + 
Sbjct: 204 VPNALAQMNGMLQLQLNDMDYGTAQRIVAAVNS----SFGPGVATALDGRTIQLAAPADP 259

Query: 237 -DLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQ 294
                 M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     
Sbjct: 260 AQQVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPV 319

Query: 295 VVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISIL 353
           V QP  F SNG TV    + +++  + G+  ++    +L  ++  +N++G     ++SIL
Sbjct: 320 VSQPGPF-SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSIL 378

Query: 354 QGIKAAGALQSEIII 368
           Q +KAAGAL++++ I
Sbjct: 379 QAMKAAGALRADLEI 393


>gi|293605007|ref|ZP_06687403.1| flagellar P-ring protein FlgI [Achromobacter piechaudii ATCC 43553]
 gi|292816612|gb|EFF75697.1| flagellar P-ring protein FlgI [Achromobacter piechaudii ATCC 43553]
          Length = 369

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 154/372 (41%), Positives = 220/372 (59%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+   A +   +       A    R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R +P
Sbjct: 1   MLSLFARVCVVVGLAAGAGAAHAERLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTP 60

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT+QS+ ++L  LGI+ P G  +  KNVAAVMVT  LP FA PG  +DV ++S+G+A SL
Sbjct: 61  FTQQSLTNMLSQLGITVPAGSNMQLKNVAAVMVTTTLPAFARPGQTLDVVVSSMGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L GAD  +YA+AQG+++V G       SS       GG+I  GAIVER +P
Sbjct: 121 RGGTLLMTPLKGADSQVYAIAQGNILVGGAGASAGGSSVQINQLNGGRISAGAIVERGVP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDL 238
             F     + ++L N DF TA  +A  +N     +F +  A A D R V+V  P      
Sbjct: 181 TTFSRDGYIHVELNNTDFGTAQNVAQALN----RKFGQGTATALDGRVVQVRTPMEQASQ 236

Query: 239 TRLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +S+VE L V    T A+VIIN RTG++V+   V I +  V++GNL+V I    QV Q
Sbjct: 237 ARFLSQVEDLQVARAPTVAKVIINARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P+   + G TV   NT ++V  + GS   +  + +L  ++ G+N++G     +++ILQ +
Sbjct: 297 PDTPFTEGQTVVVPNTQIEVRQDNGSLQRVSTSANLADVVKGLNALGATPQDLLAILQAM 356

Query: 357 KAAGALQSEIII 368
           K AGAL++E+ I
Sbjct: 357 KTAGALRAELEI 368


>gi|332161326|ref|YP_004297903.1| flagellar basal body P-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318605246|emb|CBY26744.1| flagellar P-ring protein FlgI [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665556|gb|ADZ42200.1| flagellar basal body P-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861551|emb|CBX71755.1| flagellar P-ring protein 2 [Yersinia enterocolitica W22703]
          Length = 373

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 147/371 (39%), Positives = 217/371 (58%), Gaps = 8/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +     +   ++     S     RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PF
Sbjct: 6   LITQFIMPLVVLFTLVSSPASAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPF 65

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+R
Sbjct: 66  TTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSIR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L G D  +YA+AQG+V+V G       SS      TGG+I NGA +ERELP 
Sbjct: 126 GGTLLMTPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISNGATIERELPT 185

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLT 239
            F     + LQL   DF+TA +++D IN           A A D+RT++V  P  N    
Sbjct: 186 TFGTDGVINLQLNTEDFTTAQQVSDAINRQR----GFGSASAIDARTIQVLVPRGNSSQV 241

Query: 240 RLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           R +++++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP
Sbjct: 242 RFLADIQNIPVNIDAGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVSQP 301

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           +     G TV   NT + V    G    +  +P+LN+++  +NS+G     ++SILQ ++
Sbjct: 302 DTPFGGGQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQ 361

Query: 358 AAGALQSEIII 368
           +AG L++++ I
Sbjct: 362 SAGCLRAKLEI 372


>gi|78067833|ref|YP_370602.1| flagellar basal body P-ring protein [Burkholderia sp. 383]
 gi|77968578|gb|ABB09958.1| Flagellar P-ring protein [Burkholderia sp. 383]
          Length = 392

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 146/374 (39%), Positives = 212/374 (56%), Gaps = 19/374 (5%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
             +L  +   +     R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ +
Sbjct: 23  FMALACVFGATPAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLAN 82

Query: 69  LLQNLGISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
           +L NLGIS   G           +  KNVAAVMVT  LPPFA PG  +DV+++SLG+A S
Sbjct: 83  MLANLGISINNGSANGGASQLSNMQLKNVAAVMVTGTLPPFARPGEALDVTVSSLGNAKS 142

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           LRGG L++T L GADG +YA+AQG++ V G       S         G+IV GAIVER +
Sbjct: 143 LRGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERGV 202

Query: 179 PKKFKDSAD-LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-I 236
           P         L LQL + D+ TA RI   +NS     F    A A D RT++++ P +  
Sbjct: 203 PNAIAQMNGVLQLQLNDMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLTAPADSA 258

Query: 237 DLTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V
Sbjct: 259 QQVAFMARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVV 318

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQ 354
            QP  F SNG TV    + +++  + G+  ++    +L  ++  +N++G     ++SILQ
Sbjct: 319 SQPGPF-SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSILQ 377

Query: 355 GIKAAGALQSEIII 368
            +KAAGAL++++ I
Sbjct: 378 AMKAAGALRADLEI 391


>gi|120613064|ref|YP_972742.1| flagellar basal body P-ring protein [Acidovorax citrulli AAC00-1]
 gi|120591528|gb|ABM34968.1| flagellar P-ring protein [Acidovorax citrulli AAC00-1]
          Length = 388

 Score =  365 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 142/352 (40%), Positives = 200/352 (56%), Gaps = 8/352 (2%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR 81
              RIK+V ++Q  R NQL GYGLVVGL GTGD     P T Q++ + LQ +GIS P G 
Sbjct: 39  HALRIKEVAAVQGVRSNQLTGYGLVVGLDGTGDQTTQMPITTQALTNYLQQMGISLPPGT 98

Query: 82  --LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
                KNVA V+VTA LP FA PG  IDVS++S+G+A SL+GG L+ T L GADG IYA+
Sbjct: 99  AAPQLKNVATVIVTAQLPAFAQPGQFIDVSVSSMGNAKSLKGGTLIATPLRGADGEIYAL 158

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQG++VV G       S       + G+I  GA VER +P    D   + L L   DF T
Sbjct: 159 AQGNLVVGGAGASAGGSKVQINHLSAGRIPEGAQVERAVPTPLNDGDTINLGLNASDFQT 218

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-AR 257
           A ++A  IN          IA A D RTV+V  P +       ++++E + +   TP A+
Sbjct: 219 ARKVARAINDKLGK--GASIATALDGRTVQVRAPQDPGGRVNFIADLEEIPLADATPAAK 276

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           V+IN RTG+IV    V +    +++GNL++ I+    + QPN   S G TV    +D+ V
Sbjct: 277 VVINARTGSIVFNQAVTLGPCAIAHGNLSITISSTPVISQPNPL-SQGQTVVAQKSDISV 335

Query: 318 SDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
               G+   +  +P L  ++  +N++G     +++ILQ IKAAGAL +E+ +
Sbjct: 336 KQEPGNIIQMPPSPQLADVVRALNTLGATPQDLLAILQAIKAAGALNAELEV 387


>gi|84502372|ref|ZP_01000508.1| flagellar P-ring protein FlgI [Oceanicola batsensis HTCC2597]
 gi|84389184|gb|EAQ01981.1| flagellar P-ring protein FlgI [Oceanicola batsensis HTCC2597]
          Length = 358

 Score =  365 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 163/361 (45%), Positives = 233/361 (64%), Gaps = 6/361 (1%)

Query: 10  FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSL 69
              +     +AQ   RIKD+ S +  R+NQL+GYGLVVGL GTGD+LR+SPFTE+S+  +
Sbjct: 1   MLAVAPAIDAAQADVRIKDIASFEGVRENQLVGYGLVVGLNGTGDTLRNSPFTEKSIEGM 60

Query: 70  LQNLGI-STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTS 128
           L+ LG+ +    ++ ++N AAVMVT+ LPPFA  GS IDV ++SLGDASSLRGG L++T 
Sbjct: 61  LERLGVGNLSDDQMRTQNTAAVMVTSMLPPFARRGSTIDVVVSSLGDASSLRGGTLIVTP 120

Query: 129 LLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADL 188
           L GADG +YAVAQG + V+G   +G ++S +EG+ T  +I NGA VE E+  +       
Sbjct: 121 LSGADGEVYAVAQGPIAVAGYAAQGANASIVEGVPTVARIENGATVENEIDFRLASLRSF 180

Query: 189 ILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEML 248
            + LR PD +TA R+AD+IN           A+  DS T++V      D   +M+ VE L
Sbjct: 181 RIALRTPDMTTAHRVADKINQ----SLGPGTAQVLDSTTIEVVGNDKGDTPEMMAAVENL 236

Query: 249 TVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTV 308
            V+ D+ A+V+I+ R+GTIVIG NVR+ KV VS G LTV I E+ +V QP   +  G+TV
Sbjct: 237 MVQPDSVAKVVIDARSGTIVIGANVRVDKVAVSQGGLTVVIREDIEVSQPEPITIGGTTV 296

Query: 309 TQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEII 367
               T+++V + +  F++++    L  L+ G+N+IG+     ISILQ IKAAGAL +++ 
Sbjct: 297 VVPQTEVEVQEAEAHFTILEGDVSLQRLVDGLNAIGVTASQTISILQAIKAAGALHADLE 356

Query: 368 I 368
           I
Sbjct: 357 I 357


>gi|224825168|ref|ZP_03698274.1| flagellar P-ring protein [Lutiella nitroferrum 2002]
 gi|224602839|gb|EEG09016.1| flagellar P-ring protein [Lutiella nitroferrum 2002]
          Length = 366

 Score =  365 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 151/370 (40%), Positives = 210/370 (56%), Gaps = 9/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +    +  +  L    A    R+KD+ S+   R NQLIGYGLVVGL G+GD   SSPFT
Sbjct: 1   MKRFLGMLLIGVLAMSPALATQRLKDIASIGGVRTNQLIGYGLVVGLDGSGDKATSSPFT 60

Query: 63  EQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QSM S+L  LG+  P G +L  KNVAAV VT  LPPFA  G  IDV+++S+GDA SLRG
Sbjct: 61  SQSMSSMLNQLGVQIPVGTKLDPKNVAAVTVTGTLPPFARQGQAIDVTVSSIGDAKSLRG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+M+ L GADG IYA+AQG+VVV G       SS      + G+I  GA VERE+P  
Sbjct: 121 GTLLMSPLKGADGQIYAMAQGNVVVGGAGASAAGSSAQVNHLSVGRIPAGATVEREVPTA 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTR 240
                 + L+L   DF+TA R+   IN          +A A D R V+V  P + +   +
Sbjct: 181 LGSGGVVQLELFESDFTTANRVVQAIN----RELGDGVARALDGRLVEVVAPQDANRRVQ 236

Query: 241 LMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +S +E + V   +    VI+N RTG++V+  +V I    V++GNL+V ++   QV QP 
Sbjct: 237 FLSRMENIAVTPAEASPLVILNARTGSVVMNQSVTIDPCAVAHGNLSVSVSNTPQVSQPA 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
              S G TV  N   + V    G    L    +L+ +++ +N++G     ++SILQ +KA
Sbjct: 297 PL-SGGQTVVTNQASVNVKSEGGKVIGLPRGANLSQVVNALNALGATPQDLLSILQAMKA 355

Query: 359 AGALQSEIII 368
           AGAL++E+ I
Sbjct: 356 AGALKAELQI 365


>gi|146305254|ref|YP_001185719.1| flagellar basal body P-ring protein [Pseudomonas mendocina ymp]
 gi|145573455|gb|ABP82987.1| flagellar P-ring protein [Pseudomonas mendocina ymp]
          Length = 364

 Score =  365 bits (937), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 154/372 (41%), Positives = 222/372 (59%), Gaps = 14/372 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F+ + +    + L    +     + D+V ++  R NQLIGYGLVVGL GTGD      F
Sbjct: 1   MFKRSLVF---LLLSWPLSTKAVPLMDLVDIEGIRGNQLIGYGLVVGLDGTGDK-NQVKF 56

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++++  GI+ P       KNVAAV VTA +PP  SPG  +DV+++SLGDA SLR
Sbjct: 57  TSQSVANMIKQFGINLPPNVDPKLKNVAAVTVTAEIPPSYSPGQTVDVTVSSLGDAKSLR 116

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DG IYA+AQG++VV GL   GQ  SS     +  G++ NGA VER +P
Sbjct: 117 GGQLLLTPLHGVDGEIYALAQGALVVGGLNASGQSGSSVAINSANSGRVPNGATVERMIP 176

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDL 238
             F + A+++L LR P F TA ++ + +N     RF    A A ++  + +  P T+   
Sbjct: 177 SDFSERAEVMLNLRQPSFQTAAKVVEAVN----GRFGSGTASALNATKIAIRAPITSTQR 232

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              M+ +E L VE      +V+ N RTGT+V+G  VR+    V++G LTV I+EN QV Q
Sbjct: 233 IGFMAMLEGLEVEEGRERPKVVFNSRTGTVVVGQGVRVKAAAVAHGTLTVTISENPQVSQ 292

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PNAF S G T     +D+ VS +K   F   D   L+S+IS +NS+G   D ++SILQ +
Sbjct: 293 PNAF-SGGQTAVVPRSDVAVSQDKNAMFKWPDGASLDSIISTVNSLGATPDDVMSILQAL 351

Query: 357 KAAGALQSEIII 368
           + AGAL +E+++
Sbjct: 352 EQAGALNAELVV 363


>gi|126730124|ref|ZP_01745936.1| flagellar P-ring protein precursor I [Sagittula stellata E-37]
 gi|126709504|gb|EBA08558.1| flagellar P-ring protein precursor I [Sagittula stellata E-37]
          Length = 368

 Score =  365 bits (937), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 157/372 (42%), Positives = 230/372 (61%), Gaps = 9/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+  +A L          +A    RIKD+V +   R N L+GYGLVVGL GTGD LR+SP
Sbjct: 1   MLRCLASLFLIAAATAFPAAAQSVRIKDLVEVDGVRSNDLVGYGLVVGLNGTGDGLRNSP 60

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FTE+ M ++L+ LG++  G +   +NVAAV+VT  LPPFA  G ++DV+++++GDA SL 
Sbjct: 61  FTEEIMTNILERLGVNVTGEQFRPRNVAAVLVTGRLPPFARTGGQVDVTVSAIGDAKSLL 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L  ADG IYAVAQG+V+  G   +G+++  ++G+ T G I +GA VERE+P 
Sbjct: 121 GGTLIMTPLNAADGQIYAVAQGTVIAGGAEAEGEAARVVQGVPTSGVIPSGARVEREVPF 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNIDL 238
            F + + L L LR PDF+TA RI D IN        R  A   D+ T++V+         
Sbjct: 181 DFANLSSLRLALREPDFTTAARIEDVIN----RSLGRRAAVMMDAGTIQVNLQNTGASSP 236

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
            R +  +E L VE    ARV++++R+GTIV+G +VRIS+V VS GNLT++I E    +QP
Sbjct: 237 ARAVVAIENLAVEPQRRARVVVDQRSGTIVMGADVRISRVAVSQGNLTLRIEEAPLAIQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNK--GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           N F ++G TV    T   + +    G   +     L+ +I+G+N++G+    +I IL+ I
Sbjct: 297 NPF-ADGETVVVPRTGAAIEEEPGIGLAEVPSGTSLSEVIAGLNALGVSPRDMIDILKSI 355

Query: 357 KAAGALQSEIII 368
           KAAGAL ++ ++
Sbjct: 356 KAAGALHADFVV 367


>gi|238785493|ref|ZP_04629476.1| Flagellar P-ring protein [Yersinia bercovieri ATCC 43970]
 gi|238713595|gb|EEQ05624.1| Flagellar P-ring protein [Yersinia bercovieri ATCC 43970]
          Length = 369

 Score =  365 bits (937), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 145/372 (38%), Positives = 215/372 (57%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M  +    +F  +           RI+D+V++Q  RDN LIGYGLVVGL G+GD    +P
Sbjct: 1   MRKQSLITLFITLLSLVWMPAQAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+
Sbjct: 61  FTTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSI 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS      TGG+I  GA +ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISGGATIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
             F     + LQL   DF+ A +++D IN           A A D+RT+++  P  N   
Sbjct: 181 TTFGSDGVINLQLNTEDFTMAQQVSDAINRQR----GFGSATAIDARTIQILVPRGNSSQ 236

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V Q
Sbjct: 237 VRFLADIQNIPVNVDAGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P+     G TV   NT + V    G    +  +P+LN+++  +NS+G     ++SILQ +
Sbjct: 297 PDTPFGGGQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 QSAGCLRAKLEI 368


>gi|304392504|ref|ZP_07374444.1| flagellar P-ring protein FlgI [Ahrensia sp. R2A130]
 gi|303295134|gb|EFL89494.1| flagellar P-ring protein FlgI [Ahrensia sp. R2A130]
          Length = 390

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 175/347 (50%), Positives = 248/347 (71%), Gaps = 1/347 (0%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
            SRIKD+  LQ  RDNQL+GYGLVVGLQGTGD LRS+PFT QS++++L  LGI++   R+
Sbjct: 45  ASRIKDIAKLQVTRDNQLVGYGLVVGLQGTGDGLRSAPFTRQSLQAMLTRLGIASGDDRV 104

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            +KNVAAV+VT NLP F   G+R+D +++S+GDA+SLRGG LVMT +   DG +YA AQG
Sbjct: 105 SAKNVAAVIVTTNLPAFVETGTRLDTTVSSIGDATSLRGGTLVMTMMQAGDGEVYAAAQG 164

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +V+VSG   +G +    +G+ T G++ NGAIVE+ LP  F +  + ILQLRNPDFSTA+ 
Sbjct: 165 NVIVSGFQAEGDAQKVTQGVPTTGRVPNGAIVEKALPASFSNETNYILQLRNPDFSTAVA 224

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           +AD IN+++ + +    A   D+RT+++S+P ++   R ++ +E L V   + ARV+++E
Sbjct: 225 MADTINAHTASLYGYKTARERDARTIQLSRPKSVSSARFIASIENLPVAAQSAARVVLDE 284

Query: 263 RTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKG 322
           RTGT+VIG  VRIS+V VS+G LTV+ITE   VVQP AF S+G T  +  TD++V+   G
Sbjct: 285 RTGTVVIGAEVRISRVAVSHGALTVRITERPVVVQPEAF-SDGVTAVEPATDIEVASRDG 343

Query: 323 SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           + S I+   L+ LI G+N +G+     I+I+Q IK AGALQ+E++IQ
Sbjct: 344 TLSKIEGTSLDVLIQGLNELGVDPQQTIAIIQAIKTAGALQAELVIQ 390


>gi|238755320|ref|ZP_04616663.1| Flagellar P-ring protein [Yersinia ruckeri ATCC 29473]
 gi|238706456|gb|EEP98830.1| Flagellar P-ring protein [Yersinia ruckeri ATCC 29473]
          Length = 369

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 149/372 (40%), Positives = 219/372 (58%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M  +    +F+ +           RI+D+V++Q  RDN LIGYGLVVGL G+GD    +P
Sbjct: 1   MRKQSLIPLFAALLSLVWLPASAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+
Sbjct: 61  FTTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRTGQTIDVVVSSMGNAKSI 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA +ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASSGGSSVTVNQLAGGRISNGATIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F +S  + LQL N DF+ A +I+D IN           A A D+RT++V  PT     
Sbjct: 181 TTFGNSGVINLQLNNEDFTLAQQISDAINRSR----GFGSATAIDARTIQVLVPTGGSSQ 236

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V Q
Sbjct: 237 VRFLADIQNIPVNVDPGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P+     G TV   NT + V    G+   +  +P+LN++I  +N++G     ++SILQ +
Sbjct: 297 PDTPFGGGQTVVTPNTQISVRQEGGALQKVNASPNLNNVIRALNTLGATPIDLMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L +++ I
Sbjct: 357 ESAGCLHAKLEI 368


>gi|187478189|ref|YP_786213.1| flagellar basal body P-ring protein [Bordetella avium 197N]
 gi|114151666|sp|Q2L1B1|FLGI_BORA1 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|115422775|emb|CAJ49303.1| flagellar P-ring protein [Bordetella avium 197N]
          Length = 376

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 146/349 (41%), Positives = 213/349 (61%), Gaps = 8/349 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRL 82
            R+KD+ + Q  R NQLIGYGLVVGL GTGD +R +PFT+QS+ ++L  LGI+ P G  +
Sbjct: 31  ERLKDLATFQGVRGNQLIGYGLVVGLDGTGDQVRQTPFTQQSLTNMLSQLGITVPAGSNM 90

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAVMVTA LP FA PG  +DV ++S+G+A SLRGG L+MT L GAD ++YA+AQG
Sbjct: 91  QLKNVAAVMVTATLPAFARPGQTVDVVVSSMGNAKSLRGGTLLMTPLKGADNSVYAIAQG 150

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +V+V G       SS       GG+I  GAIVER +P  F     + L++ N DF T   
Sbjct: 151 NVLVGGAGASAGGSSVQINTLNGGRISAGAIVERPVPTSFAQDGLVYLEMNNSDFGTTQN 210

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVE-TDTPARVII 260
            A+ IN     +F    A   D+R +++  P +   +   +S++E L V      A+VII
Sbjct: 211 AANAIN----RQFGAGTAMVMDARVLQLRGPLDPSQMPAFLSQIENLPVTLAPAVAKVII 266

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG++V+   V I +  V++GNL+V I    QV QP+   ++G TV   NT ++V   
Sbjct: 267 NARTGSVVMNRTVTIEEAAVAHGNLSVIINRQNQVFQPDTPFTDGQTVVAPNTQIEVRQE 326

Query: 321 KGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G+   +  + +L  ++  +N++G     +++ILQ +KAAGAL++E+ I
Sbjct: 327 GGALQRVRTSANLADVVKALNALGATPQDLLAILQAMKAAGALRAELEI 375


>gi|73539454|ref|YP_299821.1| flagellar basal body P-ring protein [Ralstonia eutropha JMP134]
 gi|72122791|gb|AAZ64977.1| Flagellar P-ring protein [Ralstonia eutropha JMP134]
          Length = 392

 Score =  364 bits (936), Expect = 8e-99,   Method: Composition-based stats.
 Identities = 140/368 (38%), Positives = 208/368 (56%), Gaps = 9/368 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +  L   +      +     R+K++ + Q  RDN L+GYGLVVGL  TGD    +PFT Q
Sbjct: 29  VTALAVVVAFGFAANFARAERLKNLATFQGVRDNPLVGYGLVVGLDNTGDQTMQTPFTTQ 88

Query: 65  SMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           S+ ++L  LGI+ P G  +  KNVAAVMVTA LP FA PGS++D+ ++S+G+A SLRGG 
Sbjct: 89  SLTNMLSQLGITLPAGKNMQLKNVAAVMVTATLPAFAQPGSQLDIVVSSMGNAKSLRGGT 148

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L+MT L GADG +YA+AQG+++V G       S         G+I NGAIVER +     
Sbjct: 149 LLMTPLKGADGQVYAIAQGNMLVGGAGASANGSKVQVNQLAVGRIANGAIVERAVAAFQP 208

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLM 242
           D   L L+L++ DF TA R+ + IN          +A A D R V+V  P +       +
Sbjct: 209 DGGVLNLELKDTDFGTAERVVEAIN----RSMGGGVAAALDGRVVQVRAPQSPSARVGFL 264

Query: 243 SEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           + +E L V      A+VI+N RTG+IV+   V +    V++GNL+V I     + QP  F
Sbjct: 265 ARIENLDVTPAKAAAKVILNARTGSIVMNQAVTVEDCAVAHGNLSVVINTQPVISQPAPF 324

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            S G TV    + + +    GS  ++     L +++ G+N++G     + +IL+ ++AAG
Sbjct: 325 -SGGQTVVAPVSQIDMKQQGGSLQIVKAGASLAAVVKGLNALGATPADLQTILEAMRAAG 383

Query: 361 ALQSEIII 368
           AL++E+ I
Sbjct: 384 ALRAELEI 391


>gi|325529018|gb|EGD06031.1| flagellar basal body P-ring protein [Burkholderia sp. TJI49]
          Length = 390

 Score =  364 bits (936), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 144/367 (39%), Positives = 208/367 (56%), Gaps = 19/367 (5%)

Query: 16  HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI 75
                    R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGI
Sbjct: 28  LGAGPARAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGI 87

Query: 76  STPG----------GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           S               +  KNVAAVM TA LPPFA PG  +DV+++SLG+A SLRGG L+
Sbjct: 88  SINNGSANGGASQLNNMQLKNVAAVMETATLPPFARPGEALDVTVSSLGNAKSLRGGTLL 147

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           +T L GADG +YA+AQG++ V G       S         G+IV GAIVER +P      
Sbjct: 148 LTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERSVPNALAQM 207

Query: 186 A-DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMS 243
              L LQL + D+ TA RI   +NS     F   +A A D RT++++ P +       M+
Sbjct: 208 NGMLQLQLNDMDYGTAQRIVSAVNS----NFGPGVATALDGRTIQLAAPADPAQQVAFMA 263

Query: 244 EVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F 
Sbjct: 264 RLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPF- 322

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           SNG TV    + +++  + G+  ++    +L  ++  +N++G     ++SILQ +KAAGA
Sbjct: 323 SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSILQAMKAAGA 382

Query: 362 LQSEIII 368
           L++++ I
Sbjct: 383 LRADLEI 389


>gi|170703100|ref|ZP_02893920.1| flagellar P-ring protein [Burkholderia ambifaria IOP40-10]
 gi|170131997|gb|EDT00505.1| flagellar P-ring protein [Burkholderia ambifaria IOP40-10]
          Length = 394

 Score =  364 bits (936), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 144/367 (39%), Positives = 208/367 (56%), Gaps = 19/367 (5%)

Query: 16  HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI 75
                    R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGI
Sbjct: 32  FGAPGAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGI 91

Query: 76  STPG----------GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           S               +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SLRGG L+
Sbjct: 92  SINNGSANGGPSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSLRGGTLL 151

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           +T L GADG +YA+AQG++ V G       S         G+IV GAIVER +P      
Sbjct: 152 LTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERSVPNAIAQM 211

Query: 186 AD-LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMS 243
              L LQL + D+ TA RI   +NS     F    A A D RT++++ P +       M+
Sbjct: 212 NGVLQLQLNDMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLAAPADSAQQVAFMA 267

Query: 244 EVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
            ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F 
Sbjct: 268 RLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPF- 326

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           SNG TV    + +++  + G+  ++    +L  ++  +N++G     ++SILQ +KAAGA
Sbjct: 327 SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSILQAMKAAGA 386

Query: 362 LQSEIII 368
           L++++ +
Sbjct: 387 LRADLEV 393


>gi|268589978|ref|ZP_06124199.1| flagellar P-ring protein FlgI [Providencia rettgeri DSM 1131]
 gi|291314695|gb|EFE55148.1| flagellar P-ring protein FlgI [Providencia rettgeri DSM 1131]
          Length = 367

 Score =  364 bits (936), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 151/370 (40%), Positives = 216/370 (58%), Gaps = 8/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            +   LI   +      +    RIKD+ ++Q  RDN LIGYGLVVGL GTGD    +PFT
Sbjct: 1   MKNKVLILLSLFFCFTYSAYSERIKDLTTVQGVRDNALIGYGLVVGLDGTGDQTMQTPFT 60

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+ ++L  +GI+ P G  +  KNVAAVMVTA LPPFA  G  +D+ ++S+G+A SLRG
Sbjct: 61  TQSLNNMLSQMGITVPPGTNMQLKNVAAVMVTAKLPPFARTGQSVDIVVSSMGNAKSLRG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L G DG IYA+AQG+++V G    G  SS       GG+I  GA +ERELP  
Sbjct: 121 GTLLMTPLKGVDGQIYAMAQGNILVGGAGASGGGSSIKVNQLNGGRITGGATIERELPSS 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTR 240
           F  +  + LQL    F+ A  IAD IN           A A DSRTV++  P  N D  R
Sbjct: 181 FGQNGAINLQLNEDSFTLAQDIADAINRMG----GMGTASALDSRTVQLLVPANNRDQVR 236

Query: 241 LMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            ++ V+ L V      A+VI+N RTG++VI  +V +    V++G+L V +    QV QP+
Sbjct: 237 FLARVQELNVRAPVAEAKVILNSRTGSVVINRSVTLDSCAVAHGSLAVTVERQTQVSQPD 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
              + G TV   NT++ V D  G+   +  +  LN +I  +N++G   + ++SILQ +++
Sbjct: 297 TPFAGGQTVVTRNTNVGVRDQGGALQKVNASVQLNQVIQALNTLGATPNDLMSILQAMES 356

Query: 359 AGALQSEIII 368
           AG L++++ I
Sbjct: 357 AGCLRAKLEI 366


>gi|270262397|ref|ZP_06190668.1| flagellar basal body P-ring protein [Serratia odorifera 4Rx13]
 gi|270043081|gb|EFA16174.1| flagellar basal body P-ring protein [Serratia odorifera 4Rx13]
          Length = 366

 Score =  364 bits (936), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 148/371 (39%), Positives = 215/371 (57%), Gaps = 10/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + +   +   +  L         RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PF
Sbjct: 1   MLKKFLMALVICALSL--PATAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPF 58

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF+  G  IDV ++S+G+A SLR
Sbjct: 59  TTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPPFSRTGQNIDVVVSSMGNAKSLR 118

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA +ERELP 
Sbjct: 119 GGTLLMTPLKGVDNQVYALAQGNVLVGGAGAASGGSSVQVNQLAGGRISNGATIERELPT 178

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLT 239
            F +   + LQL N DF+ A +I+D IN           A   D+RT++V  P  N    
Sbjct: 179 TFGNGGVINLQLNNEDFTLAQQISDAINRQR----GGGTASPLDARTIQVLVPQGNSSQV 234

Query: 240 RLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           R ++E++ + V      A+VIIN RTG++V+  +V +    V+ GNL+V +     V QP
Sbjct: 235 RFLAEIQNINVSVGAIDAKVIINSRTGSVVMNRDVILDSCAVAQGNLSVVVDRQNTVSQP 294

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N     G TV   NT + V    GS   +  + +LN++I  +N++G     ++SILQ ++
Sbjct: 295 NTPFGGGQTVVTPNTQISVQQQGGSLQKVNASANLNNVIRALNALGATPIDLMSILQAMQ 354

Query: 358 AAGALQSEIII 368
           +AG L++++ I
Sbjct: 355 SAGCLRAKLEI 365


>gi|163856439|ref|YP_001630737.1| flagellar basal body P-ring protein [Bordetella petrii DSM 12804]
 gi|163260167|emb|CAP42469.1| flagellar basal-body P-ring protein FlgI [Bordetella petrii]
          Length = 377

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 148/369 (40%), Positives = 216/369 (58%), Gaps = 8/369 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
           R+A  + +   L         RIKD+ S+Q  R N LIGYGLVVGL G+GD +R +PFT+
Sbjct: 12  RLAGCVLAAALLMLAGPAQAERIKDLASIQGVRGNPLIGYGLVVGLDGSGDQVRQTPFTQ 71

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP FA PG R+DV ++S+G+A SLRGG
Sbjct: 72  QSLTNMLSQLGITVPPGSNMQLKNVAAVMVTATLPAFARPGQRLDVVVSSMGNAKSLRGG 131

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L GAD  +YA+AQG+++V G       SS       GG+I +GAIVER +P  F
Sbjct: 132 TLLMTPLKGADSQVYAIAQGNILVGGAGASAGGSSVQINQLNGGRINDGAIVERGVPTSF 191

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRL 241
                + L++   DF T   +   +N     +F    AEA D R V+V  P +  +    
Sbjct: 192 SRDGLIYLEMDVTDFGTTQNVVAALN----RQFGAGTAEAVDGRVVQVRGPLDAAEQAAF 247

Query: 242 MSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           ++ VE L V      A+VIIN RTG++V+   V I +  V++GNL+V I    QV QP+ 
Sbjct: 248 LARVENLQVRRAPATAKVIINARTGSVVMNQTVMIDEAAVAHGNLSVIINRQTQVSQPDT 307

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
               G TV   NT ++V    G+   +  + +L  ++  +N++G     +++ILQ +K+A
Sbjct: 308 PFGGGQTVVVPNTQIEVRQEDGALHRVRTSANLADVVKALNALGATPQDLLAILQAMKSA 367

Query: 360 GALQSEIII 368
           GAL++++ I
Sbjct: 368 GALRADLEI 376


>gi|261344138|ref|ZP_05971782.1| flagellar P-ring protein FlgI [Providencia rustigianii DSM 4541]
 gi|282567730|gb|EFB73265.1| flagellar P-ring protein FlgI [Providencia rustigianii DSM 4541]
          Length = 371

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 148/369 (40%), Positives = 217/369 (58%), Gaps = 8/369 (2%)

Query: 4   RIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTE 63
            + F +  L+G   ++     R+KD+ ++Q  RDN LIGYGLVVGL GTGD    +PFT 
Sbjct: 6   FVLFSLCCLLGSLFVAPAYSERVKDLTTVQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTT 65

Query: 64  QSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           QS+ ++L  +GI+ P G  +  KNVAAVMVTA +PPF   G  +D+ ++S+G+A SLRGG
Sbjct: 66  QSLNNMLSQMGITVPPGTNMQLKNVAAVMVTAKMPPFGRSGQSVDIVVSSMGNAKSLRGG 125

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
            L+MT L G DG IYA+AQG+V+V G       SS       GG+I +GA +ERELP  F
Sbjct: 126 TLLMTPLKGVDGQIYAMAQGNVLVGGAGASAGGSSIKVNQLNGGRITDGATIERELPSSF 185

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRL 241
             S  + LQL    F+ A  I D IN           A A DSRTV++  P  N +  R 
Sbjct: 186 GQSGAINLQLNEDSFALAQDITDAINRMG----GMGTARALDSRTVQLLVPANNSEQVRF 241

Query: 242 MSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           +S V+ L V    T A+VI+N RTG++VI  +V +    V++G+L V +    QV QP+ 
Sbjct: 242 LSRVQELNVRTPMTEAKVILNSRTGSVVINRSVTLESCAVAHGSLAVTVERQTQVNQPDT 301

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
             + G TV   NT++ + +  G+   +  +  LN +I  +N++G     ++SILQ +++A
Sbjct: 302 PFAGGQTVVTRNTNVGMREQGGALQKVNASVQLNQVIQALNTLGATPTDLMSILQAMESA 361

Query: 360 GALQSEIII 368
           G L++++ I
Sbjct: 362 GCLRAKLEI 370


>gi|212709496|ref|ZP_03317624.1| hypothetical protein PROVALCAL_00538 [Providencia alcalifaciens DSM
           30120]
 gi|212687834|gb|EEB47362.1| hypothetical protein PROVALCAL_00538 [Providencia alcalifaciens DSM
           30120]
          Length = 371

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 150/371 (40%), Positives = 215/371 (57%), Gaps = 8/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
              +      L G   ++     RIKD+ ++Q  RDN LIGYGLVVGL GTGD    +PF
Sbjct: 4   KLFVLISFVCLFGSLFVAPAYSERIKDLTTVQGVRDNPLIGYGLVVGLDGTGDQTMQTPF 63

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L  +GI+ P G  +  KNVAAVMVTA +PPF   G  +DV ++S+G+A SLR
Sbjct: 64  TTQSLNNMLSQMGITVPAGTNMQLKNVAAVMVTAKMPPFGRSGQSVDVVVSSMGNAKSLR 123

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L G DG IYA+AQG+V+V G       SS       GG+I +GA++ERELP 
Sbjct: 124 GGTLLMTPLKGVDGQIYAMAQGNVLVGGAGASAGGSSVKVNQLNGGRITDGAMIERELPN 183

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLT 239
            F  S  + LQL    F+ A  I+D IN           A A DSRTV++  P  N D  
Sbjct: 184 SFGQSGAINLQLNEDSFALAQDISDAINRLG----GMGSARALDSRTVQLLVPANNTDQV 239

Query: 240 RLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           R +S V+ L V      A+VI+N RTG++VI  +V +    V++G+L V +    QV QP
Sbjct: 240 RFLSRVQELNVRTPMAEAKVILNSRTGSVVINRSVTLDSCAVAHGSLAVTVERQTQVNQP 299

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           +   + G TV   NT++ V +  G+   +  +  LN +I  +N++G     ++SILQ ++
Sbjct: 300 DTPFAGGQTVVTRNTNIGVKEQGGALQKVNASVQLNQVIQALNTLGATPTDLMSILQAME 359

Query: 358 AAGALQSEIII 368
           +AG L++++ I
Sbjct: 360 SAGCLRAKLEI 370


>gi|91224195|ref|ZP_01259458.1| flagellar P-ring protein precursor I [Vibrio alginolyticus 12G01]
 gi|91191106|gb|EAS77372.1| flagellar P-ring protein precursor I [Vibrio alginolyticus 12G01]
          Length = 373

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 147/357 (41%), Positives = 219/357 (61%), Gaps = 11/357 (3%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
              A+    I D+V ++  R+NQL+GYGLVVGL G GD      FT QS+ ++L+  G+ 
Sbjct: 22  TSRAEAEIPIMDLVDVRGIRENQLVGYGLVVGLAGQGDR-NQVKFTSQSITNMLRQFGVQ 80

Query: 77  TPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
                    +NVA+V VTA++ P A PG  +DV ++S+GDA SLRGG L++T L G DG 
Sbjct: 81  IDDSMNPKLRNVASVSVTASVDPMAGPGQTLDVVVSSIGDAKSLRGGTLLLTPLRGIDGE 140

Query: 136 IYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRN 194
           +YA+AQG+VVV GL  +G+  S       T G++ NGA +ERE+   F    ++ L LR 
Sbjct: 141 VYAIAQGNVVVGGLSAEGRSGSKVEVNTPTAGRVPNGATLEREIKTDFNQRDEITLNLRK 200

Query: 195 PDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLT-VET 252
           P F+TA  IA +IN    N F   +A A +   V +  P +      +MS +E ++ VE 
Sbjct: 201 PSFTTAKNIAREIN----NTFGPNVAVAINKARVDMRAPKDTQQRVVMMSMLEEMSVVEG 256

Query: 253 DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNN 312
             PAR++ N RTGT+VIG +V++S+  VS+GNLTV+I+E++QV QPNAF +NG T   N 
Sbjct: 257 RKPARIVFNSRTGTVVIGKSVKVSEAAVSHGNLTVRISESQQVSQPNAF-ANGDTKVVNQ 315

Query: 313 TDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           TDL V+++           +LN++++ +NS+G     ++SILQ +  AGAL +E+++
Sbjct: 316 TDLDVNEDLAQMVIWPPGTELNTIVNAVNSLGATPTDLMSILQALSEAGALNAELVV 372


>gi|226327740|ref|ZP_03803258.1| hypothetical protein PROPEN_01613 [Proteus penneri ATCC 35198]
 gi|225203444|gb|EEG85798.1| hypothetical protein PROPEN_01613 [Proteus penneri ATCC 35198]
          Length = 373

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 147/371 (39%), Positives = 219/371 (59%), Gaps = 8/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + +IA  +F ++      +    RI+D+ S++  R+N LIGYGLVVGL GTGD    +PF
Sbjct: 6   MKKIAMSLFFIVMTCVGFSAHAERIRDLTSVEGVRENALIGYGLVVGLDGTGDQTMQTPF 65

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  IDV ++SLG+A SLR
Sbjct: 66  TTQSLNNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPPFGRTGQSIDVVVSSLGNAKSLR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L G D  IYA+AQG++VV G       +S       GG+I +GAI+ERELP 
Sbjct: 126 GGTLLMTPLKGVDNQIYALAQGNIVVGGAGASAGGNSVKVNQLAGGRISSGAIIERELPS 185

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLT 239
           +F  +  L LQL   +F+ A  I+D +N           A   D+RTV++  P    +  
Sbjct: 186 QFGQTGLLNLQLNEENFTLAQHISDTVNKLR----GVGTAIPLDARTVQLRVPIGKSEQV 241

Query: 240 RLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           R ++EV+ L ++     A+VIIN RTG++V+  +V +    ++ GNL+V +     V QP
Sbjct: 242 RFLAEVQNLEIKRVVADAKVIINARTGSVVMNRDVTLGSCAIAQGNLSVTVNSQVNVSQP 301

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N   + GSTV   NT + +S+  GS   +  +  LN ++  +N++G     ++SILQ ++
Sbjct: 302 NTPFAGGSTVVTRNTSVNMSEQGGSLQQVNASASLNEVVRTLNALGATPTDLMSILQAME 361

Query: 358 AAGALQSEIII 368
           +AG L++ + I
Sbjct: 362 SAGCLRARLEI 372


>gi|262273524|ref|ZP_06051338.1| flagellar P-ring protein FlgI [Grimontia hollisae CIP 101886]
 gi|262222502|gb|EEY73813.1| flagellar P-ring protein FlgI [Grimontia hollisae CIP 101886]
          Length = 383

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 144/371 (38%), Positives = 213/371 (57%), Gaps = 14/371 (3%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
           A ++ +L  +   +  +   +  +  ++  R+NQL+GYGLVVGL GTGD    + FT+QS
Sbjct: 18  ALILLTLFSVLIPTQAMARPLLSIADVKGIRENQLVGYGLVVGLSGTGDK-NQTKFTQQS 76

Query: 66  MRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           ++++L   G+  P       KNVAAV V+A LP  A  G  +DV+++SLGDA SLRGG L
Sbjct: 77  VKNMLSQFGVQLPANADPKLKNVAAVAVSATLPAMAGKGQALDVTVSSLGDAKSLRGGTL 136

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           ++T L GADG IYA+AQG++VV G+  +G   S     I T G I NGAI+ERE+P  F 
Sbjct: 137 LLTPLKGADGQIYAMAQGNLVVGGIQAQGSSGSGVTVNIPTAGLIPNGAIIEREVPTSFT 196

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLM 242
              +++L L+ P+FSTA  +   IN      F   +A A     ++V  P +       +
Sbjct: 197 TEEEVVLNLKKPNFSTARNVEKAINKV----FGPDVAVAESHARIRVRAPMDTSQRVTFL 252

Query: 243 SEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           S +E L V ET    RV+ N RTGT+V+G +V I    VS+GNLTV + EN  V QPNAF
Sbjct: 253 SMLEELDVEETTRKDRVVFNARTGTVVVGQDVHIHTAAVSHGNLTVSVMENLNVSQPNAF 312

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSL----IDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
              G+T    ++ + V + KG   +     +   L +L+  +NS+G   + +++IL  + 
Sbjct: 313 -GQGNTAITPDSTVSVDEEKGKVFIWPESEEGTSLQTLVDAVNSLGASPNDLMAILIALD 371

Query: 358 AAGALQSEIII 368
            AGAL  E++I
Sbjct: 372 EAGALDGELVI 382


>gi|163744343|ref|ZP_02151703.1| flagellar P-ring protein precursor I [Oceanibulbus indolifex
           HEL-45]
 gi|161381161|gb|EDQ05570.1| flagellar P-ring protein precursor I [Oceanibulbus indolifex
           HEL-45]
          Length = 366

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 174/370 (47%), Positives = 236/370 (63%), Gaps = 7/370 (1%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M   +  L+  L       A    RIKD+V+++  R NQL+GYGLVVGL GTGDSLR++P
Sbjct: 1   MNAIVKLLLIGLTFALAAPAAAQVRIKDIVTVEGVRSNQLVGYGLVVGLNGTGDSLRNAP 60

Query: 61  FTEQSMRSLLQNLGI-STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FTE+++  +L+ LGI +    ++ + N AAVMVTA+LPPFA  GS IDV ++SLGDASSL
Sbjct: 61  FTERAIEGMLERLGIGNLTEDQMRTANTAAVMVTASLPPFARMGSTIDVVVSSLGDASSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L++T L  ADG IYAVAQG + V+G   +G ++S +EG+ TG +I NGAIVERE+ 
Sbjct: 121 RGGTLIVTPLTAADGEIYAVAQGPIAVAGFAAQGLNASIVEGVPTGARIDNGAIVEREVD 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT 239
             F +   + L LRN DF TA R+   IN         P+A A DSRT+ VS      L 
Sbjct: 181 FDFSEMTSIKLALRNADFVTAQRVEAAINQAMG-----PVATAIDSRTITVSAYGKGSLM 235

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             M+ +E L V+ D  A+V+I+ R+GTIVIG NVRI +V VS G LTV + ++  V QP 
Sbjct: 236 ETMALIEPLQVQPDQIAKVVIDARSGTIVIGANVRIDRVAVSQGGLTVTVRDDFNVSQPE 295

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKA 358
           + S  G+TV   N+ + V +    F++ID    L  L+ G+N+IG+     ISILQ IKA
Sbjct: 296 SLSIGGTTVVVPNSSVGVEEKDAKFAVIDGSVSLQRLVDGLNAIGVGATETISILQAIKA 355

Query: 359 AGALQSEIII 368
           AGAL +++ I
Sbjct: 356 AGALHADLEI 365


>gi|293395587|ref|ZP_06639870.1| flagellar P-ring protein FlgI [Serratia odorifera DSM 4582]
 gi|291421906|gb|EFE95152.1| flagellar P-ring protein FlgI [Serratia odorifera DSM 4582]
          Length = 366

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 150/365 (41%), Positives = 216/365 (59%), Gaps = 8/365 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L+ +L+           RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+ 
Sbjct: 5   LLMALLAATISLPVAAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSLS 64

Query: 68  SLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L  LGI+ P G  +  KNVAAVMVTA LPPFA  G  IDV ++S+G+A SLRGG L+M
Sbjct: 65  NMLSQLGITVPPGTNMQLKNVAAVMVTAKLPPFARSGQNIDVVVSSMGNAKSLRGGTLLM 124

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L GAD  +YA+AQG+V+V G       SS       GG+I NGA++ERELP  F    
Sbjct: 125 TPLKGADNQVYALAQGNVLVGGAGAAAGGSSVQVNQLNGGRISNGAVIERELPSTFGQGG 184

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEV 245
           ++ LQL + DF+ A +I+D IN           A   D+RTVKV  P  N    R ++++
Sbjct: 185 EINLQLNDEDFTLAQQISDAINRQR----GYGTATPLDARTVKVLVPQGNSSQVRFLADI 240

Query: 246 EMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           + + V      A+VIIN RTG++V+   V +    V+ GNL+V +     V QPN     
Sbjct: 241 QNINVNVSAMDAKVIINSRTGSVVMNREVILDSCAVAQGNLSVVVDRQNTVSQPNTPFGG 300

Query: 305 GSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G TV   NT + +    GS   +  + +LN++I  +N++G     ++SILQ +++AG L+
Sbjct: 301 GQTVVTPNTQISMQQQGGSLQKINASANLNNVIRALNALGATPIDLMSILQAMQSAGCLR 360

Query: 364 SEIII 368
           +++ I
Sbjct: 361 AKLDI 365


>gi|315179630|gb|ADT86544.1| flagellar P-ring protein precursor I [Vibrio furnissii NCTC 11218]
          Length = 373

 Score =  363 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 145/353 (41%), Positives = 213/353 (60%), Gaps = 9/353 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           A+V   I D+V +Q  R+NQL+GYGLVVGL G GD      FT QS+ ++L+  G+    
Sbjct: 25  AEVEIPIMDLVDVQGIRENQLVGYGLVVGLDGQGDR-NQVKFTAQSITNMLRQFGVQIDE 83

Query: 80  G-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
                 +NVA+V VTA + P A PG  +++ ++S+GDA SLRGG L++T L G DG +YA
Sbjct: 84  STDPKLRNVASVSVTATVDPMAGPGQTLNIVVSSIGDAKSLRGGTLLLTPLRGIDGEVYA 143

Query: 139 VAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           VAQG+VVV G+  +G+  S       T G+I NGA +ERE+P  F D   + L LR P F
Sbjct: 144 VAQGNVVVGGVSAEGRSGSKIAVNTPTSGRIPNGATLEREIPTDFNDRDTVTLNLREPSF 203

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTV-ETDTP 255
           +TA  IA +IN      F   +A A +   V++  P +      +MS +E ++V E   P
Sbjct: 204 TTAKNIAREIND----TFGPEVAIAINKGRVEMRAPKDTQQRVTMMSMLEEMSVMEGRKP 259

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           AR++ N RTGT+VIG NV++ +  VS+GNLTV ITE++Q  QPNAF+S  + V   +   
Sbjct: 260 ARIVFNSRTGTVVIGKNVKVGQAAVSHGNLTVSITESQQASQPNAFASGDTQVVDQSQID 319

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              DN       +  +LN++++ +NS+G     ++SILQ +  AGAL +E+++
Sbjct: 320 INEDNAQMVIWPEGTELNTIVNAVNSLGATPTDLMSILQALHEAGALNAELVV 372


>gi|108812479|ref|YP_648246.1| flagellar basal body P-ring protein [Yersinia pestis Nepal516]
 gi|229902861|ref|ZP_04517978.1| flagellar P-ring protein precursor [Yersinia pestis Nepal516]
 gi|108776127|gb|ABG18646.1| flagellar P-ring protein precursor [Yersinia pestis Nepal516]
 gi|229680308|gb|EEO76407.1| flagellar P-ring protein precursor [Yersinia pestis Nepal516]
 gi|320015463|gb|ADV99034.1| flagellar P-ring protein precursor [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 369

 Score =  363 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 143/372 (38%), Positives = 215/372 (57%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M  +    +  ++           RI+D+V++Q  RDN LIGYGLVVGL G+GD    +P
Sbjct: 1   MRKQSLVTLLMVLLSLVWLPASAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+
Sbjct: 61  FTTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSI 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA +ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGAAAGGSSVQVNQLAGGRISNGATIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     + LQL + DF+ A +++D IN           A A D+RT++V  P      
Sbjct: 181 TTFGTDGIINLQLNSEDFTLAQQVSDAINRQR----GFGSATALDARTIQVLVPRGGSSQ 236

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++++ + +  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V Q
Sbjct: 237 VRFLADIQNIPINVDPGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNIVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P+     G TV   NT + V    G    +  +P+LN+++  +NS+G     ++SILQ +
Sbjct: 297 PDTPFGGGQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 ESAGCLRAKLEI 368


>gi|319790431|ref|YP_004152064.1| flagellar P-ring protein [Thermovibrio ammonificans HB-1]
 gi|317114933|gb|ADU97423.1| flagellar P-ring protein [Thermovibrio ammonificans HB-1]
          Length = 363

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 137/355 (38%), Positives = 198/355 (55%), Gaps = 8/355 (2%)

Query: 16  HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI 75
              +   + +I  +V+++  R N L GYG+VVGL G+GD   S  FT QS+ ++L+ +GI
Sbjct: 14  SAGAQGALVKISTLVNVEGVRPNYLTGYGIVVGLNGSGDGTTSV-FTLQSIANMLRKMGI 72

Query: 76  STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
                 + +KN AAV+VTA LPPFA PG   DV + SLGDA S+  G+L+ T LLG DG 
Sbjct: 73  YVDPKAVKTKNAAAVIVTAKLPPFAKPGMTFDVEVASLGDAKSIANGVLIRTPLLGPDGK 132

Query: 136 IYAVAQGSVVV-SGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRN 194
           +YA AQG V    G     +     +   T G I NG IVER LP +      L+L L  
Sbjct: 133 VYAFAQGPVSTGGGFSESNKGGKVQKNFPTAGIIPNGGIVERPLPFELSQMKQLVLTLNQ 192

Query: 195 PDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDT 254
           P+F+ A  IA  IN      F +P+A A DS TVKV  P  ++  + +SEV  L V T  
Sbjct: 193 PNFTLASEIAQVINE----HFGKPLARAVDSATVKVDYPAGVNKVKFISEVLNLEVNTVP 248

Query: 255 PARVIINERTGTIVIGDNVRIS-KVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
              ++I E+TGT+++  +++I   V VS+GN+ V +T+   + QP    S G TV     
Sbjct: 249 EPTIVIYEKTGTVIMSGDIKIDPPVYVSHGNIYVSVTKTPVISQPPPL-SGGKTVVTQQV 307

Query: 314 DLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              V +  G    I++P L  L+  +N +G+    +I+ILQ +KAAG L ++I+I
Sbjct: 308 KTTVKEENGRIFGINSPSLRDLVKALNQLGVSPRDLIAILQAMKAAGKLHAKIVI 362


>gi|22126386|ref|NP_669809.1| flagellar basal body P-ring protein [Yersinia pestis KIM 10]
 gi|45441405|ref|NP_992944.1| flagellar basal body P-ring protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51596015|ref|YP_070206.1| flagellar basal body P-ring protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108807177|ref|YP_651093.1| flagellar basal body P-ring protein [Yersinia pestis Antiqua]
 gi|145598606|ref|YP_001162682.1| flagellar basal body P-ring protein [Yersinia pestis Pestoides F]
 gi|149366247|ref|ZP_01888282.1| flagellar P-ring protein precursor [Yersinia pestis CA88-4125]
 gi|153950706|ref|YP_001401286.1| flagellar basal body P-ring protein [Yersinia pseudotuberculosis IP
           31758]
 gi|162418995|ref|YP_001606476.1| flagellar basal body P-ring protein [Yersinia pestis Angola]
 gi|165925988|ref|ZP_02221820.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165938777|ref|ZP_02227332.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166010921|ref|ZP_02231819.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166210464|ref|ZP_02236499.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401182|ref|ZP_02306685.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420059|ref|ZP_02311812.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425890|ref|ZP_02317643.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167467494|ref|ZP_02332198.1| flagellar P-ring protein FlgI [Yersinia pestis FV-1]
 gi|170024643|ref|YP_001721148.1| flagellar basal body P-ring protein [Yersinia pseudotuberculosis
           YPIII]
 gi|186895118|ref|YP_001872230.1| flagellar basal body P-ring protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218928926|ref|YP_002346801.1| flagellar basal body P-ring protein [Yersinia pestis CO92]
 gi|229896246|ref|ZP_04511416.1| flagellar P-ring protein precursor [Yersinia pestis Pestoides A]
 gi|229897181|ref|ZP_04512337.1| flagellar P-ring protein precursor [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229897908|ref|ZP_04513059.1| flagellar P-ring protein precursor [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|294504026|ref|YP_003568088.1| flagellar P-ring protein precursor [Yersinia pestis Z176003]
 gi|22095706|sp|Q8ZFB1|FLGI2_YERPE RecName: Full=Flagellar P-ring protein 2; AltName: Full=Basal body
           P-ring protein 2; Flags: Precursor
 gi|81639722|sp|Q66BT8|FLGI1_YERPS RecName: Full=Flagellar P-ring protein 1; AltName: Full=Basal body
           P-ring protein 1; Flags: Precursor
 gi|226701966|sp|B1JP09|FLGI_YERPY RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|21959372|gb|AAM86060.1|AE013853_8 homolog of Salmonella P-ring of flagella basal body [Yersinia
           pestis KIM 10]
 gi|45436265|gb|AAS61821.1| flagellar P-ring protein precursor [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51589297|emb|CAH20918.1| flagellar P-ring protein precursor [Yersinia pseudotuberculosis IP
           32953]
 gi|108779090|gb|ABG13148.1| flagellar P-ring protein precursor [Yersinia pestis Antiqua]
 gi|115347537|emb|CAL20446.1| flagellar P-ring protein precursor [Yersinia pestis CO92]
 gi|145210302|gb|ABP39709.1| flagellar P-ring protein precursor [Yersinia pestis Pestoides F]
 gi|149292660|gb|EDM42734.1| flagellar P-ring protein precursor [Yersinia pestis CA88-4125]
 gi|152962201|gb|ABS49662.1| flagellar P-ring protein FlgI [Yersinia pseudotuberculosis IP
           31758]
 gi|162351810|gb|ABX85758.1| flagellar P-ring protein FlgI [Yersinia pestis Angola]
 gi|165913391|gb|EDR32013.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165922192|gb|EDR39369.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165990265|gb|EDR42566.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207644|gb|EDR52124.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961754|gb|EDR57775.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167049571|gb|EDR60979.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055289|gb|EDR65086.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|169751177|gb|ACA68695.1| flagellar P-ring protein [Yersinia pseudotuberculosis YPIII]
 gi|186698144|gb|ACC88773.1| flagellar P-ring protein [Yersinia pseudotuberculosis PB1/+]
 gi|229688949|gb|EEO81014.1| flagellar P-ring protein precursor [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229693518|gb|EEO83567.1| flagellar P-ring protein precursor [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701169|gb|EEO89198.1| flagellar P-ring protein precursor [Yersinia pestis Pestoides A]
 gi|262361788|gb|ACY58509.1| flagellar P-ring protein precursor [Yersinia pestis D106004]
 gi|262366076|gb|ACY62633.1| flagellar P-ring protein precursor [Yersinia pestis D182038]
 gi|294354485|gb|ADE64826.1| flagellar P-ring protein precursor [Yersinia pestis Z176003]
          Length = 369

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 143/372 (38%), Positives = 215/372 (57%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M  +    +  ++           RI+D+V++Q  RDN LIGYGLVVGL G+GD    +P
Sbjct: 1   MRKQSLVTLLMVLLSLVWLPASAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+
Sbjct: 61  FTTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSI 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA +ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGAAAGGSSVQVNQLAGGRISNGATIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F     + LQL + DF+ A +++D IN           A A D+RT++V  P      
Sbjct: 181 TTFGTDGIINLQLNSEDFTLAQQVSDAINRQR----GFGSATAIDARTIQVLVPRGGSSQ 236

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++++ + +  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V Q
Sbjct: 237 VRFLADIQNIPINVDPGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNIVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P+     G TV   NT + V    G    +  +P+LN+++  +NS+G     ++SILQ +
Sbjct: 297 PDTPFGGGQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 ESAGCLRAKLEI 368


>gi|325982367|ref|YP_004294769.1| flagellar P-ring protein [Nitrosomonas sp. AL212]
 gi|325531886|gb|ADZ26607.1| flagellar P-ring protein [Nitrosomonas sp. AL212]
          Length = 369

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 147/371 (39%), Positives = 214/371 (57%), Gaps = 9/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           I  +      +I L      +  RIKD+ S+Q  R+NQLIGYGLVVGL G+GD    +PF
Sbjct: 3   ILHMITQSLLMICLFLPGISLADRIKDLASIQGVRNNQLIGYGLVVGLDGSGDMTTQTPF 62

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ S+L  LG++ P G  L  +NVAAVMVTA LP F   G  IDV+++S+G+A SLR
Sbjct: 63  TVQSIISMLGQLGVNLPPGTNLQLRNVAAVMVTATLPAFTKTGQHIDVTVSSMGNAKSLR 122

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L GAD  +YA+AQGSV+V G+      SS      + G+I  G IVERE+P 
Sbjct: 123 GGTLLMTPLKGADNQVYAMAQGSVLVGGIGAAAGGSSVQVNHLSVGRITGGGIVEREIPT 182

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLT 239
                  + L+L + DF+T  RI D INS     F    A A D R V+V  P +     
Sbjct: 183 VVGQGDYINLELNSTDFTTVNRIVDAINS-----FYPASAVAVDGRVVQVKAPADTSQRI 237

Query: 240 RLMSEVEMLT-VETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             +S++E +  V     A+VI+N RTG+IV+  +V +    +++GNL++ I     + QP
Sbjct: 238 MFISQIESMDVVPAKATAKVIVNSRTGSIVMNQSVTLETSAIAHGNLSIIINTEPVISQP 297

Query: 299 NAFSSNGSTVTQNNTDLKV-SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
             F+  G TV    + +++ +D      L +  DL  ++  + +IG  T  ++SILQ +K
Sbjct: 298 GPFAQRGETVVTQRSQVEIRTDEGNLMLLPNGADLGEVVKALTAIGATTQDLLSILQALK 357

Query: 358 AAGALQSEIII 368
           AAG+L++++ I
Sbjct: 358 AAGSLRADLEI 368


>gi|32490794|ref|NP_871048.1| flagellar basal body P-ring protein [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|31340089|sp|Q8D3F6|FLGI_WIGBR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|25166000|dbj|BAC24191.1| flgI [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 370

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 145/373 (38%), Positives = 220/373 (58%), Gaps = 10/373 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +  I   +  ++     SA    RI+D+ ++   RDN LIGYGLVVGL GTGD    +PF
Sbjct: 1   MKYILIKLSIVMIFIINSASKAERIRDLTTIVGVRDNVLIGYGLVVGLDGTGDQTTQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+R++L  LG+S P G  +  KN+AAVMVTA LPPF   G +IDV ++SLG A SLR
Sbjct: 61  TIQSLRNMLSQLGVSIPSGINMQLKNIAAVMVTAKLPPFVKIGQKIDVMVSSLGSAKSLR 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L++T L G D  IYA+AQG+++VSG   +   ++       GG+I  GAI+E+ +  
Sbjct: 121 GGTLLITPLKGVDNQIYALAQGNILVSGFGAQSGGNTSQVNQLNGGRISEGAIIEKSIKT 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--- 237
            F     + LQL N DFS A +I+D IN+Y    F +  A   DSRT+ V    + D   
Sbjct: 181 DFDKREIITLQLNNNDFSLAQQISDAINTY----FGKKSAYPTDSRTINVILSASYDKSE 236

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
             + ++ ++ + +      A ++IN RTG++VI   V ++   V++G LTV+I +  +V 
Sbjct: 237 KVKFIARLQNIPIIIGPSDAIIVINSRTGSVVINKEVMLNSCAVAHGELTVEIKKRTKVN 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPN     GSTV    T++ + +   S   +  + +LN +IS +NSIG K + +++IL+ 
Sbjct: 297 QPNTILGGGSTVVTPETEILIKNQGDSLQEISSSTNLNEVISSLNSIGAKPNDLMAILES 356

Query: 356 IKAAGALQSEIII 368
           +K+AG L +++ I
Sbjct: 357 MKSAGCLNAKLEI 369


>gi|238799111|ref|ZP_04642567.1| Flagellar P-ring protein [Yersinia mollaretii ATCC 43969]
 gi|238717058|gb|EEQ08918.1| Flagellar P-ring protein [Yersinia mollaretii ATCC 43969]
          Length = 369

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 145/372 (38%), Positives = 213/372 (57%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M       +   +           RI+D+V++Q  RDN LIGYGLVVGL G+GD    +P
Sbjct: 1   MRKPSLVTLIITLFSLVWMPAQAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+
Sbjct: 61  FTTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSI 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS      TGG+I  GA +ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISGGATIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
             F     + LQL   DF+ A +++D IN           A A D+RT++V  P  N   
Sbjct: 181 TTFGSDGVINLQLNTEDFTMAQQVSDAINRQR----GFGSATAIDARTIQVLVPRGNSSQ 236

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V Q
Sbjct: 237 VRFLADIQNIPVNVDAGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P+     G TV   NT + V    G    +  +P+LN+++  +NS+G     ++SILQ +
Sbjct: 297 PDTPFGGGQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 QSAGCLRAKLEI 368


>gi|329850451|ref|ZP_08265296.1| flagellar P-ring protein [Asticcacaulis biprosthecum C19]
 gi|328840766|gb|EGF90337.1| flagellar P-ring protein [Asticcacaulis biprosthecum C19]
          Length = 368

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 156/347 (44%), Positives = 225/347 (64%), Gaps = 9/347 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGS 84
           RIKDVV ++  R NQL+GYG+VVGL GTGD++R+SP  +QSM ++++ LGI+     L +
Sbjct: 27  RIKDVVEVEGVRGNQLVGYGIVVGLNGTGDTVRNSPMLKQSMEAMMERLGINVRDANLNT 86

Query: 85  KNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSV 144
           KN AAVMVTA LPPFA+PGSR+D+++++ GDA SL GG L++T L+GADG +YAVAQG+V
Sbjct: 87  KNAAAVMVTAELPPFAAPGSRLDITVSAAGDAKSLLGGTLLVTPLIGADGEVYAVAQGTV 146

Query: 145 VVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
               +   G   SS  +G+ T G+I +G I+ER+    F     + L LRNPDF+TA RI
Sbjct: 147 QTGSVSAGGASGSSVTKGVPTAGRISSGGIIERQTAFDFNSQPVVRLTLRNPDFTTAQRI 206

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINER 263
           A  I +          A A +   V +  P    +   ++ +E L+V+ D PARV+I+E 
Sbjct: 207 AAAITAQY-----PGTAVAENPSVVAIRAPAGQTMMSFVTLIEPLSVDIDVPARVVIDEV 261

Query: 264 TGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGS 323
            G IV+G+NVRIS+V ++ GNLT+++ E   V QP  F S G T T   TD+ + + KG 
Sbjct: 262 NGVIVMGENVRISRVAIAQGNLTIRVDERPDVSQPAPF-SQGQTATIPATDISIEEEKGK 320

Query: 324 --FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
               L     L+ L++G+N++G+    +ISILQ IKA+GALQ++I +
Sbjct: 321 QLLQLGGGSTLSDLVAGLNALGVSPRDMISILQAIKASGALQADIQV 367


>gi|123442780|ref|YP_001006757.1| flagellar basal body P-ring protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089741|emb|CAL12594.1| flagellar P-ring protein precursor [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 358

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 147/361 (40%), Positives = 215/361 (59%), Gaps = 8/361 (2%)

Query: 12  LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQ 71
           ++     S     RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+ ++L 
Sbjct: 1   MLFTLVSSPASAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSLSNMLS 60

Query: 72  NLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLL 130
            LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+RGG L+MT L 
Sbjct: 61  QLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSIRGGTLLMTPLK 120

Query: 131 GADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLIL 190
           G D  +YA+AQG+V+V G       SS      TGG+I NGA +ERELP  F     + L
Sbjct: 121 GVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISNGATIERELPTTFGSDGVINL 180

Query: 191 QLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVEMLT 249
           QL   DF+TA +++D IN           A A D+RT++V  P  N    R +++++ + 
Sbjct: 181 QLNTEDFTTAQQVSDAINRQR----GFGSASAIDARTIQVLVPRGNSSQVRFLADIQNIP 236

Query: 250 VETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTV 308
           V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP+     G TV
Sbjct: 237 VNIDAGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVSQPDTPFGGGQTV 296

Query: 309 TQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEII 367
              NT + V    G    +  +P+LN+++  +NS+G     ++SILQ +++AG L++++ 
Sbjct: 297 VTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQSAGCLRAKLE 356

Query: 368 I 368
           I
Sbjct: 357 I 357


>gi|227355997|ref|ZP_03840389.1| flagellar P-ring protein precursor [Proteus mirabilis ATCC 29906]
 gi|227163985|gb|EEI48887.1| flagellar P-ring protein precursor [Proteus mirabilis ATCC 29906]
          Length = 368

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 150/371 (40%), Positives = 219/371 (59%), Gaps = 8/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++A  +F ++      +    RI+D+ S++  R+N LIGYGLVVGL GTGD    +PF
Sbjct: 1   MKKLAISLFFIVMTCVGFSAHAERIRDLTSVEGVRENALIGYGLVVGLDGTGDQTMQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  IDV ++SLG+A SLR
Sbjct: 61  TTQSLNNMLSQLGITVPAGTNMQLKNVAAVMVTAKLPPFGRTGQSIDVVVSSLGNAKSLR 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L G D  +YAVAQG+++V G       SS       GG+I NGAI+ERELP 
Sbjct: 121 GGTLLMTPLKGVDSQVYAVAQGNIIVGGSGASAGGSSVKVNQLAGGRISNGAIIERELPS 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLT 239
           +F  +  L LQL   +F+ A  IAD IN           A   D+RTV++  P    +  
Sbjct: 181 QFGQTGLLNLQLNEENFTLAQSIADAINKLR----GVGTALPLDARTVQLRVPLGKSEQV 236

Query: 240 RLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           R +++V+ L V+     A+VIIN RTG++V+  +V +    ++ GNL+V +     V QP
Sbjct: 237 RFLADVQNLEVKRVIADAKVIINARTGSVVMNRDVVLGSCAIAQGNLSVTVDSQVNVSQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N   + GSTV   NT + V++  GS   +  +  LN +I  +N++G     ++SILQ ++
Sbjct: 297 NTPFAGGSTVVSRNTSVNVNEKGGSLQKVNASASLNEVIRSLNALGATPTDLMSILQAME 356

Query: 358 AAGALQSEIII 368
           +AG L++ + I
Sbjct: 357 SAGCLRARLEI 367


>gi|121997315|ref|YP_001002102.1| flagellar basal body P-ring protein [Halorhodospira halophila SL1]
 gi|121588720|gb|ABM61300.1| flagellar P-ring protein [Halorhodospira halophila SL1]
          Length = 371

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 144/365 (39%), Positives = 207/365 (56%), Gaps = 14/365 (3%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           +  ++ L   S     RIKD+ S+   R NQL+GYGLVVGL GTGD    +PFTEQS+RS
Sbjct: 15  VGVVLVLLAASVSAAERIKDIASVGGVRSNQLVGYGLVVGLDGTGD---DTPFTEQSVRS 71

Query: 69  LLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +L + G++ P      + N AAVM+TA LP F  PG +IDVS++SLGDA SL+GG L+MT
Sbjct: 72  MLASQGVNIPHDVDPDADNTAAVMITAELPAFTRPGQQIDVSVSSLGDADSLQGGELLMT 131

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD 187
            L  ADG +YAVAQG VV+ G   +   +        GG I NGA+VER +   F+D  +
Sbjct: 132 PLRAADGEVYAVAQGRVVIGGFGAE--DTEIPVDNQLGGSIPNGAMVERRIDTGFQDRDE 189

Query: 188 LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVE 246
           ++L L  PDF+TA R A+ IN           A A D+ +V+V  P +       +S +E
Sbjct: 190 VVLNLHEPDFTTARRTAEVINH----NLGPRTARAEDAGSVRVRAPQDSDQRVSFISFLE 245

Query: 247 MLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
            L VE  + PA VI+N RTGTIV+G NVR+    VS+GN+TV I                
Sbjct: 246 ELRVEPGEAPAEVIVNARTGTIVMGSNVRVRPAAVSHGNMTVAIGAGGPEQIAEDPFGLD 305

Query: 306 STVTQNNTDLK--VSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
             +   + ++   +     +F      DL+ ++  +N++G     +++IL+ +K AGAL+
Sbjct: 306 EPLMVPDEEMDEGLEGENPAFVFQAGADLDEIVDAINAVGAAPGDLVAILEALKRAGALR 365

Query: 364 SEIII 368
           +E+ I
Sbjct: 366 AELTI 370


>gi|238751766|ref|ZP_04613254.1| Flagellar P-ring protein [Yersinia rohdei ATCC 43380]
 gi|238710037|gb|EEQ02267.1| Flagellar P-ring protein [Yersinia rohdei ATCC 43380]
          Length = 373

 Score =  363 bits (931), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 146/371 (39%), Positives = 218/371 (58%), Gaps = 8/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +  + F+    +      +    RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PF
Sbjct: 6   VITLFFIPLIAVISLLPLSASAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPF 65

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+R
Sbjct: 66  TTQSLSNMLSQLGITVPAGTNMQLKNVAAVMVTAKLPAFSRTGQTIDVVVSSMGNAKSIR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L G D  +YA+AQG+V+V G       SS      TGG+I NGA +ERELP 
Sbjct: 126 GGTLLMTPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISNGATIERELPT 185

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLT 239
            F     + LQL   DF+TA +++D IN           A A D+RT++V  P       
Sbjct: 186 TFGTDGVINLQLNTDDFTTAQQVSDAINRQR----GLGSATAIDARTIQVLVPRGSSSQV 241

Query: 240 RLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           R +++++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP
Sbjct: 242 RFLADIQNIPVNVDAGDAKVIINSRTGSVVMNRNVMLDSCAVAQGNLSVVVDKQNTVSQP 301

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           +     G TV   NT + V    G+   +  +P+LN+++  +NS+G     ++SILQ ++
Sbjct: 302 DTPFGGGQTVVTPNTQISVQQQGGALQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQ 361

Query: 358 AAGALQSEIII 368
           +AG L++++ I
Sbjct: 362 SAGCLRAKLEI 372


>gi|171321842|ref|ZP_02910743.1| flagellar P-ring protein [Burkholderia ambifaria MEX-5]
 gi|171092880|gb|EDT38132.1| flagellar P-ring protein [Burkholderia ambifaria MEX-5]
          Length = 394

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 145/361 (40%), Positives = 208/361 (57%), Gaps = 19/361 (5%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG-- 79
              R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS     
Sbjct: 38  HAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGS 97

Query: 80  --------GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
                     +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SLRGG L++T L G
Sbjct: 98  ANGGPSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSLRGGTLLLTPLKG 157

Query: 132 ADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LIL 190
           ADG +YA+AQG++ V G       S         G+IV GAIVER +P         L L
Sbjct: 158 ADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERAVPNAIAQMNGVLQL 217

Query: 191 QLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLT 249
           QL + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L 
Sbjct: 218 QLNDMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLAAPADSAQQVAFMARLQNLD 273

Query: 250 VETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTV 308
           V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV
Sbjct: 274 VSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTV 332

Query: 309 TQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEII 367
               + +++  + G+  ++    +L  ++  +NS+G     ++SILQ +KAAGAL++++ 
Sbjct: 333 VAQQSQIQLKQDNGALKMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLE 392

Query: 368 I 368
           +
Sbjct: 393 V 393


>gi|260222472|emb|CBA32070.1| Flagellar P-ring protein [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 381

 Score =  362 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 137/367 (37%), Positives = 216/367 (58%), Gaps = 11/367 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L  +L       A   +RIK+V +++  R NQL G+GLV+GL GTGD     P+T Q ++
Sbjct: 19  LCVALSMAFAPVAHSATRIKEVAAIEGVRSNQLTGFGLVIGLDGTGDQTTQMPYTTQGLK 78

Query: 68  SLLQNLGISTPG---GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
           + ++ LG++       +L  KNVAAV+VTA LP FA PG  +D++++SLG+A SL+GG L
Sbjct: 79  NYMEQLGLTLTPASLTQLQMKNVAAVLVTAQLPAFARPGQMLDINVSSLGNAKSLKGGTL 138

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           + T L GADG +YA+AQG+++V+G       S       + G+I +GA VER +P   +D
Sbjct: 139 IATPLKGADGEVYAMAQGNLIVAGAGASAGGSKVQVNHLSAGRIPDGAQVERSVPTSLQD 198

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMS 243
              + L L   DF TA ++A  +N    NRF   +A+A D RTV+V  PTN +     ++
Sbjct: 199 GPTINLSLNASDFQTARKVAQAVN----NRFGSGVAQALDGRTVQVKAPTNPNERVSFIA 254

Query: 244 EVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           ++E L V++    A++IIN RTG+IV+   V +    +++GNL+V ++ +  + QPN   
Sbjct: 255 DMEELPVDSSVAAAKIIINSRTGSIVMNQAVTLGACAIAHGNLSVSVSSSPVISQPNPL- 313

Query: 303 SNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGA 361
           S G TV     ++++    G    L  A  L  ++  +NS+G     +++ILQ IK+AGA
Sbjct: 314 SGGQTVVGEKANIEIKQEAGKLIQLPQAAQLTDVVRALNSLGATPQDLLAILQAIKSAGA 373

Query: 362 LQSEIII 368
           L +E+ +
Sbjct: 374 LNAELEV 380


>gi|238788319|ref|ZP_04632113.1| Flagellar P-ring protein [Yersinia frederiksenii ATCC 33641]
 gi|238723565|gb|EEQ15211.1| Flagellar P-ring protein [Yersinia frederiksenii ATCC 33641]
          Length = 373

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 144/371 (38%), Positives = 213/371 (57%), Gaps = 8/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +  +  +                RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PF
Sbjct: 6   LITLFVVQLIAFISLLSLPASAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPF 65

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+R
Sbjct: 66  TTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSIR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L G D  +YA+AQG+V+V G       SS      TGG+I NGA +ERELP 
Sbjct: 126 GGTLLMTPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISNGATIERELPT 185

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLT 239
            F     + LQL   DF+ A +++D IN           A A D+RT++V  P       
Sbjct: 186 TFGTDGVINLQLNTEDFTMAQQVSDAINRQR----GFGSATAIDARTIQVLVPRGSSSQV 241

Query: 240 RLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           R +++++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP
Sbjct: 242 RFLADIQNIPVNVDAGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNTVSQP 301

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           +     G TV   NT + V    G    +  +P+LN+++  +NS+G     ++SILQ ++
Sbjct: 302 DTPFGGGQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQ 361

Query: 358 AAGALQSEIII 368
           +AG L++++ I
Sbjct: 362 SAGCLRAKLEI 372


>gi|94312673|ref|YP_585882.1| flagellar basal body P-ring protein [Cupriavidus metallidurans
           CH34]
 gi|93356525|gb|ABF10613.1| flagellar basal body P-ring protein [Cupriavidus metallidurans
           CH34]
          Length = 394

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 138/352 (39%), Positives = 202/352 (57%), Gaps = 9/352 (2%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
               R+K++ + Q  RDN L+GYGLVVGL  TGD    +PFT QS++++L  LGI+ P G
Sbjct: 47  AHAERLKNLATFQGVRDNPLVGYGLVVGLDNTGDQTMQTPFTTQSLQNMLSQLGITLPAG 106

Query: 81  -RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
             +  KNVAAVMVTA LP +A PGS+IDV ++S+G+A SLRGG L+MT L G DG +YAV
Sbjct: 107 KNMQLKNVAAVMVTAALPAYAQPGSQIDVVVSSMGNAKSLRGGTLLMTPLKGIDGQVYAV 166

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQG+++V G       S         G+I NGAIVER +P    +   + L+L++ DF T
Sbjct: 167 AQGNMLVGGAGASANGSKVQINQLAVGRIANGAIVERAVPSFQPEGGFMNLELKDTDFGT 226

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVETD-TPAR 257
             R+ + IN           A A D R V+V  P         M+ +E L V      A+
Sbjct: 227 VERVVEAIN----RNLGAGTAAAMDGRVVQVRTPQAPSARVGFMARIENLDVTPAKAAAK 282

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           VI+N RTG+IV+   V +    +++GNL+V I     + QP  F S G TV    + + +
Sbjct: 283 VILNARTGSIVMNQAVTVEDCAIAHGNLSVVINTQPVISQPGPF-SQGQTVVAPVSQIDM 341

Query: 318 SDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
               GS  ++     L +++ G+N++G     + +IL+ ++AAGAL++E+ I
Sbjct: 342 KQGGGSLQIVKAGASLAAVVKGLNALGATPADLQTILEAMRAAGALRAELEI 393


>gi|299531282|ref|ZP_07044692.1| flagellar basal body P-ring protein [Comamonas testosteroni S44]
 gi|298720689|gb|EFI61636.1| flagellar basal body P-ring protein [Comamonas testosteroni S44]
          Length = 382

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 140/370 (37%), Positives = 212/370 (57%), Gaps = 12/370 (3%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
             ++ +L           +RIK+V ++Q  R NQL GYGLVVGL GTGD     P+T+Q+
Sbjct: 17  LLVVAALGASGLTLPAHATRIKEVAAIQGVRSNQLTGYGLVVGLDGTGDQTTQMPYTKQA 76

Query: 66  MRSLLQNLGISTPGG----RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           + + L+ +GI+ P      +L  KNVAAV++TA LP FA PG  ID++++S+G+A SL+G
Sbjct: 77  LANYLEQMGIALPATGNAAQLQLKNVAAVIITAELPAFAQPGQAIDINVSSMGNAKSLKG 136

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G LV T L GADG IYA+AQG+VVV G       S         G++  GA VER +P  
Sbjct: 137 GTLVATPLRGADGEIYALAQGNVVVGGAGAAAGGSKVQVNHLNAGRVPQGAQVERAVPTP 196

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
                 + L L   DF TA ++   IN     R     A A D RTV+V+ P +     R
Sbjct: 197 VNQGNTITLGLNQTDFQTADKMVRAINQ----RMGAGTAMALDGRTVQVNAPIDPGSRVR 252

Query: 241 LMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
           +++E++ + +ET  P A+V+IN RTG+IV+   V +    +++GNL++ I+    + QP 
Sbjct: 253 MIAEIQEMPIETSKPAAKVVINARTGSIVLNQAVTLGPCAIAHGNLSITISTTPVISQPA 312

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
            F S G TV    +D++V    G    + ++P L  ++  +NS+G     +++ILQ IKA
Sbjct: 313 PF-SQGQTVVAQKSDIQVKQEPGKVINMPNSPQLTDVVRALNSLGATPQDLLAILQAIKA 371

Query: 359 AGALQSEIII 368
           AGA+ +E+ +
Sbjct: 372 AGAMDAELEV 381


>gi|221069318|ref|ZP_03545423.1| flagellar P-ring protein [Comamonas testosteroni KF-1]
 gi|220714341|gb|EED69709.1| flagellar P-ring protein [Comamonas testosteroni KF-1]
          Length = 382

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 140/370 (37%), Positives = 213/370 (57%), Gaps = 12/370 (3%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
             ++ +L           +RIK+V ++Q  R NQL GYGLVVGL GTGD     P+T+Q+
Sbjct: 17  LLVVAALGASGLTLPAHATRIKEVAAIQGVRSNQLTGYGLVVGLDGTGDQTTQMPYTKQA 76

Query: 66  MRSLLQNLGISTPGG----RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           + + L+ +GI+ P      +L  KNVAAV++TA LP FA PG  ID++++S+G+A SL+G
Sbjct: 77  LANYLEQMGIALPATGNAAQLQLKNVAAVIITAELPAFAQPGQAIDINVSSMGNAKSLKG 136

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G LV T L GADG IYA+AQG+VVV G       S         G++  GA VER +P  
Sbjct: 137 GTLVATPLRGADGEIYALAQGNVVVGGAGAAAGGSKVQVNHLNAGRVPQGAQVERAVPTP 196

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
               + + L L   DF TA ++   IN     R     A A D RTV+V+ P +     R
Sbjct: 197 VNQGSTITLGLNQTDFQTADKMVRAINQ----RLGAGTAMALDGRTVQVNAPIDPGSRVR 252

Query: 241 LMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
           +++E++ + +ET  P A+V+IN RTG+IV+   V +    +++GNL++ I+    + QP 
Sbjct: 253 MIAEIQEMPIETSKPAAKVVINARTGSIVLNQAVTLGPCAIAHGNLSITISTTPVISQPA 312

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
            F S G TV    +D++V    G    + ++P L  ++  +NS+G     +++ILQ IKA
Sbjct: 313 PF-SQGQTVVAQKSDIQVKQEPGKVINMPNSPQLTDVVRALNSLGATPQDLLAILQAIKA 371

Query: 359 AGALQSEIII 368
           AGA+ +E+ +
Sbjct: 372 AGAMDAELEV 381


>gi|264676574|ref|YP_003276480.1| flagellar P-ring protein [Comamonas testosteroni CNB-2]
 gi|262207086|gb|ACY31184.1| flagellar P-ring protein [Comamonas testosteroni CNB-2]
          Length = 385

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 140/370 (37%), Positives = 212/370 (57%), Gaps = 12/370 (3%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
             ++ +L           +RIK+V ++Q  R NQL GYGLVVGL GTGD     P+T+Q+
Sbjct: 20  LLVVAALGASGLTLPAHATRIKEVAAIQGVRSNQLTGYGLVVGLDGTGDQTTQMPYTKQA 79

Query: 66  MRSLLQNLGISTPGG----RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           + + L+ +GI+ P      +L  KNVAAV++TA LP FA PG  ID++++S+G+A SL+G
Sbjct: 80  LANYLEQMGIALPATGNAAQLQLKNVAAVIITAELPAFAQPGQAIDINVSSMGNAKSLKG 139

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G LV T L GADG IYA+AQG+VVV G       S         G++  GA VER +P  
Sbjct: 140 GTLVATPLRGADGEIYALAQGNVVVGGAGAAAGGSKVQVNHLNAGRVPQGAQVERAVPTP 199

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTR 240
                 + L L   DF TA ++   IN     R     A A D RTV+V+ P +     R
Sbjct: 200 VNQGNTITLGLNQTDFQTADKMVRAINQ----RMGAGTAMALDGRTVQVNAPIDPGSRVR 255

Query: 241 LMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
           +++E++ + +ET  P A+V+IN RTG+IV+   V +    +++GNL++ I+    + QP 
Sbjct: 256 MIAEIQEMPIETSKPAAKVVINARTGSIVLNQAVTLGPCAIAHGNLSITISTTPVISQPA 315

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
            F S G TV    +D++V    G    + ++P L  ++  +NS+G     +++ILQ IKA
Sbjct: 316 PF-SQGQTVVAQKSDIQVKQEPGKVINMPNSPQLTDVVRALNSLGATPQDLLAILQAIKA 374

Query: 359 AGALQSEIII 368
           AGA+ +E+ +
Sbjct: 375 AGAMDAELEV 384


>gi|254251195|ref|ZP_04944513.1| Flagellar basal-body P-ring protein [Burkholderia dolosa AUO158]
 gi|124893804|gb|EAY67684.1| Flagellar basal-body P-ring protein [Burkholderia dolosa AUO158]
          Length = 398

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 144/369 (39%), Positives = 210/369 (56%), Gaps = 19/369 (5%)

Query: 14  GLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNL 73
            +   +     R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NL
Sbjct: 34  CMTGAAPAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANL 93

Query: 74  GISTPG----------GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           GIS               +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SLRGG 
Sbjct: 94  GISINNGSANGGSSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSLRGGT 153

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L++T L GADG +YA+AQG++ V G       S         G+IV GAIVER +P    
Sbjct: 154 LLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERAVPNAVA 213

Query: 184 DSA-DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRL 241
                L LQL + D+ TA RI   +N+     F    A A D RT++++ P +       
Sbjct: 214 QMNGMLQLQLNDMDYGTAQRIVSAVNA----SFGPGTATALDGRTIQLAAPADSAQQVAF 269

Query: 242 MSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  
Sbjct: 270 MARLQNLDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGP 329

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           F SNG TV    + +++  + G+  ++    +L  ++  +N++G     ++SILQ +KAA
Sbjct: 330 F-SNGQTVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSILQAMKAA 388

Query: 360 GALQSEIII 368
           GAL++++ I
Sbjct: 389 GALRADLEI 397


>gi|261821157|ref|YP_003259263.1| flagellar basal body P-ring protein [Pectobacterium wasabiae
           WPP163]
 gi|261605170|gb|ACX87656.1| flagellar P-ring protein [Pectobacterium wasabiae WPP163]
          Length = 369

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 148/372 (39%), Positives = 217/372 (58%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M     F +   +    I+     RI+D+V++Q  R N LIGYGLVVGL G+GD    +P
Sbjct: 1   MRIGSFFTVLLTLLALNIAPASAERIRDLVNIQGVRGNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F   G  IDV ++SLG+A SL
Sbjct: 61  FTTQSLTNMLSQLGITVPAGTNMQLKNVAAVMVTAELPAFGRSGQNIDVVVSSLGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA++ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISNGAVIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDL 238
             F  S  ++LQL+N DFS A +++D IN           A   DSRT++V  P  N   
Sbjct: 181 STFGASNTIMLQLKNDDFSMAQKVSDAINRSGY----GGTASPLDSRTIQVLAPHGNSSQ 236

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++V+ + V      A+V+IN RTG++V+  +V +    ++ GNL+V I +   V Q
Sbjct: 237 VRFLADVQNIEVNVGIQDAKVVINSRTGSVVMNRDVTLDSCAIAQGNLSVTINQQANVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PN     G TV    T++ V    G+   +  + +LN+++  +NS+G     ++SILQ +
Sbjct: 297 PNTPFGGGQTVVTPQTEISVQQAGGALQRVNSSANLNNVVRALNSLGATPMELMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 QSAGCLRAKLEI 368


>gi|146294546|ref|YP_001184970.1| flagellar basal body P-ring protein [Shewanella putrefaciens CN-32]
 gi|145566236|gb|ABP77171.1| flagellar P-ring protein [Shewanella putrefaciens CN-32]
          Length = 372

 Score =  362 bits (929), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 143/376 (38%), Positives = 213/376 (56%), Gaps = 14/376 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSR-IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           + R   L+  + G  +   Q  SR + D+V +Q  RDNQL+GYGLVVGL GTGD      
Sbjct: 1   MLRCLLLLLLVSGTLQAQEQSQSRYLMDIVDVQGLRDNQLVGYGLVVGLSGTGDRS-QVK 59

Query: 61  FTEQSMRSLLQNLGISTPG-GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L+  G+          KNVAAV V A +   ASPG  +DV+++SLGDA SL
Sbjct: 60  FTSQSVVNMLKQFGVQIDDKTDPKLKNVAAVAVHATITSLASPGQSLDVTVSSLGDAKSL 119

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           +GG L+MT L   DG IYAVAQG++VV G+  +G   SS    + T G I NGA++E  +
Sbjct: 120 QGGTLLMTPLRAVDGEIYAVAQGNLVVGGISAEGRNGSSVTVNVPTVGTIPNGALLEAPI 179

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NID 237
              F D+ D+IL L++P+F TA  I   +N      F   +A A D   V +  P  N +
Sbjct: 180 KSNFSDNEDIILNLKDPNFKTARNIERAVNEL----FGPDVARAQDHAKVLIHAPKSNRE 235

Query: 238 LTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               MS +E L ++      R++ N RTGT+V+G +V   K  VS+GNLTV I E + V 
Sbjct: 236 RVTFMSMLEELKIDQGRRSPRIVFNSRTGTVVMGGDVVARKAAVSHGNLTVTIVERQNVS 295

Query: 297 QPNAF---SSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISI 352
           QPN     ++ G TV  N++ + V   NK  F   +   +  ++  +NS+G     +++I
Sbjct: 296 QPNGAYLGNAAGETVVTNDSQVLVEQGNKRMFVWPEGTSIEEIVRAVNSLGATPMDLMAI 355

Query: 353 LQGIKAAGALQSEIII 368
           L+ +  AG+L++++++
Sbjct: 356 LEALSEAGSLEADLVV 371


>gi|33592483|ref|NP_880127.1| flagellar basal body P-ring protein [Bordetella pertussis Tohama I]
 gi|33572129|emb|CAE41671.1| flagellar P-ring protein precursor [Bordetella pertussis Tohama I]
 gi|332381900|gb|AEE66747.1| flagellar basal body P-ring protein [Bordetella pertussis CS]
          Length = 377

 Score =  361 bits (928), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 147/364 (40%), Positives = 213/364 (58%), Gaps = 8/364 (2%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
               + L    A    R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R + FT+QS+ +
Sbjct: 17  AVLALELLGAGAAHAERLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTLFTQQSLTN 76

Query: 69  LLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +L  LGI+ P G  +  KNVAAVMVTA LP FA PG  +DV ++S+G+A SLRGG L+MT
Sbjct: 77  MLSQLGITVPQGSNMQLKNVAAVMVTATLPSFARPGQTVDVVVSSMGNAKSLRGGTLLMT 136

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD 187
            L GAD  +Y +AQG+++V G       SS       GG+I NGAIVER +P  +     
Sbjct: 137 PLKGADNQVYVIAQGNLLVGGAGASAGGSSVQINQLNGGRISNGAIVERAVPTMYAQDGM 196

Query: 188 LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVE 246
           + L++ N DF T    A  IN     +F    A A D R ++V  P +   +   MS+VE
Sbjct: 197 VYLEMNNTDFGTTQNAATAIN----RQFGAGTAMALDGRVIQVRGPLDPSMMPAFMSQVE 252

Query: 247 MLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
            L V      A+VIIN RTG++V+   V I +  V++GNL+V I    QV QP+   + G
Sbjct: 253 NLQVARAPATAKVIINARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVFQPDTPFTEG 312

Query: 306 STVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
            TV   NT ++V  + G+   +  + +L  ++  +N++G     +++ILQ +K AGAL++
Sbjct: 313 QTVVVPNTQIEVRQDGGALQRVTTSANLADVVKALNALGATPQDLLAILQAMKTAGALRA 372

Query: 365 EIII 368
           ++ I
Sbjct: 373 DLEI 376


>gi|197285506|ref|YP_002151378.1| flagellar basal body P-ring protein [Proteus mirabilis HI4320]
 gi|194682993|emb|CAR43436.1| flagellar P-ring protein precursor (basal body P-ring protein)
           [Proteus mirabilis HI4320]
          Length = 368

 Score =  361 bits (928), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 151/371 (40%), Positives = 219/371 (59%), Gaps = 8/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + ++A  +F ++      +    RI+D+ S++  R+N LIGYGLVVGL GTGD    +PF
Sbjct: 1   MKKLAISLFFIVMTCVGFSAHAERIRDLTSVEGVRENALIGYGLVVGLDGTGDQTMQTPF 60

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  IDV ++SLG+A SLR
Sbjct: 61  TTQSLNNMLSQLGITVPAGTNMQLKNVAAVMVTAKLPPFGRTGQSIDVVVSSLGNAKSLR 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L G D  +YAVAQG++VV G       SS       GG+I NGAI+ERELP 
Sbjct: 121 GGTLLMTPLKGVDSQVYAVAQGNIVVGGSGASAGGSSVKVNQLAGGRISNGAIIERELPS 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLT 239
           +F  +  L LQL   +F+ A  IAD IN           A   D+RTV++  P    +  
Sbjct: 181 QFGQTGLLNLQLNEENFTLAQSIADAINKLR----GVGTALPLDARTVQLRVPLGKSEQV 236

Query: 240 RLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           R +++V+ L V+     A+VIIN RTG++V+  +V +    ++ GNL+V +     V QP
Sbjct: 237 RFLADVQNLEVKRVIADAKVIINARTGSVVMNRDVVLGSCAIAQGNLSVTVDSQVNVSQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           N   + GSTV   NT + V++  GS   +  +  LN +I  +N++G     ++SILQ ++
Sbjct: 297 NTPFAGGSTVVSRNTSVNVNEKGGSLQKVNASASLNEVIRSLNALGATPTDLMSILQAME 356

Query: 358 AAGALQSEIII 368
           +AG L++ + I
Sbjct: 357 SAGCLRARLEI 367


>gi|119503648|ref|ZP_01625731.1| flagellar P-ring protein precursor I [marine gamma proteobacterium
           HTCC2080]
 gi|119460710|gb|EAW41802.1| flagellar P-ring protein precursor I [marine gamma proteobacterium
           HTCC2080]
          Length = 373

 Score =  361 bits (928), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 147/355 (41%), Positives = 212/355 (59%), Gaps = 9/355 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           S     RIKD+  L+  R NQL+G+GL+VGL G+GD +  +PFT Q+ RS+LQ  G++ P
Sbjct: 22  SLSKAERIKDLAMLEGARTNQLVGFGLIVGLDGSGDQVTQTPFTLQAARSMLQQFGVNVP 81

Query: 79  -GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
                 +KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L+MT L   +G +Y
Sbjct: 82  ANSNPQTKNVAAVMVTATLPPFAKPGQTIDVTVSSLGNAKSLRGGELLMTQLKAGNGEVY 141

Query: 138 AVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
            VAQGS++VSG   +G   SS      + G+I NG IVERE+      +  +   L +PD
Sbjct: 142 VVAQGSLIVSGFGAEGADGSSISLNTKSAGRIPNGGIVEREVLTPLHGAGPITFNLHSPD 201

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVE-TDT 254
           FSTA  +A  IN +         A A D+ +V+V  P   D     ++E+E + V+    
Sbjct: 202 FSTASNMAAAINGF----MGPGTASALDAVSVRVVAPAEPDAKVAYVAELENIQVQRAAA 257

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            A+VI+N R+GTIVIG  V +    V++GNLTV + E+ +V QP  FS  G TV    ++
Sbjct: 258 SAKVIVNARSGTIVIGAEVMVKTAAVAHGNLTVSVDESVEVSQPGPFSRVGETVVTTQSE 317

Query: 315 LKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + + D     F L D   L  +++ +N +G     +I+IL+ ++ AGAL +++II
Sbjct: 318 VNIEDENLRMFLLNDGVSLQEIVTAINRVGAAPGDLIAILEALQQAGALSAQLII 372


>gi|126462480|ref|YP_001043594.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221639491|ref|YP_002525753.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides KD131]
 gi|332558504|ref|ZP_08412826.1| FlgI [Rhodobacter sphaeroides WS8N]
 gi|14548029|sp|P58204|FLGI_RHOSH RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|11095162|gb|AAG29751.1|AF205139_3 flagellar P-ring protein [Rhodobacter sphaeroides]
 gi|126104144|gb|ABN76822.1| flagellar P-ring protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221160272|gb|ACM01252.1| Flagellar P-ring protein precursor [Rhodobacter sphaeroides KD131]
 gi|332276216|gb|EGJ21531.1| FlgI [Rhodobacter sphaeroides WS8N]
          Length = 371

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 137/358 (38%), Positives = 220/358 (61%), Gaps = 18/358 (5%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
             R+KD+ ++   R N L+GYG+VVGL GTGD   +S  T+QSM+SL+  LG+S   G L
Sbjct: 19  ADRLKDLTTVAGVRSNPLVGYGVVVGLSGTGDG--NSQLTQQSMQSLISRLGLSVETGDL 76

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            +KN AAVMVTA+LPPF   G  +DV+++++G A SL+GG L+MT L+GADG +YA+AQG
Sbjct: 77  KAKNAAAVMVTADLPPFLKIGQTLDVTVSTVGQAKSLKGGTLLMTPLMGADGEVYAIAQG 136

Query: 143 SVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VV GL V+G   SS    I T G++  G +VE+ +   F ++  L+L L   DFSTA 
Sbjct: 137 NLVVGGLGVEGKDGSSLTVNIPTVGRVPRGGMVEKMVETPFLETDHLVLNLNRGDFSTAA 196

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-ARVI 259
            +A+ +N      F   +A A D  +++V  P +       MS +E + V+   P ARV+
Sbjct: 197 AVAEGVN----RTFGPDVAVALDGTSIRVRAPADPAQRVSFMSLLENVEVDPAPPVARVV 252

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP--------NAFSSNGSTVTQN 311
           +N RTGT+VIG  V+++   V++G+LTV++TE+++V Q             + G  V   
Sbjct: 253 VNARTGTVVIGGTVKVTPAAVTHGSLTVRVTEDQRVSQGASVVVGNNATVVAPGEPVVTP 312

Query: 312 NTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++ ++V +    +F       L+SL+  +N++G     +++IL+ ++ AGAL++E+++
Sbjct: 313 DSQVQVVEEPAKAFVFDPGVSLSSLVDAINAVGASPSDLVAILEALREAGALRAELVV 370


>gi|91204380|emb|CAJ70880.1| strongly similar to flagellar P-ring protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 385

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 146/377 (38%), Positives = 219/377 (58%), Gaps = 16/377 (4%)

Query: 2   IFRIAFLIFS-----LIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSL 56
           + +     F      LI L     Q   RIKD+  +Q  R+NQL GYG+V+GLQGTGD+ 
Sbjct: 14  MLKCVITSFIIAGTTLISLFVHHVQAAVRIKDIAYVQGVRENQLYGYGIVIGLQGTGDNS 73

Query: 57  RSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDA 116
           +    T Q   ++ + LG+        SKN A VMVT N+P FA PG ++D++++S+GD 
Sbjct: 74  QIFKLTSQMAVNIFEKLGVLMDEKDFFSKNTAVVMVTTNIPAFARPGDKLDITLSSIGDC 133

Query: 117 SSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVER 176
            SL GG+L+ T+L GAD  +YAVAQG++ V G  +KG + S  + IST   I NGAIVE+
Sbjct: 134 KSLEGGVLLQTALQGADNEVYAVAQGALTVGGYSIKGDAQSVRKNISTTAHISNGAIVEK 193

Query: 177 ELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI 236
           E+   F     L + LR+PDF+T+ R+ + IN+          + A D+  + +  P   
Sbjct: 194 EIHTTFLKGQALNIVLRDPDFTTSTRVTELINNIY-----PNSSVAVDAAVINIRPPQGF 248

Query: 237 D----LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
                + + +S +E L ++TD+ A++IINERTGTIV   +VRIS V V++GNL++ I E 
Sbjct: 249 QSDETIVKFISTLEELYIKTDSVAKIIINERTGTIVADQHVRISTVAVAHGNLSITIKEE 308

Query: 293 EQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIIS 351
           ++V QPN     G T     TD++VS+ K     L +   ++ +   +N +G+    +IS
Sbjct: 309 KEVSQPN-MLGAGETRDMARTDIQVSEEKSRLTVLQEGVSISDVARALNVLGVTPRDLIS 367

Query: 352 ILQGIKAAGALQSEIII 368
           I Q IK AGAL +E++I
Sbjct: 368 IFQAIKKAGALHAELVI 384


>gi|90112112|sp|Q7VYG2|FLGI_BORPE RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 368

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 147/371 (39%), Positives = 214/371 (57%), Gaps = 8/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +          + L    A    R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R + F
Sbjct: 1   MLIPLARAVLALELLGAGAAHAERLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTLF 60

Query: 62  TEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T+QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP FA PG  +DV ++S+G+A SLR
Sbjct: 61  TQQSLTNMLSQLGITVPQGSNMQLKNVAAVMVTATLPSFARPGQTVDVVVSSMGNAKSLR 120

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L GAD  +Y +AQG+++V G       SS       GG+I NGAIVER +P 
Sbjct: 121 GGTLLMTPLKGADNQVYVIAQGNLLVGGAGASAGGSSVQINQLNGGRISNGAIVERAVPT 180

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLT 239
            +     + L++ N DF T    A  IN     +F    A A D R ++V  P +   + 
Sbjct: 181 MYAQDGMVYLEMNNTDFGTTQNAATAIN----RQFGAGTAMALDGRVIQVRGPLDPSMMP 236

Query: 240 RLMSEVEMLTV-ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             MS+VE L V      A+VIIN RTG++V+   V I +  V++GNL+V I    QV QP
Sbjct: 237 AFMSQVENLQVARAPATAKVIINARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVFQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           +   + G TV   NT ++V  + G+   +  + +L  ++  +N++G     +++ILQ +K
Sbjct: 297 DTPFTEGQTVVVPNTQIEVRQDGGALQRVTTSANLADVVKALNALGATPQDLLAILQAMK 356

Query: 358 AAGALQSEIII 368
            AGAL++++ I
Sbjct: 357 TAGALRADLEI 367


>gi|226944496|ref|YP_002799569.1| flagellar basal body P-ring protein [Azotobacter vinelandii DJ]
 gi|226719423|gb|ACO78594.1| Flagellar P-ring protein [Azotobacter vinelandii DJ]
          Length = 385

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 142/356 (39%), Positives = 217/356 (60%), Gaps = 10/356 (2%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
            +A    +++D+      R+N L+GYGLVVGL GTGD    +PFTEQ + ++L  LGI+ 
Sbjct: 34  PAAAPAEQVRDIADFAGVRNNVLVGYGLVVGLDGTGDQTTQTPFTEQGLTNMLSQLGITV 93

Query: 78  P-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
           P G  +  +NVAAVMVT +LPPFA PG ++DV ++S+G+A SLRGG L+MT L G DG  
Sbjct: 94  PSGSNMQMRNVAAVMVTTSLPPFARPGQQVDVVVSSIGNARSLRGGTLLMTPLKGMDGET 153

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK-DSADLILQLRNP 195
           YA+AQG+++V G+  +   SS       GG+I  GA+VERE+P        +L L LR+P
Sbjct: 154 YALAQGNLLVGGVGAQANGSSVQINQQAGGRIARGALVEREVPLMLGGSRGELDLYLRSP 213

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVETDT 254
           DF+TA R+   IN    N F R +A A D   V++  P++ +     M+ VE + V    
Sbjct: 214 DFATARRVVLAIN----NEFGRTVASAQDGGLVRLQGPSSPNERVNFMARVEGVQVTPMA 269

Query: 255 -PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
              +VI+N RTG +V+   V++ +  V++GNL++ I  + +V QP  F S G TV   N+
Sbjct: 270 ERPKVIVNSRTGAVVLNGAVKLHRAAVAHGNLSIVIDTDNRVSQPEPF-SRGQTVVAPNS 328

Query: 314 DLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           D+ +    G+  L++   DL  ++  +N++G     ++SIL+ +KAAG+L++E+ I
Sbjct: 329 DISIEQEGGALHLVEGSADLMDVVKALNALGATPQDLMSILEALKAAGSLRAELEI 384


>gi|317492424|ref|ZP_07950853.1| flagellar P-ring protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919763|gb|EFV41093.1| flagellar P-ring protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 367

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 146/370 (39%), Positives = 215/370 (58%), Gaps = 8/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
                L   +            RI+D+ ++Q  RDN LIGYGLVVGL G+GD    +PFT
Sbjct: 1   MTSLMLGLLVSLSLFTQTASAERIRDLTTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFT 60

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF+  G  IDV ++S+G+A SLRG
Sbjct: 61  TQSLNNMLSQLGITVPAGTNMQLKNVAAVMVTAKLPPFSRAGQSIDVVVSSMGNAKSLRG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L G D  +YA+AQG+V+V G       SS       GG+I  GA +ERE+   
Sbjct: 121 GTLLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISGGATIEREVQST 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTR 240
           F +S  + LQL + DFS A RI+D IN +         A   D+RTV+V  P  N +  R
Sbjct: 181 FGNSNVINLQLNDEDFSLAQRISDSINRFG----GMGSATPLDARTVQVLVPQGNSNQVR 236

Query: 241 LMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
           +++ ++ + V   +  A+VI+N RTG++V+  NV +    V+ GNL+V +     V QPN
Sbjct: 237 VLANIQNIEVSVGSFDAKVIVNSRTGSVVMNRNVELDSCAVAQGNLSVVVDRQNTVSQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
                G TV   NT + V   +GS   +  + +LNS++  +N++G   + ++SILQ +++
Sbjct: 297 TPFGGGQTVVTPNTQISVQQGQGSLQQVRSSANLNSVVRTLNALGATPNDLMSILQAMQS 356

Query: 359 AGALQSEIII 368
           AG L++++ I
Sbjct: 357 AGCLRAKLEI 366


>gi|116694223|ref|YP_728434.1| flagellar basal body P-ring protein [Ralstonia eutropha H16]
 gi|113528722|emb|CAJ95069.1| flagellar basal body P-ring protein [Ralstonia eutropha H16]
          Length = 389

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 138/372 (37%), Positives = 210/372 (56%), Gaps = 9/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +   +  L   +      S     R+K++ + Q  R+N L+GYGLVVGL  TGD    +P
Sbjct: 22  LRLSVISLALGVAFGAFASVAKAERLKNLATFQGVRENPLVGYGLVVGLDNTGDQTMQTP 81

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA+LP FA PGS++D+ ++S+G+A SL
Sbjct: 82  FTTQSLTNMLSQLGITLPAGKNMQLKNVAAVMVTASLPAFAQPGSQLDIVVSSMGNAKSL 141

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L GADG +YA+AQG+++V G       S         G+I NGAIVER + 
Sbjct: 142 RGGTLLMTPLKGADGQVYAIAQGNMLVGGAGASANGSKVQVNQLAVGRIANGAIVERAVA 201

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDL 238
               D   L L+L++ DF TA R+ + IN          +A A D R V+V  P +    
Sbjct: 202 PFQPDGGVLNLELKDTDFGTAERVVEAIN----RSMGGGVAAALDGRVVQVRAPASAAAR 257

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              ++ +E + V      A+VI+N RTG+IV+   V +    V++GNL+V I     + Q
Sbjct: 258 VGFLARIENIDVTPAKAAAKVILNARTGSIVMNQAVTVEDCAVAHGNLSVVINTQPVISQ 317

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGI 356
           P  F S G TV    + + +    GS  ++     L +++ G+N++G     + +IL+ +
Sbjct: 318 PAPF-SEGRTVVAPVSQIDMRQQGGSLQIVKAGASLAAVVKGLNALGATPADLQTILEAM 376

Query: 357 KAAGALQSEIII 368
           +AAGAL++E+ +
Sbjct: 377 RAAGALRAELEV 388


>gi|124021068|sp|Q46PF7|FLGI_RALEJ RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 377

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 140/368 (38%), Positives = 208/368 (56%), Gaps = 9/368 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +  L   +      +     R+K++ + Q  RDN L+GYGLVVGL  TGD    +PFT Q
Sbjct: 14  VTALAVVVAFGFAANFARAERLKNLATFQGVRDNPLVGYGLVVGLDNTGDQTMQTPFTTQ 73

Query: 65  SMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           S+ ++L  LGI+ P G  +  KNVAAVMVTA LP FA PGS++D+ ++S+G+A SLRGG 
Sbjct: 74  SLTNMLSQLGITLPAGKNMQLKNVAAVMVTATLPAFAQPGSQLDIVVSSMGNAKSLRGGT 133

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L+MT L GADG +YA+AQG+++V G       S         G+I NGAIVER +     
Sbjct: 134 LLMTPLKGADGQVYAIAQGNMLVGGAGASANGSKVQVNQLAVGRIANGAIVERAVAAFQP 193

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLM 242
           D   L L+L++ DF TA R+ + IN          +A A D R V+V  P +       +
Sbjct: 194 DGGVLNLELKDTDFGTAERVVEAIN----RSMGGGVAAALDGRVVQVRAPQSPSARVGFL 249

Query: 243 SEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           + +E L V      A+VI+N RTG+IV+   V +    V++GNL+V I     + QP  F
Sbjct: 250 ARIENLDVTPAKAAAKVILNARTGSIVMNQAVTVEDCAVAHGNLSVVINTQPVISQPAPF 309

Query: 302 SSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
            S G TV    + + +    GS  ++     L +++ G+N++G     + +IL+ ++AAG
Sbjct: 310 -SGGQTVVAPVSQIDMKQQGGSLQIVKAGASLAAVVKGLNALGATPADLQTILEAMRAAG 368

Query: 361 ALQSEIII 368
           AL++E+ I
Sbjct: 369 ALRAELEI 376


>gi|77463648|ref|YP_353152.1| flagellar basal body P-ring protein [Rhodobacter sphaeroides 2.4.1]
 gi|124021066|sp|Q3J1T3|FLGI1_RHOS4 RecName: Full=Flagellar P-ring protein 1; AltName: Full=Basal body
           P-ring protein 1; Flags: Precursor
 gi|77388066|gb|ABA79251.1| flagellar P-ring protein [Rhodobacter sphaeroides 2.4.1]
          Length = 371

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 136/358 (37%), Positives = 219/358 (61%), Gaps = 18/358 (5%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRL 82
             R+KD+ ++   R N L+GYG+VVGL GTGD   +S  T+QSM+SL+  LG+S   G L
Sbjct: 19  ADRLKDLTTVAGVRSNPLVGYGVVVGLSGTGDG--NSQLTQQSMQSLISRLGLSVETGDL 76

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
            +KN AAVMVTA+LPPF   G  +DV+++++G   SL+GG L+MT L+GADG +YA+AQG
Sbjct: 77  KAKNAAAVMVTADLPPFLKIGQTLDVTVSTVGQPKSLKGGTLLMTPLMGADGEVYAIAQG 136

Query: 143 SVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           ++VV GL V+G   SS    I T G++  G +VE+ +   F ++  L+L L   DFSTA 
Sbjct: 137 NLVVGGLGVEGKDGSSLTVNIPTVGRVPRGGMVEKMVETPFLETDHLVLNLNRGDFSTAA 196

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-ARVI 259
            +A+ +N      F   +A A D  +++V  P +       MS +E + V+   P ARV+
Sbjct: 197 AVAEGVN----RTFGPDVAVALDGTSIRVRAPADPARRVSFMSLLENVEVDPAPPVARVV 252

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP--------NAFSSNGSTVTQN 311
           +N RTGT+VIG  V+++   V++G+LTV++TE+++V Q             + G  V   
Sbjct: 253 VNARTGTVVIGGTVKVTPAAVTHGSLTVRVTEDQRVSQGASVVVGNNATVVAPGEPVVTP 312

Query: 312 NTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++ ++V +    +F       L+SL+  +N++G     +++IL+ ++ AGAL++E+++
Sbjct: 313 DSQVQVVEEPAKAFVFDPGVSLSSLVDAINAVGASPSDLVAILEALREAGALRAELVV 370


>gi|227112525|ref|ZP_03826181.1| flagellar basal body P-ring protein [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 369

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 150/372 (40%), Positives = 218/372 (58%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M     F +   +    I+     RI+D+V++Q  R N LIGYGLVVGL G+GD    +P
Sbjct: 1   MRIASFFTVLLTLLTLNIAPASAERIRDLVNIQGVRGNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  IDV ++SLG+A SL
Sbjct: 61  FTTQSLTNMLSQLGITVPAGTNMQLKNVAAVMVTAELPPFGRTGQNIDVVVSSLGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA++ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISNGAVIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDL 238
             F  S  ++LQL+N DFS A +++D IN           A   DSRT++V  P  N   
Sbjct: 181 STFGTSNTIMLQLKNDDFSMAQKVSDAINRSGY----GGTASPLDSRTIQVLAPHGNSSQ 236

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++++ + V      A+VIIN RTG++V+  +V +    ++ GNL+V I +   V Q
Sbjct: 237 VRFLADIQNIEVNVGIQDAKVIINSRTGSVVMNRDVTLDSCAIAQGNLSVTINQQANVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PN     G TV    T++ V    GS   +  + +LN+++  +NS+G     ++SILQ +
Sbjct: 297 PNTPFGGGQTVVTPQTEISVQQAGGSLQRVNSSANLNNVVRALNSLGATPMELMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 QSAGCLRAKLEI 368


>gi|157371203|ref|YP_001479192.1| flagellar basal body P-ring protein [Serratia proteamaculans 568]
 gi|157322967|gb|ABV42064.1| flagellar P-ring protein [Serratia proteamaculans 568]
          Length = 366

 Score =  360 bits (925), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 147/372 (39%), Positives = 216/372 (58%), Gaps = 11/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ +I   ++  +     +     RI+D+V++Q  RDN LIGYGLVVGL G+GD    +P
Sbjct: 1   MLKKILLTLWIGLVCLPAT---AERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTP 57

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF+  G  IDV ++S+G+A SL
Sbjct: 58  FTTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTARLPPFSRTGQNIDVVVSSMGNAKSL 117

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA +ERELP
Sbjct: 118 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISNGATIERELP 177

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
             F     + LQL + DF+ A +I+D IN           A   D+RT++V  P  N   
Sbjct: 178 TTFGAGGVINLQLNDEDFTLAQQISDAINRQR----GGGTASPLDARTIQVLVPQGNSSQ 233

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R ++E++ + V      A+VIIN RTG++V+  +V +    V+ GNL+V +     V Q
Sbjct: 234 VRFLAEIQNINVSVGAMDAKVIINSRTGSVVMNRDVILDSCAVAQGNLSVVVDRQNTVSQ 293

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P      G TV   NT + V    GS   +  + +LN++I  +N++G     ++SILQ +
Sbjct: 294 PTTPFGGGQTVVTPNTQISVQQQGGSLQKVNASANLNNVIRALNALGATPIDLMSILQAM 353

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 354 QSAGCLRAKLEI 365


>gi|227328342|ref|ZP_03832366.1| flagellar basal body P-ring protein [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 369

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 151/372 (40%), Positives = 218/372 (58%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M     F +   +    IS     RI+D+V++Q  R N LIGYGLVVGL G+GD    +P
Sbjct: 1   MRIASFFTVLLTLLTLNISPASAERIRDLVNIQGVRGNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  IDV ++SLG+A SL
Sbjct: 61  FTTQSLTNMLSQLGITVPAGTNMQLKNVAAVMVTAELPPFGRTGQNIDVVVSSLGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA++ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISNGAVIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDL 238
             F  S  ++LQL+N DFS A +++D IN           A   DSRT++V  P  N   
Sbjct: 181 STFGTSNTIMLQLKNDDFSMAQKVSDAINRSGY----GGTATPLDSRTIQVLAPHGNSSQ 236

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++V+ + V      A+VIIN RTG++V+  +V +    ++ GNL+V I +   V Q
Sbjct: 237 VRFLADVQNIEVNVGIQDAKVIINSRTGSVVMNRDVTLDSCAIAQGNLSVTINQQANVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PN     G TV    T++ V    G+   +  + +LN+++  +NS+G     ++SILQ +
Sbjct: 297 PNTPFGGGQTVVTPQTEISVQQAGGALQRVNSSANLNNVVRALNSLGATPMELMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 QSAGCLRAKLEI 368


>gi|308050020|ref|YP_003913586.1| flagellar P-ring protein [Ferrimonas balearica DSM 9799]
 gi|307632210|gb|ADN76512.1| flagellar P-ring protein [Ferrimonas balearica DSM 9799]
          Length = 364

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 144/355 (40%), Positives = 203/355 (57%), Gaps = 11/355 (3%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           +      + D+V +Q  R+NQL+GYGLVVGL GTGD      FT QS+ ++L+  G+   
Sbjct: 15  APVQARPLMDIVDVQGVRENQLVGYGLVVGLDGTGDKS-QVRFTSQSVVNMLKQFGVQLD 73

Query: 79  GG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIY 137
                  KNVAAV V A +PP ASPG  ++V+++S+GDA SLRGG L+MT L G DG +Y
Sbjct: 74  DRIDPKLKNVAAVAVHATVPPLASPGQTVNVTVSSIGDAKSLRGGTLLMTPLHGVDGEVY 133

Query: 138 AVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           AVAQG++VV G+  +G   SS      T G I +G I+E ++P  F +  D++L LR P 
Sbjct: 134 AVAQGNLVVGGITAEGRNGSSVTINTPTVGLIPSGGILEADIPSTFTELPDIVLNLRQPS 193

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETD-T 254
           F TA  I   +N      F   +A A D   V V  P +       MS +E L VE    
Sbjct: 194 FKTARNIERSVNDL----FGPDVARAQDHAKVLVQAPMDPRQRVTFMSMLEELEVEVGRQ 249

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
             RV+ N RTGT+VIG  VR+ +  VS+GNLTV ITE +QV QPNAF   G T    ++ 
Sbjct: 250 RPRVVFNSRTGTVVIGQEVRVQRAAVSHGNLTVTITERQQVSQPNAF-GGGDTTVIQDSQ 308

Query: 315 LKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           + +S      F   +   L+ ++  +NS+G     +++ILQ +  AGAL +E+++
Sbjct: 309 IDISQGSANMFVWPEGTSLDEIVRAVNSLGAAPTDLMAILQALDEAGALDAELVV 363


>gi|296283246|ref|ZP_06861244.1| flagellar P-ring protein precursor [Citromicrobium bathyomarinum
           JL354]
          Length = 363

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 158/352 (44%), Positives = 222/352 (63%), Gaps = 10/352 (2%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR 81
             SRIKD+V +++ R NQL+GYGLVVGL GTGD  R+ PFTE+S++S+L+ +G+S    +
Sbjct: 18  SGSRIKDIVDVENVRTNQLVGYGLVVGLAGTGDRTRNVPFTEESLQSMLERMGVSVRDMQ 77

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
           L +KNVAAV VTA LPPFA  GSRIDV ++++GDA+SL+GG L+++ L   +G I+AVAQ
Sbjct: 78  LRTKNVAAVTVTATLPPFARAGSRIDVQVSAMGDATSLQGGTLLISPLRALNGEIFAVAQ 137

Query: 142 GSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           G + VSG   +G  +S   G+ST  +I  GAIVERE+P     +  L L L+NPDF+TA 
Sbjct: 138 GPLAVSGFKAQGAGASISRGVSTSARIAGGAIVEREVPYVLGSADSLKLALKNPDFTTAD 197

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT--RLMSEVEMLTVETDTPARVI 259
           RI   IN           A   D  TV++        +  +L+ E+E L V+ D PAR++
Sbjct: 198 RIVRAINQRF-----PGAARMLDPATVELGGAGGYGGSLLQLLPEIENLPVDVDQPARIV 252

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           +NE  GT+V+  +VRIS V ++ G LT+ + E+  V QP  F S G T     T L+V D
Sbjct: 253 VNEAAGTVVMTSDVRISPVAIAQGGLTISVAESPIVSQPGPF-SGGETTVVPRTRLEVDD 311

Query: 320 NKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
             G+    L     L SL++G+N +G+    +I+IL  +K AGALQ+EI IQ
Sbjct: 312 GSGASLAMLEQGTSLQSLVNGLNRLGVSPRDLITILHALKGAGALQAEITIQ 363


>gi|302383712|ref|YP_003819535.1| flagellar P-ring protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302194340|gb|ADL01912.1| flagellar P-ring protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 368

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 168/353 (47%), Positives = 227/353 (64%), Gaps = 9/353 (2%)

Query: 19  SAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP 78
           +A   SRIKD+ S++  R NQL+GYGLVVGL GTGDSLR+ PFT QS+  + + LG++  
Sbjct: 21  TASAQSRIKDIASIEGVRTNQLVGYGLVVGLAGTGDSLRNCPFTRQSLEGMTERLGVNIR 80

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           G    SKN+AA+MVTA+LPPFA+PG+R+DVS++SL DA SL GG L++TSL GADGN+YA
Sbjct: 81  GSNANSKNLAAIMVTADLPPFATPGARVDVSVSSLCDAKSLLGGTLLVTSLQGADGNVYA 140

Query: 139 VAQGSVVV-SGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDF 197
           VAQGSV   S        SS   G+ T G+I +GA VERE         ++ L LRNPDF
Sbjct: 141 VAQGSVQTGSVSGSGSSGSSVTRGVPTAGRIASGATVERETGFNLDSLQEVRLTLRNPDF 200

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPAR 257
           +TA R+A  IN+          A A +   + +  P  + +   +S VE + V  DTPAR
Sbjct: 201 TTAQRVAAAINATY-----PSTALAENGSVITLRAPAQLGMAAFISRVENMPVAVDTPAR 255

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           VII+E  G IV+G+NVRIS V ++ GNLT+ + E  QV QP  F S G T     +D+ V
Sbjct: 256 VIIDEVNGVIVMGENVRISTVAIAQGNLTISVQETPQVSQPAPF-SQGQTTVVPQSDVTV 314

Query: 318 SDNKGSFS--LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            +  G     +  A  L++L++G+N++G+    +ISILQ IKAAGALQ+EI +
Sbjct: 315 EEELGREIRLVNGATSLSTLVNGLNALGVSPRDMISILQAIKAAGALQAEIEV 367


>gi|238794002|ref|ZP_04637620.1| Flagellar P-ring protein [Yersinia intermedia ATCC 29909]
 gi|238726634|gb|EEQ18170.1| Flagellar P-ring protein [Yersinia intermedia ATCC 29909]
          Length = 373

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 145/371 (39%), Positives = 215/371 (57%), Gaps = 8/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +  +  +    +           RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PF
Sbjct: 6   LVTLFVIQLIALLTLVSLPATAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPF 65

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP F+  G  ID+ ++S+G+A S+R
Sbjct: 66  TTQSLSNMLSQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDIVVSSMGNAKSIR 125

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG L+MT L G D  +YA+AQG+V+V G       SS      TGG+I NGA +ERELP 
Sbjct: 126 GGTLLMTPLKGVDNQVYALAQGNVLVGGAGASSGGSSVQVNQLTGGRISNGATIERELPT 185

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLT 239
            F     + LQL   DF+ A +++D IN           A A D+RT++V  P  N    
Sbjct: 186 TFGTDGVINLQLNTEDFTMAQQVSDAINRQR----GFGSATAIDARTIQVLVPRGNSSQV 241

Query: 240 RLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           R +++++ + V  D   A+VIIN RTG++V+  NV +    V+ GNL+V I +   V QP
Sbjct: 242 RFLADIQNIPVNVDAGDAKVIINSRTGSVVMNRNVMLDSCAVAQGNLSVVIDKQNTVSQP 301

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           +     G TV   NT + V    G    +  +P+LN+++  +NS+G     ++SILQ ++
Sbjct: 302 DTPLGGGQTVVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMQ 361

Query: 358 AAGALQSEIII 368
           +AG L++++ I
Sbjct: 362 SAGCLRAKLEI 372


>gi|289549015|ref|YP_003474003.1| flagellar P-ring protein [Thermocrinis albus DSM 14484]
 gi|289182632|gb|ADC89876.1| flagellar P-ring protein [Thermocrinis albus DSM 14484]
          Length = 361

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 149/356 (41%), Positives = 230/356 (64%), Gaps = 7/356 (1%)

Query: 13  IGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQN 72
           + +  ++    ++I+D+ +++  R N L+GYGLVVGL+GTGD  +S+ FT +S+ ++LQ 
Sbjct: 12  LLILLVTVSFAAKIRDIATVEGNRSNYLVGYGLVVGLKGTGDG-KSTLFTVRSIANMLQR 70

Query: 73  LGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
           +G+S    R+  KNVAAVMVTA LPP+A PG RIDV ++S+GDA SL GG L++T L+G 
Sbjct: 71  MGVSVDPRRMTVKNVAAVMVTAKLPPYAKPGMRIDVEVSSIGDAKSLEGGTLLLTPLVGP 130

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQL 192
           DG IYA+AQG VVVSG   +G ++  ++ + T G+I NGAIVER L    +D  ++ L L
Sbjct: 131 DGQIYALAQGQVVVSGYEARGAAARQVQNVPTVGRIPNGAIVERGLSYP-QDVREINLYL 189

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVET 252
            N  FS A +I D IN+    RF   +A+A D+ TV++  P  +D+   +++VE L ++ 
Sbjct: 190 DNASFSLAKKIQDIINA----RFQAQVAQAVDASTVRLKIPEGMDMVSFLAQVEDLDIDV 245

Query: 253 DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNN 312
              A+V+I+ R+GT+++G +V I+ V V+ G LTV + E  +VVQP    S G TV    
Sbjct: 246 PAVAKVVIDSRSGTVLLGGDVTIAPVSVTVGTLTVTVKEAPEVVQPPPL-SRGETVVVPR 304

Query: 313 TDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           T+LKV + +     +    ++ L+  +N IG     II+ILQ +KAAGAL++++ +
Sbjct: 305 TELKVEEKERRIMELRGATVSQLVESLNRIGATPREIIAILQAMKAAGALRAKLEV 360


>gi|121607557|ref|YP_995364.1| flagellar basal body P-ring protein [Verminephrobacter eiseniae
           EF01-2]
 gi|121552197|gb|ABM56346.1| flagellar P-ring protein [Verminephrobacter eiseniae EF01-2]
          Length = 385

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 143/357 (40%), Positives = 216/357 (60%), Gaps = 11/357 (3%)

Query: 18  ISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIST 77
           +      RIK+V ++Q  R NQL GYGLVVGL GTGD     P+T Q++ + LQ +G+S 
Sbjct: 33  VGPAQALRIKEVAAVQGVRSNQLTGYGLVVGLDGTGDQTTQMPYTTQALSNYLQQMGLSL 92

Query: 78  PGG---RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
           P G   +L  KNVAAV+VTA LP FA PG  +DV+++S+G+A SL+GG LV T L GADG
Sbjct: 93  PPGAASQLQPKNVAAVIVTAQLPAFAQPGQTMDVNVSSVGNARSLKGGTLVATPLRGADG 152

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRN 194
            IYA+AQG+VVV G       S       + G+I  GA VE+ +P    +   + LQL +
Sbjct: 153 EIYALAQGNVVVGGAGAAAGGSKVQINHLSAGRIPLGAQVEQAVPTPLNEGQSIRLQLNS 212

Query: 195 PDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVETD 253
            DF TA R+A  IN+    +  + +A A D RTV+V  P + D     ++++E L +E+ 
Sbjct: 213 MDFQTARRVAQAINA----KLGQGLATALDGRTVQVQAPIDPDARVGFIADLEELPLESS 268

Query: 254 TP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNN 312
            P A+V+IN RTG++V+  +V +    +++GNL++ I++   + QPN  SS G TV    
Sbjct: 269 APAAKVVINARTGSVVLNQSVTLGPCAIAHGNLSITISQTPVISQPNPLSS-GQTVLAQK 327

Query: 313 TDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +D+ +    G+   +  +P L  ++  +N++G     ++SILQ I+AAGAL +E+ +
Sbjct: 328 SDISIRQEAGNVIQVPASPRLADVVKALNALGATPGDLLSILQAIQAAGALNAELEV 384


>gi|33596143|ref|NP_883786.1| flagellar basal body P-ring protein [Bordetella parapertussis
           12822]
 gi|33601545|ref|NP_889105.1| flagellar basal body P-ring protein [Bordetella bronchiseptica
           RB50]
 gi|33573146|emb|CAE36794.1| flagellar P-ring protein precursor [Bordetella parapertussis]
 gi|33575981|emb|CAE33060.1| flagellar P-ring protein precursor [Bordetella bronchiseptica RB50]
          Length = 377

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 147/349 (42%), Positives = 212/349 (60%), Gaps = 8/349 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRL 82
            R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R +PFT+QS+ ++L  LGI+ P G  +
Sbjct: 32  ERLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTPFTQQSLTNMLSQLGITVPQGSNM 91

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAVMVTA LP FA PG  +DV ++S+G+A SLRGG L+MT L GAD  +YA+AQG
Sbjct: 92  QLKNVAAVMVTATLPSFARPGQTVDVVVSSMGNAKSLRGGTLLMTPLKGADNQVYAIAQG 151

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++V G       SS       GG+I NGAIVER +P  +     + L++ N DF T   
Sbjct: 152 NLLVGGAGASAGGSSVQINQLNGGRISNGAIVERAVPTMYAQDGTVYLEMNNTDFGTTQN 211

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTV-ETDTPARVII 260
            A  IN     +F    A A D R ++V  P +   +   MS+VE L V      A+VII
Sbjct: 212 AAAAIN----RQFGAGTAMALDGRVIQVRGPLDPSMMPAFMSQVENLQVARAPATAKVII 267

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG++V+   V I +  V++GNL+V I    QV QP+   + G TV   NT ++V  +
Sbjct: 268 NARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVFQPDTPFTEGQTVVVPNTQIEVRQD 327

Query: 321 KGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G+   +  + +L  ++  +N++G     +++ILQ +K AGAL++++ I
Sbjct: 328 GGALQRVTTSANLADVVKALNALGATPQDLLAILQAMKTAGALRADLEI 376


>gi|206558972|ref|YP_002229732.1| flagellar basal body P-ring protein [Burkholderia cenocepacia
           J2315]
 gi|198035009|emb|CAR50881.1| flagellar P-ring protein precursor (basal body P-ring protein)
           [Burkholderia cenocepacia J2315]
          Length = 398

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 145/363 (39%), Positives = 208/363 (57%), Gaps = 19/363 (5%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
                R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   
Sbjct: 40  PAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINN 99

Query: 80  ----------GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSL 129
                       +  KNVAAVMVTA LPPFA PG  +DV+++SLG+A SLRGG L++T L
Sbjct: 100 GSANGGPSSLNNMQLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSLRGGTLLLTPL 159

Query: 130 LGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-L 188
            GADG +YA+AQG++ V G       S         G+IV GAIVER +P         L
Sbjct: 160 KGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERAVPNAIAQMNGVL 219

Query: 189 ILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEM 247
            LQL + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ 
Sbjct: 220 QLQLNDMDYGTAQRIVSAVNS----SFGPGTATALDGRTIQLAAPADSAQQVAFMARLQN 275

Query: 248 LTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
           L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG 
Sbjct: 276 LDVSPDKAAAKVILNARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPF-SNGQ 334

Query: 307 TVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSE 365
           TV    + +++  + G+  ++    +L  ++  +N++G     ++SILQ +KAAGAL+++
Sbjct: 335 TVVAQQSQIQLKQDNGALKMVTAGANLADVVKALNTLGATPADLMSILQAMKAAGALRAD 394

Query: 366 III 368
           + I
Sbjct: 395 LEI 397


>gi|120597309|ref|YP_961883.1| flagellar basal body P-ring protein [Shewanella sp. W3-18-1]
 gi|120557402|gb|ABM23329.1| flagellar P-ring protein [Shewanella sp. W3-18-1]
          Length = 372

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 143/376 (38%), Positives = 212/376 (56%), Gaps = 14/376 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSR-IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           + R   L+  + G  +   Q  SR + D+V +Q  RDNQL+GYGLVVGL GTGD      
Sbjct: 1   MLRCLLLLLLVSGTLQAQEQSQSRYLMDIVDVQGLRDNQLVGYGLVVGLSGTGDRS-QVK 59

Query: 61  FTEQSMRSLLQNLGISTPG-GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L+  G+          KNVAAV V A +   ASPG  +DV+++SLGDA SL
Sbjct: 60  FTSQSVVNMLKQFGVQIDDKTDPKLKNVAAVAVHATITSLASPGQSLDVTVSSLGDAKSL 119

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           +GG L+MT L   DG IYAVAQG++VV G+   G   SS    + T G I NGA++E  +
Sbjct: 120 QGGTLLMTPLRAVDGEIYAVAQGNLVVGGISAAGRNGSSVTVNVPTVGTIPNGALLEAPI 179

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NID 237
              F D+ D+IL L++P+F TA  I   +N      F   +A A D   V +  P  N +
Sbjct: 180 KSNFSDNEDIILNLKDPNFKTARNIERAVNEL----FGPDVARAQDHAKVLIHAPKSNRE 235

Query: 238 LTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               MS +E L ++      R++ N RTGT+V+G +V   K  VS+GNLTV I E + V 
Sbjct: 236 RVTFMSMLEELKIDQGRRSPRIVFNSRTGTVVMGGDVVARKAAVSHGNLTVTIVERQNVS 295

Query: 297 QPNAF---SSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISI 352
           QPN     ++ G TV  N++ + V   NK  F   +   +  ++  +NS+G     +++I
Sbjct: 296 QPNGAYLGNAAGETVVTNDSQVLVEQGNKRMFVWPEGTSIEEIVRAVNSLGATPMDLMAI 355

Query: 353 LQGIKAAGALQSEIII 368
           L+ +  AG+L++++++
Sbjct: 356 LEALSEAGSLEADLVV 371


>gi|300696917|ref|YP_003747578.1| FlgI: flagellar P-ring protein ; signal peptide [Ralstonia
           solanacearum CFBP2957]
 gi|299073641|emb|CBJ53161.1| FlgI: Flagellar P-ring protein ; signal peptide [Ralstonia
           solanacearum CFBP2957]
          Length = 368

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 137/372 (36%), Positives = 200/372 (53%), Gaps = 9/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M          L     +      RIKD+ ++   R+N LIGYGLVVGL G+GD    +P
Sbjct: 1   MTLYRFIGSALLAWSALVGTAHADRIKDLTTVAGVRENALIGYGLVVGLDGSGDQTTQTP 60

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS  ++L   GI+ P G  +  KN AAV+VTA+LP F  PG  IDV+++S+G+A SL
Sbjct: 61  FTIQSFNNMLSQFGINVPAGSSIQLKNTAAVVVTASLPAFVRPGQTIDVTVSSIGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L++T L G DG +YA+AQG+VV+ G       S         G+I NGA VER + 
Sbjct: 121 RGGTLLLTPLKGVDGQLYALAQGNVVIGGAGASANGSKVQINQLGAGRIANGATVERTVQ 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
               +   + L     DF T   I + IN     +F    AEA D RT+ V  P    D 
Sbjct: 181 ASVGEGGGIQLDTGTTDFGTVQNIVNAINK----QFGADTAEAADGRTINVRAPALASDR 236

Query: 239 TRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +++++ + V      ARV++N RTG++V+   V++    V++GNL+V I+    V Q
Sbjct: 237 VGFLAKLQNIDVTPAQAAARVVVNARTGSVVMNQQVKLEPCAVAHGNLSVTISTEPVVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P  F S G TV    ++++V    GS   +     L  ++  +N+IG     +ISILQ +
Sbjct: 297 PAPF-SQGQTVAGARSNIEVKQQGGSLINVKGGTSLADVVKAINAIGANPQDLISILQAM 355

Query: 357 KAAGALQSEIII 368
           KAA AL++++ I
Sbjct: 356 KAANALRADLEI 367


>gi|89056667|ref|YP_512118.1| flagellar basal body P-ring protein [Jannaschia sp. CCS1]
 gi|88866216|gb|ABD57093.1| flagellar P-ring protein FlgI [Jannaschia sp. CCS1]
          Length = 367

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 153/372 (41%), Positives = 224/372 (60%), Gaps = 9/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + RI             +     RIKD+V     R N L+GYGL+VGL GTGD LR++PF
Sbjct: 1   MIRIFSFFLVACIFATAAVATPIRIKDLVEFDGVRGNDLVGYGLIVGLNGTGDGLRNAPF 60

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           TE+ M ++L+ LG++  G +   +NVAAV+VTA LPPF+  G +ID++++++GDA SL G
Sbjct: 61  TEEIMVNVLERLGVNVTGEQFRPQNVAAVIVTATLPPFSRQGGQIDITVSAIGDAESLLG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G LVMT L  ADG IYAVAQG+V+  G    G  +  ++G+ T G I  GA VERE+   
Sbjct: 121 GTLVMTPLTAADGEIYAVAQGAVIAGGASAGGDGAEIIQGVPTAGVIPAGARVEREVEFD 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTV--KVSKPTNIDLT 239
           F   + + L LR PDF+TA RI   IN+     F R +A   DS TV   +S        
Sbjct: 181 FASMSQIRLALRTPDFTTAARIEVAINT----EFGRGVASMLDSGTVLLDISATRAPSPA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             ++ VE + V  +T ARV++++R+GTIV+G++VRIS+V V+ GNLT++I E    VQPN
Sbjct: 237 HALTRVENILVVPETRARVVVDQRSGTIVMGEDVRISRVAVAQGNLTLRIQEEPIAVQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
            F + G TV    T+  +++  G+    L     L+ ++  +N++G+    +I IL  I+
Sbjct: 297 PF-AEGETVILPRTNAGLAEEAGTGLAELSGGTSLSEVVGALNALGVSPRDMIDILSSIE 355

Query: 358 AAGALQSEIIIQ 369
           AAGAL +E I++
Sbjct: 356 AAGALHAEFIVR 367


>gi|188592121|ref|YP_001796719.1| flagellar basal body p-ring protein [Cupriavidus taiwanensis LMG
           19424]
 gi|170938495|emb|CAP63482.1| FlgI: Flagellar P-ring protein ; signal peptide [Cupriavidus
           taiwanensis LMG 19424]
          Length = 381

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 139/372 (37%), Positives = 210/372 (56%), Gaps = 9/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +   +  L   +      +     R+K++ + Q  RDN L+GYGLVVGL  TGD    +P
Sbjct: 14  LRLTMVSLALGVAFGAFATGAKAERLKNLATFQGVRDNPLVGYGLVVGLDNTGDQTMQTP 73

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LP FA PGS++DV ++S+G+A SL
Sbjct: 74  FTTQSLTNMLSQLGITLPAGKNMQLKNVAAVMVTATLPAFAQPGSQLDVVVSSMGNAKSL 133

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L GADG +YA+AQG+++V G       S         G+I NGAIVER + 
Sbjct: 134 RGGTLLMTPLKGADGQVYAIAQGNMLVGGAGASANGSKVQINQLAVGRIANGAIVERAVA 193

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
               D   L L+L++ DF TA R+ + IN          +A A D R V+V  P +    
Sbjct: 194 PFQPDGGVLNLELKDTDFGTAERVVEAIN----RNMGGGVAAALDGRVVQVRAPASPAAR 249

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              ++ +E + V      A+VI+N RTG+IV+   V +    V++GNL+V I     + Q
Sbjct: 250 VGFLARIENIDVTPAKAAAKVILNARTGSIVMNQAVTVEDCAVAHGNLSVVINTQPVISQ 309

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQGI 356
           P  F S+G TV    + + +    GS  ++     L +++ G+N++G     + +IL+ +
Sbjct: 310 PAPF-SDGQTVVAPVSQIDMRQQGGSLQIVKAGASLAAVVKGLNALGATPADLQTILEAM 368

Query: 357 KAAGALQSEIII 368
           +AAGAL++E+ +
Sbjct: 369 RAAGALRAELEV 380


>gi|330501141|ref|YP_004378010.1| flagellar basal body P-ring protein [Pseudomonas mendocina NK-01]
 gi|328915427|gb|AEB56258.1| flagellar basal body P-ring protein [Pseudomonas mendocina NK-01]
          Length = 364

 Score =  359 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 154/364 (42%), Positives = 213/364 (58%), Gaps = 11/364 (3%)

Query: 10  FSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSL 69
              + L    +     + D+V ++  R NQLIGYGLVVGL GTGD      FT QS+ ++
Sbjct: 6   LVALLLGWPLSTKAVPLMDLVDIEGIRGNQLIGYGLVVGLDGTGDK-NQVRFTSQSVANM 64

Query: 70  LQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTS 128
           ++  GI+ P       KNVAAV VTA +PP  SPG  +DV++ SLGDA SLRGG L+MT 
Sbjct: 65  IKQFGINLPPNVDPKLKNVAAVTVTAEIPPSYSPGQSVDVTVASLGDAKSLRGGQLLMTP 124

Query: 129 LLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKDSAD 187
           L G DG  YA+AQG+VVV GL   GQ  SS     +  G++ NGA VER +P  F    +
Sbjct: 125 LQGVDGETYALAQGAVVVGGLNATGQSGSSVAINSANSGRVPNGATVERMIPSDFSTRDE 184

Query: 188 LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVE 246
           ++L LR P F TA ++ + +N     RF    A A +S  + +  P T+      M+ +E
Sbjct: 185 VMLNLRQPSFQTAAKVVEAVN----GRFGSGTASALNSTKIAIRAPITSTQRIGFMAMLE 240

Query: 247 MLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
            L VE      +V+ N RTGT+V+G  VR+    V++G LTV I+EN QV QPNAF S G
Sbjct: 241 GLEVEEGRERPKVVFNSRTGTVVVGQGVRVKAAAVAHGTLTVTISENPQVSQPNAF-SGG 299

Query: 306 STVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
            T     +D+ VS +K   F   D   L+S+I+ +NS+G   D ++SILQ ++ AGAL +
Sbjct: 300 QTAVVPRSDVAVSQDKNAMFKWPDGASLDSIINTVNSLGATPDDVMSILQALEQAGALNA 359

Query: 365 EIII 368
           E+I+
Sbjct: 360 ELIV 363


>gi|310816849|ref|YP_003964813.1| flagellar P-ring protein [Ketogulonicigenium vulgare Y25]
 gi|308755584|gb|ADO43513.1| flagellar P-ring protein [Ketogulonicigenium vulgare Y25]
          Length = 369

 Score =  359 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 158/359 (44%), Positives = 228/359 (63%), Gaps = 10/359 (2%)

Query: 15  LHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLG 74
           +        +R+KD+V     R N L+GYGLVVGL GTGD +R++PFTE+ M ++L+ LG
Sbjct: 15  VTVPLQAAPTRLKDLVEFDGVRGNDLVGYGLVVGLNGTGDGIRNAPFTEEIMANVLERLG 74

Query: 75  ISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
           ++  G +   +NVAAVMVTA LPPFA  GS +DV+++++GDASSL GG LVMT L  ADG
Sbjct: 75  VNITGEQFRPRNVAAVMVTARLPPFARAGSPMDVTVSAIGDASSLLGGTLVMTPLNAADG 134

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRN 194
            IYAVAQG+++  G   + Q++   +G+ T G I  GA +ERE+   F+  +++ L LR 
Sbjct: 135 EIYAVAQGTIIAGGFSAEAQAARVTQGVPTAGVIPAGATIEREVDFDFRTLSNVRLALRT 194

Query: 195 PDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNIDLTRLMSEVEMLTVET 252
           PDF+TA RI   +N      F R +A   D+ TV VS            MS++E + VE 
Sbjct: 195 PDFTTAARIETAVNQ----TFGRAVAVMQDAGTVIVSIAQTQASSPAHAMSQIENILVEP 250

Query: 253 DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNN 312
           +  ARV++++R+GTIVIG++VRIS+V VS G LTV++ E+  VVQPN F SNG TV    
Sbjct: 251 EIRARVVVDQRSGTIVIGEDVRISRVAVSQGRLTVRVEESPMVVQPNPF-SNGETVVVPQ 309

Query: 313 TDLKVSDN---KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +   +S +    G   +     L+ L++GMN++G+    +I IL+ I+AAGAL +E I+
Sbjct: 310 STAALSVDPGTGGMAEVNTGTSLSELVAGMNALGVAPHDMIDILKSIRAAGALHAEFIV 368


>gi|167561209|ref|ZP_02354125.1| flagellar basal body P-ring protein [Burkholderia oklahomensis
           EO147]
          Length = 398

 Score =  359 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 148/369 (40%), Positives = 209/369 (56%), Gaps = 19/369 (5%)

Query: 14  GLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNL 73
            +    A    R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NL
Sbjct: 34  FVLAPVAAHAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANL 93

Query: 74  GISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           GIS   G           +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG 
Sbjct: 94  GISINNGSANGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGT 153

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L++T L GADG +YA+AQG++ V G       S         G+I  GAIVER +P    
Sbjct: 154 LLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAIA 213

Query: 184 DSAD-LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRL 241
                L LQL + D+ TA RI   +NS     F    A A D RT++++ P +       
Sbjct: 214 QMNGVLQLQLNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAF 269

Query: 242 MSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  
Sbjct: 270 MARLQNLEVSPDKAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGP 329

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           F SNG TV    + +++  + G+   +    +L  ++  +NS+G     ++SILQ +KAA
Sbjct: 330 F-SNGQTVVAQQSQIQLKQDNGALRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAA 388

Query: 360 GALQSEIII 368
           GAL++++ I
Sbjct: 389 GALRADLEI 397


>gi|83747650|ref|ZP_00944686.1| FlgI [Ralstonia solanacearum UW551]
 gi|207739733|ref|YP_002258126.1| flagellar p-ring protein precursor (basal body p-ring protein
           [Ralstonia solanacearum IPO1609]
 gi|83725702|gb|EAP72844.1| FlgI [Ralstonia solanacearum UW551]
 gi|206593115|emb|CAQ60021.1| flagellar p-ring protein precursor (basal body p-ring protein)
           [Ralstonia solanacearum IPO1609]
          Length = 368

 Score =  359 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 137/372 (36%), Positives = 200/372 (53%), Gaps = 9/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M          L     +      RIKD+ ++   R+N LIGYGLVVGL G+GD    +P
Sbjct: 1   MTLYRFIGSALLAWSVLVGTAHADRIKDLTTVAGVRENALIGYGLVVGLDGSGDQTTQTP 60

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS  ++L   GI+ P G  +  KN AAV+VTA+LP F  PG  IDV+++S+G+A SL
Sbjct: 61  FTIQSFNNMLSQFGINVPAGSSIQLKNTAAVVVTASLPAFVRPGQTIDVTVSSIGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L++T L G DG +YA+AQG+VV+ G       S         G+I NGA VER + 
Sbjct: 121 RGGTLLLTPLKGVDGQLYALAQGNVVIGGAGASANGSKVQINQLGAGRIANGATVERTVQ 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
               +   + L     DF T   I + IN     +F    AEA D RT+ V  P    D 
Sbjct: 181 ASVGEGGGIQLDTGTTDFGTVQNIVNAINK----QFGADTAEAADGRTINVRAPALASDR 236

Query: 239 TRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +++++ + V      ARV++N RTG++V+   V++    V++GNL+V I+    V Q
Sbjct: 237 VGFLAKLQNIDVTPAQAAARVVVNARTGSVVMNQQVKLEPCAVAHGNLSVTISTEPVVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P  F S G TV    ++++V    GS   +     L  ++  +N+IG     +ISILQ +
Sbjct: 297 PAPF-SQGQTVAGARSNIEVKQQGGSLINVKGGTSLADVVKAINAIGANPQDLISILQAM 355

Query: 357 KAAGALQSEIII 368
           KAA AL++++ I
Sbjct: 356 KAANALRADLEI 367


>gi|207728350|ref|YP_002256744.1| flagellar p-ring protein precursor [Ralstonia solanacearum MolK2]
 gi|206591596|emb|CAQ57208.1| flagellar p-ring protein precursor (basal body p-ring protein)
           [Ralstonia solanacearum MolK2]
          Length = 368

 Score =  359 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 137/372 (36%), Positives = 200/372 (53%), Gaps = 9/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M          L     +      RIKD+ ++   R+N LIGYGLVVGL G+GD    +P
Sbjct: 1   MTLYRFIGSALLAWSALVGTAHADRIKDLTTVAGVRENALIGYGLVVGLDGSGDQTTQTP 60

Query: 61  FTEQSMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS  ++L   GI+ P G  +  KN AAV+VTA+LP F  PG  IDV+++S+G+A SL
Sbjct: 61  FTIQSFNNMLSQFGINVPAGSSIQLKNTAAVVVTASLPAFVRPGQTIDVTVSSIGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L++T L G DG +YA+AQG+VV+ G       S         G+I NGA VER + 
Sbjct: 121 RGGTLLLTPLKGVDGQLYALAQGNVVIGGAGASANGSKVQINQLGAGRIANGATVERTVQ 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
               +   + L     DF T   I + IN     +F    AEA D RT+ V  P    D 
Sbjct: 181 ASVGEGGGIQLDTGTTDFGTVQNIVNAINK----QFGADTAEAADGRTINVRAPALASDR 236

Query: 239 TRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              +++++ + V      ARV++N RTG++V+   V++    V++GNL+V I+    V Q
Sbjct: 237 VGFLAKLQNIEVTPAQAAARVVVNARTGSVVMNQQVKLEPCAVAHGNLSVTISTEPVVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           P  F S G TV    ++++V    GS   +     L  ++  +N+IG     +ISILQ +
Sbjct: 297 PAPF-SQGQTVAGARSNIEVKQQGGSLINVKGGTSLADMVKAINAIGANPQDLISILQAM 355

Query: 357 KAAGALQSEIII 368
           KAA AL++++ I
Sbjct: 356 KAANALRADLEI 367


>gi|90112110|sp|Q7WJD1|FLGI_BORBR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|90112111|sp|Q7WA91|FLGI_BORPA RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 368

 Score =  359 bits (922), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 147/349 (42%), Positives = 212/349 (60%), Gaps = 8/349 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP-GGRL 82
            R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R +PFT+QS+ ++L  LGI+ P G  +
Sbjct: 23  ERLKDLASIQGVRGNQLIGYGLVVGLDGSGDQVRQTPFTQQSLTNMLSQLGITVPQGSNM 82

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVAAVMVTA LP FA PG  +DV ++S+G+A SLRGG L+MT L GAD  +YA+AQG
Sbjct: 83  QLKNVAAVMVTATLPSFARPGQTVDVVVSSMGNAKSLRGGTLLMTPLKGADNQVYAIAQG 142

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +++V G       SS       GG+I NGAIVER +P  +     + L++ N DF T   
Sbjct: 143 NLLVGGAGASAGGSSVQINQLNGGRISNGAIVERAVPTMYAQDGTVYLEMNNTDFGTTQN 202

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTV-ETDTPARVII 260
            A  IN     +F    A A D R ++V  P +   +   MS+VE L V      A+VII
Sbjct: 203 AAAAIN----RQFGAGTAMALDGRVIQVRGPLDPSMMPAFMSQVENLQVARAPATAKVII 258

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG++V+   V I +  V++GNL+V I    QV QP+   + G TV   NT ++V  +
Sbjct: 259 NARTGSVVMNRTVMIEEAAVAHGNLSVIINRQNQVFQPDTPFTEGQTVVVPNTQIEVRQD 318

Query: 321 KGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G+   +  + +L  ++  +N++G     +++ILQ +K AGAL++++ I
Sbjct: 319 GGALQRVTTSANLADVVKALNALGATPQDLLAILQAMKTAGALRADLEI 367


>gi|224370757|ref|YP_002604921.1| FlgI [Desulfobacterium autotrophicum HRM2]
 gi|223693474|gb|ACN16757.1| FlgI [Desulfobacterium autotrophicum HRM2]
          Length = 378

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 151/366 (41%), Positives = 224/366 (61%), Gaps = 10/366 (2%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
               + +    I     +RIKD+ +++  R NQL GYGL+VGL GTGD    + FT Q++
Sbjct: 18  IFFLTFVLFSGIKTAQGARIKDLAAIKGIRSNQLTGYGLIVGLDGTGDKS-GADFTTQAL 76

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
            +++  +GI      L  KN+AAV+VTA++P FA  G++IDV  +S+GDA SL GG L++
Sbjct: 77  ANMMDRMGIHVDKDELSVKNIAAVIVTADIPAFARIGNKIDVVASSIGDAKSLSGGTLLL 136

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L G DG +YA+AQG V + G+   G   S  +      +I NGA VERE+P       
Sbjct: 137 TPLKGVDGQVYALAQGPVTLGGVGAGGARGSTQKNHLQVARIANGASVEREIPVVLDGKK 196

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID---LTRLMS 243
            LIL L NPDF+TA R+AD IN+         +AEA DS  ++++ P N+    +   ++
Sbjct: 197 ALILSLFNPDFTTAKRVADTINASI----GDGVAEAVDSSALRLNIPENMQESKVAEFLA 252

Query: 244 EVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           ++E L++  DT A+V++NE+TGT+VIG+NV IS V V++GNLTV I ++ +V QP +F +
Sbjct: 253 DIETLSIVPDTRAKVVVNEKTGTVVIGENVTISTVAVAHGNLTVTIKKSSEVSQPESF-T 311

Query: 304 NGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G T+T +  D+ V +       L     +  L+ G+NSIG+    +I+ILQ IKAAGAL
Sbjct: 312 QGETITTSQRDVAVDEEAVKVMPLPGGATIGELVKGLNSIGVSPRDLITILQSIKAAGAL 371

Query: 363 QSEIII 368
           Q+E+ I
Sbjct: 372 QAELEI 377


>gi|325295402|ref|YP_004281916.1| Flagellar P-ring protein [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065850|gb|ADY73857.1| Flagellar P-ring protein [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 365

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 146/347 (42%), Positives = 204/347 (58%), Gaps = 8/347 (2%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLG 83
            +I   V++   R N L GYG+VVGL GTGD   S  FT QS+ ++L+ +GI      + 
Sbjct: 24  VKIGTEVNIVGVRPNYLTGYGIVVGLDGTGDGTTSI-FTLQSIANMLKKMGIYVDPKAVK 82

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
           +KN AAV+VTA LPPFA PG   DV + SLGDA SL  GIL+ T LLG DG IYA AQG 
Sbjct: 83  TKNAAAVIVTAKLPPFAKPGMTFDVEVASLGDAKSLANGILIRTPLLGPDGKIYAFAQGP 142

Query: 144 VVV-SGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           V    G     +     +  ST G I NG IVERELP +  +  +LIL L++PDFS A  
Sbjct: 143 VSTGGGFTESNKGGKIKKNFSTTGMIPNGGIVERELPFELSNEKNLILTLKHPDFSRANN 202

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINE 262
           IA  IN+Y    F + +A+A DS TV V    N +  + +SE+  L + T++   ++I E
Sbjct: 203 IAFAINNY----FGKNLAKAEDSSTVIVKYLPNYNKVKFISEILNLKINTESEPTIVIYE 258

Query: 263 RTGTIVIGDNVRIS-KVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
           RTGT+++  +++I   V VS+GN+ V +T+   + QP    SNG+TV   N    V +  
Sbjct: 259 RTGTVIMSGDIKIEPPVYVSHGNIYVSVTKTPVISQPPPL-SNGTTVQTENVTTTVKEEH 317

Query: 322 GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           G    I +P L  L+  +N +G+    +I+I+Q +KAAG L ++III
Sbjct: 318 GRIFSITSPSLRDLVKALNDLGVSPGDLIAIIQAMKAAGKLHAKIII 364


>gi|253688968|ref|YP_003018158.1| flagellar P-ring protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259645997|sp|C6D995|FLGI_PECCP RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|251755546|gb|ACT13622.1| flagellar P-ring protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 369

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 149/372 (40%), Positives = 218/372 (58%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M     F +   +    I+     RI+D+V++Q  R N LIGYGLVVGL G+GD    +P
Sbjct: 1   MRIASFFTVLLTLLTLNIAPASAERIRDLVNIQGVRGNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  IDV ++SLG+A SL
Sbjct: 61  FTTQSLTNMLSQLGITVPAGTNMQLKNVAAVMVTAELPPFGRAGQNIDVVVSSLGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA++ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISNGAVIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDL 238
             F  S  ++LQL+N DFS A +++D IN           A   DSRT++V  P  N   
Sbjct: 181 STFGASNTIMLQLKNDDFSMAQKVSDAINRSGY----GGTATPLDSRTIQVLAPHGNSSQ 236

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++V+ + V      A+V+IN RTG++V+  +V +    ++ GNL+V I +   V Q
Sbjct: 237 VRFLADVQNIEVNVGIQDAKVVINSRTGSVVMNRDVTLDSCAIAQGNLSVTINQQANVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PN     G TV    T++ V    G+   +  + +LN+++  +NS+G     ++SILQ +
Sbjct: 297 PNTPFGGGQTVVTPQTEISVQQAGGALQRVNSSANLNNVVRALNSLGATPMELMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 QSAGCLRAKLEI 368


>gi|85859199|ref|YP_461401.1| flagellar basal body P-ring protein [Syntrophus aciditrophicus SB]
 gi|85722290|gb|ABC77233.1| flagellar basal-body P-ring protein [Syntrophus aciditrophicus SB]
          Length = 403

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 154/393 (39%), Positives = 230/393 (58%), Gaps = 29/393 (7%)

Query: 1   MIFRIAFL--IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS 58
           M+ +  FL  I  L  +  +S    +R+KD+ S+   R+NQLIGYGLVVGL GTGD +++
Sbjct: 14  MLLKKIFLTGIIVLDLVFFVSYGFAARLKDIASISGVRENQLIGYGLVVGLAGTGDDVKN 73

Query: 59  SPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
             FT +S+ +LL   GIS     L + N+AAVMVT++LP FA  G+RID +++S+GDA S
Sbjct: 74  -GFTSESLSNLLNRQGISMKNKTLKADNIAAVMVTSSLPAFAKIGARIDATVSSIGDAKS 132

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           L GG L+MT L G DG IYAVAQG V + G  V G +SS  +  ++ G++ +G +VEREL
Sbjct: 133 LHGGTLLMTPLRGVDGEIYAVAQGPVTLGGYAVGGANSSTGKNHASAGRVSSGVLVEREL 192

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNI 236
              F       L L  PDF+T+  +AD +N           A+  DS +V V     T  
Sbjct: 193 KYDFDRLRSFTLNLLQPDFTTSACLADVMNKTLGQHVE---AKQVDSFSVDVRMKEATGG 249

Query: 237 DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
           +L  ++S +E L V  D+ + V++NE+TGT+V+G+NVRIS V V++GNL++QI E+ +V 
Sbjct: 250 NLMNIISMMENLDVPVDSKSVVVMNEKTGTVVMGENVRISTVAVAHGNLSIQIKEDIRVS 309

Query: 297 QPNAF--------------------SSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSL 335
           QP  F                    +  G TV   +T + + + K    +I     +  +
Sbjct: 310 QPLPFSPLSSKGNQPAMDKKTGTIVAPGGQTVVTLDTTVGIEEEKKQVMVISKGVTIQEV 369

Query: 336 ISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +  +N++G+    +I+I+Q IKAAGALQ+E+ I
Sbjct: 370 VKALNALGVSPRDLITIMQTIKAAGALQAELKI 402


>gi|50120643|ref|YP_049810.1| flagellar basal body P-ring protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|62286800|sp|Q6D6H2|FLGI_ERWCT RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|49611169|emb|CAG74615.1| flagellar P-ring protein precursor [Pectobacterium atrosepticum
           SCRI1043]
          Length = 369

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 148/372 (39%), Positives = 217/372 (58%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M     F +   +    I+     RI+D+V++Q  R N LIGYGLVVGL G+GD    +P
Sbjct: 1   MRIASFFTVLLTLLTLNITPASAERIRDLVNIQGVRGNALIGYGLVVGLDGSGDQTMQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPF   G  ID+ ++SLG+A SL
Sbjct: 61  FTTQSLTNMLSQLGITVPAGTNMQLKNVAAVMVTAELPPFGRTGQNIDIVVSSLGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG+V+V G       SS       GG+I NGA++ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYALAQGNVLVGGAGASAGGSSVQVNQLAGGRISNGAVIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDL 238
             F  S  ++LQL+N DFS A +++D IN           A   DSRT++V  P  N   
Sbjct: 181 STFGTSNTIMLQLKNDDFSMAQKVSDAINRSGY----GGTASPLDSRTIQVLAPHGNSSQ 236

Query: 239 TRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++V+ + V      A+V+IN RTG++V+  +V +    ++ GNL+V I +   V Q
Sbjct: 237 VRFLADVQNIEVNVGIQDAKVVINSRTGSVVMNRDVTLDSCAIAQGNLSVTINQQANVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PN     G TV    T++ V    G    +  + +LN+++  +NS+G     ++SILQ +
Sbjct: 297 PNTPFGGGQTVVTPQTEISVQQTGGVLQRVNSSANLNNVVRALNSLGATPMELMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 QSAGCLRAKLEI 368


>gi|116626487|ref|YP_828643.1| flagellar basal body P-ring protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229649|gb|ABJ88358.1| flagellar P-ring protein [Candidatus Solibacter usitatus Ellin6076]
          Length = 367

 Score =  358 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 156/370 (42%), Positives = 216/370 (58%), Gaps = 6/370 (1%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M      L   L+ L        +R+KD+V+++  RDNQLIGYGLVVGL GTGD  R + 
Sbjct: 1   MKMLRHTLAILLLLLLPAWPARAARLKDLVAIEGVRDNQLIGYGLVVGLAGTGDR-RQAL 59

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           F+ QS+ ++L+ LG+S P   +   N AAVMVTA LP FA PG  ID++  ++GDAS+L+
Sbjct: 60  FSAQSLTNMLERLGVSVPPAAIRVNNTAAVMVTATLPAFAQPGMHIDITAAAIGDASNLQ 119

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GGILV+TSL GADG +YA+AQG V+  G       SS      T G+   G  VER  P 
Sbjct: 120 GGILVLTSLRGADGLVYAIAQGPVMTGGFSAGRGGSSQTVNHPTVGRAPAGGTVERVAPS 179

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DL 238
                + + LQ+R+ DF+TA RI   +N        +P+A A +S  V V+ PT     +
Sbjct: 180 -LAPKSAIRLQIRHSDFTTASRIVAALNQRFTGD--KPVARAENSGLVTVTVPTGYTARV 236

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           T  ++E+E L VE D PARV+INERTGTIVIG +VRI+ V + +GNL+V+I    QV QP
Sbjct: 237 TDFIAELESLDVEADRPARVVINERTGTIVIGKDVRIAPVAILHGNLSVEIQTTMQVTQP 296

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
           NA     + V    T     +   S  L     +  L+  + +IG     +I+ILQ +++
Sbjct: 297 NALGQGTTEVVPQTTMTAKEEKARSVLLKQGATVEELVRALAAIGSTPRDVIAILQNLRS 356

Query: 359 AGALQSEIII 368
           AGAL +EI +
Sbjct: 357 AGALDAEIEV 366


>gi|74317648|ref|YP_315388.1| flagellar basal body P-ring protein [Thiobacillus denitrificans
           ATCC 25259]
 gi|124021075|sp|Q3SIE5|FLGI_THIDA RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|74057143|gb|AAZ97583.1| flagellar P-ring protein precursor FlgI [Thiobacillus denitrificans
           ATCC 25259]
          Length = 365

 Score =  358 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 148/364 (40%), Positives = 208/364 (57%), Gaps = 9/364 (2%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
            F L  L    A    RIKD+ ++Q  R NQL GYGLVVGL GTGD    +PFT QS+ +
Sbjct: 6   FFVLAALVLSGAAHAERIKDIAAIQGVRANQLFGYGLVVGLDGTGDQTTQTPFTTQSIAN 65

Query: 69  LLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           +L  +G++ P G  +  KNVAAVMVTA+LPPFA  G  IDV+++S+G+A SLRGG LVM 
Sbjct: 66  MLTQMGVNLPPGINMQLKNVAAVMVTADLPPFAQAGQAIDVTVSSIGNAKSLRGGTLVMA 125

Query: 128 SLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD 187
            L GADG +YA+AQGS+VVSG       S       + G+I  GA VER +     +S  
Sbjct: 126 PLKGADGLVYAMAQGSLVVSGAGASANGSKVQVNHLSVGRIPAGATVERTVATALGESGS 185

Query: 188 LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVE 246
           + L+LR  DF+TA R+ D +N+    RF    A A ++R V V  P    +    +  +E
Sbjct: 186 INLELRQSDFTTASRVVDVVNA----RFGADTARALNARVVAVKTPLGASERVAFLGAIE 241

Query: 247 MLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
            L V      A+VIIN RTG++V+   V +    VS+GNL+V I+    + QP  F   G
Sbjct: 242 GLEVSPGQAMAKVIINARTGSVVMNQTVTLDPSAVSHGNLSVVISTAPVISQPAPF-GRG 300

Query: 306 STVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
            TV    + +++    G    L     L  ++  +NSIG     +++ILQ +KA+GAL++
Sbjct: 301 ETVVAAESQIEIRQQPGEVMMLKGGASLADVVKALNSIGATPQDLLAILQALKASGALRA 360

Query: 365 EIII 368
           E+ +
Sbjct: 361 ELEV 364


>gi|83944169|ref|ZP_00956625.1| flagellar P-ring protein precursor [Sulfitobacter sp. EE-36]
 gi|83845036|gb|EAP82917.1| flagellar P-ring protein precursor [Sulfitobacter sp. EE-36]
          Length = 393

 Score =  358 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 159/371 (42%), Positives = 225/371 (60%), Gaps = 20/371 (5%)

Query: 14  GLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNL 73
            +  + +    RIKD+   +  R+N LIGYGLVVGL GTGD L SSPFT +S+R +L+ L
Sbjct: 26  VVPAMPSWAEVRIKDIAHFEGVRENHLIGYGLVVGLLGTGDKLNSSPFTRESIRGMLERL 85

Query: 74  GI-STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
           G+ +  G  L +KN AAVMVTA LPPFA  GS ID++++SLGDA+SLRGG L++T L GA
Sbjct: 86  GVANLDGEALKTKNTAAVMVTAKLPPFARRGSPIDITVSSLGDATSLRGGTLLITPLTGA 145

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQL 192
           DG +YAV QG+V  SG  V G ++S ++G+ T  +I NGAIVERE+         + + L
Sbjct: 146 DGEVYAVGQGAVAASGYRVDGNAASVVDGVPTIARIENGAIVEREIEFSLFQLDSIRIAL 205

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVET 252
            NPDF+TA R+ + I             E  DS T++V      +    +  VE L V  
Sbjct: 206 NNPDFTTADRVREAI----AKHLGSSQVEVLDSGTIEVWVGDKRNAPETIMAVENLLVTP 261

Query: 253 DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN------------- 299
           D  ARV+I+E++GTIV+G +VRI++V +S G LTV++ EN  V QP              
Sbjct: 262 DAVARVVIDEKSGTIVMGSDVRIAQVAISQGGLTVRVRENFGVSQPGPISLGGNTAVISE 321

Query: 300 -AFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIK 357
              S  G+TV    T++ + +  GSF++++    L  L+ G+N+IG+     I+ILQ IK
Sbjct: 322 EPISIGGTTVIVPETEIDIEETDGSFTILNGDVSLQELVDGLNAIGVGARQTIAILQAIK 381

Query: 358 AAGALQSEIII 368
           AAGAL +++ I
Sbjct: 382 AAGALHADLEI 392


>gi|149908755|ref|ZP_01897416.1| flagellar P-ring protein precursor [Moritella sp. PE36]
 gi|149808297|gb|EDM68236.1| flagellar P-ring protein precursor [Moritella sp. PE36]
          Length = 370

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 142/371 (38%), Positives = 211/371 (56%), Gaps = 9/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +  ++ L+ S +    +SA     + D+  +Q  R NQLIGYGLVVGL G+GD      F
Sbjct: 4   LILLSVLLCSTLLSVGVSAAYQRMLLDITDIQGLRKNQLIGYGLVVGLDGSGDKS-QVKF 62

Query: 62  TEQSMRSLLQNLGIST-PGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QSM ++LQ  G+     G    KNVAAVM+TA + P A  G  I+++++S+GDA SLR
Sbjct: 63  TTQSMINMLQQFGVKLGDKGNPKLKNVAAVMITAEVAPQAGKGQTINITVSSIGDAKSLR 122

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFV-KGQSSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L G DG IYA AQG++VV G+    G  SS      T G I NG  VE+E+ 
Sbjct: 123 GGTLLLTPLRGMDGEIYATAQGNLVVGGIKATGGSGSSVTVNTPTVGIIPNGGTVEKEIQ 182

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DL 238
             F  + +++L L+ P+F TA  I   IN+     F   +A+A     V V+ P +    
Sbjct: 183 TNFISAKEVVLNLKTPNFKTARNIELAINAI----FGDGVAQAKGQHRVTVAAPVDARQR 238

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              MS +E + +E      R++ N RTGT+V+G NV++ K  VS+GNLTV I E   V Q
Sbjct: 239 VTFMSMLEEIEIELGRVKPRIVFNSRTGTVVMGANVKVRKAAVSHGNLTVTINERSNVSQ 298

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           PNAFS+  + +T  ++      +   F + +   L  ++  +NS+G   D ++SILQ + 
Sbjct: 299 PNAFSNGNTAITPESSIYIQKGDNPMFIVPEGTSLEVIVRAINSLGASPDDLMSILQALD 358

Query: 358 AAGALQSEIII 368
            AGAL++E+++
Sbjct: 359 QAGALEAELVV 369


>gi|148554185|ref|YP_001261767.1| flagellar basal body P-ring protein [Sphingomonas wittichii RW1]
 gi|166988333|sp|A5V5R3|FLGI_SPHWW RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|148499375|gb|ABQ67629.1| flagellar P-ring protein [Sphingomonas wittichii RW1]
          Length = 367

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 146/373 (39%), Positives = 211/373 (56%), Gaps = 12/373 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M   +   +F   GL    A    RIKD+ S    R NQL GYG+VVGL GTGD   S  
Sbjct: 1   MFRALITALFCFSGLALAGAGHAERIKDIGSFAGLRANQLTGYGIVVGLAGTGD--DSLD 58

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           ++   M+ +    G+  P G     KN AAVM+TA LP FA PG R+D++I++LG A SL
Sbjct: 59  YSTLGMKGVASRFGLQLPAGVNPALKNAAAVMITAELPAFAKPGQRLDITISALGKAKSL 118

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG L+M  L+GADG IYA+AQG++ V GL +     S     + T G+I  GA VER +
Sbjct: 119 RGGTLIMAPLMGADGQIYAMAQGNLAVGGLGIDAADGSKLTINVPTAGRIPGGATVERSV 178

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID- 237
              F  +  L   L   D +T+ R+A  IN     R  +PIA + D+ T+ +  P   + 
Sbjct: 179 DAGFATTPQLRFDLSEGDLTTSQRVAAAIN----GRLGQPIARSIDATTITIDAPQGAEV 234

Query: 238 LTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
            T LMS +E L V+T + PARV++N RTGT+VI   VRI+ V V++G +TVQ+ E  Q++
Sbjct: 235 RTALMSRIENLEVDTAEAPARVVVNARTGTVVINGAVRIAPVAVTHGKMTVQVDEKPQII 294

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP  F S G T  Q ++ + V       F       L  ++  +N+IG     +++IL+ 
Sbjct: 295 QPQPF-SRGQTAVQQSSAINVEQEARPMFEFNPGASLADIVKAVNAIGASPADLVAILEA 353

Query: 356 IKAAGALQSEIII 368
           +K AGA+++E+++
Sbjct: 354 LKQAGAMKAELVV 366


>gi|197105398|ref|YP_002130775.1| flagellar P-ring protein [Phenylobacterium zucineum HLK1]
 gi|196478818|gb|ACG78346.1| flagellar P-ring protein [Phenylobacterium zucineum HLK1]
          Length = 371

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 163/351 (46%), Positives = 230/351 (65%), Gaps = 9/351 (2%)

Query: 21  QVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG 80
              SRIKD+V  +  R+N L+GYG+VVGL GTGD+LR++PFT+QS+ ++L+ LG++T   
Sbjct: 26  SAKSRIKDIVEFEGVRENMLVGYGIVVGLNGTGDALRNAPFTKQSLEAMLERLGVNTRDA 85

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
           +L +KNVAAVMVTA LPPFA+PGS+IDVS+++LGDA SL+GG L++T LLGADG  YAVA
Sbjct: 86  QLNTKNVAAVMVTAKLPPFAAPGSQIDVSVSALGDAKSLQGGSLLVTPLLGADGRAYAVA 145

Query: 141 QGSVVV-SGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           QG+V   +        SS  +G+ T G+I  GA VE E   +  +   + L LRNPDF+T
Sbjct: 146 QGTVQTGAISASGASGSSISKGVPTAGRIAGGASVELETGFQLANMGQMRLTLRNPDFTT 205

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVI 259
           A RIAD +N+          A A +   V +  P + DL   M++VE L VE D PA+V+
Sbjct: 206 ARRIADAVNARF-----PGSAVAENPTIVSLR-PASGDLISFMAQVENLAVEPDAPAKVV 259

Query: 260 INERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSD 319
           I+E  G IV+G+ VR+S V +  GNLT+ + E   V QP  F+  G T     TD++V +
Sbjct: 260 IDEVAGVIVMGEAVRVSTVAIQQGNLTITVREQPGVSQPAPFARTGETAVVPQTDIEVDE 319

Query: 320 NKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            +G    ++     L +L+SG+N++G+    +ISILQ I+AAGALQ+EI +
Sbjct: 320 ERGRQFLTVGSGASLATLVSGLNALGVTPRDMISILQTIRAAGALQAEIEV 370


>gi|241765795|ref|ZP_04763736.1| flagellar P-ring protein [Acidovorax delafieldii 2AN]
 gi|241364306|gb|EER59456.1| flagellar P-ring protein [Acidovorax delafieldii 2AN]
          Length = 383

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 146/349 (41%), Positives = 204/349 (58%), Gaps = 10/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR--L 82
           RIK+V ++Q  R NQL GYGLVVGL GTGD     PFT Q+M + LQ +GIS P G    
Sbjct: 39  RIKEVAAVQGVRSNQLSGYGLVVGLDGTGDQSTQMPFTAQAMANYLQQMGISLPPGTAAP 98

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVA V+VTA LP FA PG  IDV+++S+G+A SLRGG L+ T L GADG IYA+AQG
Sbjct: 99  QLKNVATVVVTAQLPAFAQPGQMIDVAVSSMGNAKSLRGGTLIATPLRGADGEIYALAQG 158

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           +VVV G       S         G+I  GA VER +P    D   + L L   DF TA +
Sbjct: 159 NVVVGGAGASAGGSKVQINHLNAGRIPEGAQVERSVPTPLHDGDTITLGLNAMDFQTARK 218

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-ARVII 260
           +A  IN+    R  +  A A D RTV+V+ P +       ++E+E L +   TP A+V+I
Sbjct: 219 VAQAINA----RQGQGTATALDGRTVQVAAPQDPGRRVNFIAELEELQLPDSTPAAKVVI 274

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG+IV+   V +    +++GNL++ I+    + QPN   S G TV    +D+ +   
Sbjct: 275 NARTGSIVLNQAVTLGPCAIAHGNLSITISSTPIISQPNPL-SRGVTVVAQKSDIAIQQE 333

Query: 321 KGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G+   +  +P L  ++  +N++G     +++ILQ IKAAGAL +E+ +
Sbjct: 334 AGNVIQMPPSPQLADVVRALNTLGATPQDLLAILQAIKAAGALNAELEV 382


>gi|167568427|ref|ZP_02361301.1| flagellar basal body P-ring protein [Burkholderia oklahomensis
           C6786]
          Length = 398

 Score =  358 bits (919), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 147/369 (39%), Positives = 209/369 (56%), Gaps = 19/369 (5%)

Query: 14  GLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNL 73
            +    A    R+K++  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NL
Sbjct: 34  FVLAPVAAHAERLKELAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANL 93

Query: 74  GISTPGG----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           GIS   G           +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG 
Sbjct: 94  GISINNGSANGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGT 153

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L++T L GADG +YA+AQG++ V G       S         G+I  GAIVER +P    
Sbjct: 154 LLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAIA 213

Query: 184 DSAD-LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRL 241
                L LQL + D+ TA RI   +NS     F    A A D RT++++ P +       
Sbjct: 214 QMNGVLQLQLNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAF 269

Query: 242 MSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           M+ ++ L V  D   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  
Sbjct: 270 MARLQNLEVSPDKAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGP 329

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           F SNG TV    + +++  + G+   +    +L  ++  +NS+G     ++SILQ +KAA
Sbjct: 330 F-SNGQTVVAQQSQIQLKQDNGALRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAA 388

Query: 360 GALQSEIII 368
           GAL++++ I
Sbjct: 389 GALRADLEI 397


>gi|295111395|emb|CBL28145.1| Flagellar basal-body P-ring protein [Synergistetes bacterium SGP1]
          Length = 380

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 150/354 (42%), Positives = 215/354 (60%), Gaps = 12/354 (3%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
                   RIKD+  ++  RDNQL G GLV GL+GTGD   +S  T   MR++++N G++
Sbjct: 34  FTKLHPRVRIKDIADIEGARDNQLTGVGLVTGLRGTGD---NSAMTTHMMRNMMRNFGVT 90

Query: 77  TPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNI 136
                + ++NVA V +TA LPP+A PG RIDVS+N++G+A SL+GG L+   L  ADGN+
Sbjct: 91  LAPNEVKTRNVAVVSLTATLPPYARPGQRIDVSVNAIGNAQSLQGGTLIQAPLHAADGNV 150

Query: 137 YAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPD 196
           YAVAQGSV+V G    G S+S  + + T G++ +GAIVER++P  F     + L LR+PD
Sbjct: 151 YAVAQGSVLVGGWAADGSSASTTKNVPTVGRVPSGAIVERDVPSDFTLGGQMALLLRDPD 210

Query: 197 FSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVEMLTVETDT 254
           F+TA R+AD IN          IA   D+  V V+ P       T  ++ VE L +  D 
Sbjct: 211 FTTAQRVADAINQKFGA-----IASPVDAGRVAVNLPGQYLAAPTAFLANVERLEITPDM 265

Query: 255 PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTD 314
            ARV +NERTGT+V+G NVRIS V V++GNLTV + ++  VVQP AF S G T  +  TD
Sbjct: 266 VARVAVNERTGTVVMGGNVRISSVAVAHGNLTVSVKDDPNVVQPEAF-SGGETRVEIRTD 324

Query: 315 LKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEII 367
           + V+++     ++     +  ++  +N+IG     II+ILQ I  AGAL  +++
Sbjct: 325 ITVNEDGASMIAMPATTTVRDMVRVLNAIGATPRDIITILQAIDKAGALHGQLV 378


>gi|322432972|ref|YP_004210221.1| flagellar P-ring protein [Acidobacterium sp. MP5ACTX9]
 gi|321165199|gb|ADW70903.1| flagellar P-ring protein [Acidobacterium sp. MP5ACTX9]
          Length = 382

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 145/377 (38%), Positives = 222/377 (58%), Gaps = 14/377 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSR------IKDVVSLQSGRDNQLIGYGLVVGLQGTGD 54
           +I     L   L+ L      + ++      ++D+  ++  RDNQL+GYGLVVGL+GTGD
Sbjct: 10  LIRITHVLFLGLLALSFAPLALATQPERQVLLRDITDIEGVRDNQLVGYGLVVGLRGTGD 69

Query: 55  SLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLG 114
             + + FT Q++ + ++ +G+    G++  KNVAAV +T +LPPFA PGS++D++++S G
Sbjct: 70  R-QQTYFTVQTLANAMKRMGVQIAPGQVVVKNVAAVFITGSLPPFARPGSKLDITVSSAG 128

Query: 115 DASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIV 174
           DA SL GG+L+MTSL G DG +YA AQG + + G               T G+I  GAIV
Sbjct: 129 DAKSLEGGVLLMTSLRGPDGQVYAEAQGPLALGGYSEGTAGQLHSVNHPTVGRIPEGAIV 188

Query: 175 ERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT 234
           ER+          + L LRNPDF+ A  +A+ IN      F   +A   DSRTV++    
Sbjct: 189 ERDANVDLSHFHTVSLMLRNPDFTAARDMAEAINK----DFQHTVATPIDSRTVQIDVAG 244

Query: 235 NI--DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
                +  L+S V+ L++   +PA+V INERTGTIV+G +V +S V V +G+L++++   
Sbjct: 245 AGASSVPILISRVQSLSIPFHSPAKVTINERTGTIVMGGSVTLSPVSVLHGSLSIEVETT 304

Query: 293 EQVVQPNAFSSNGSTVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIIS 351
             V QP  FSS G+T    NT L V D    S  L +  +++ LI G+++IG  +  I++
Sbjct: 305 YTVSQPLPFSSGGTTQPVANTVLAVKDLPAQSIRLENGANVDDLIRGLHAIGATSHDIVA 364

Query: 352 ILQGIKAAGALQSEIII 368
           ILQ IK+AG LQ+++ +
Sbjct: 365 ILQAIKSAGGLQADLEV 381


>gi|270486641|ref|ZP_06203715.1| flagellar P-ring protein FlgI [Yersinia pestis KIM D27]
 gi|270335145|gb|EFA45922.1| flagellar P-ring protein FlgI [Yersinia pestis KIM D27]
          Length = 359

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 142/362 (39%), Positives = 212/362 (58%), Gaps = 8/362 (2%)

Query: 11  SLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLL 70
            ++           RI+D+V++Q  RDN LIGYGLVVGL G+GD    +PFT QS+ ++L
Sbjct: 1   MVLLSLVWLPASAERIRDLVTVQGVRDNALIGYGLVVGLDGSGDQTMQTPFTTQSLSNML 60

Query: 71  QNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSL 129
             LGI+ P G  +  KNVAAVMVTA LP F+  G  IDV ++S+G+A S+RGG L+MT L
Sbjct: 61  SQLGITVPPGTNMQLKNVAAVMVTAKLPAFSRAGQTIDVVVSSMGNAKSIRGGTLLMTPL 120

Query: 130 LGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLI 189
            G D  +YA+AQG+V+V G       SS       GG+I NGA +ERELP  F     + 
Sbjct: 121 KGVDNQVYALAQGNVLVGGAGAAAGGSSVQVNQLAGGRISNGATIERELPTTFGTDGIIN 180

Query: 190 LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEML 248
           LQL + DF+ A +++D IN           A A D+RT++V  P       R +++++ +
Sbjct: 181 LQLNSEDFTLAQQVSDAINRQR----GFGSATAIDARTIQVLVPRGGSSQVRFLADIQNI 236

Query: 249 TVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGST 307
            +  D   A+VIIN RTG++V+  NV +    V+ GNL+V + +   V QP+     G T
Sbjct: 237 PINVDPGDAKVIINSRTGSVVMNRNVVLDSCAVAQGNLSVVVDKQNIVSQPDTPFGGGQT 296

Query: 308 VTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEI 366
           V   NT + V    G    +  +P+LN+++  +NS+G     ++SILQ +++AG L++++
Sbjct: 297 VVTPNTQISVQQQGGVLQRVNASPNLNNVVRALNSLGATPIDLMSILQAMESAGCLRAKL 356

Query: 367 II 368
            I
Sbjct: 357 EI 358


>gi|126176152|ref|YP_001052301.1| flagellar basal body P-ring protein [Shewanella baltica OS155]
 gi|304412504|ref|ZP_07394110.1| flagellar P-ring protein [Shewanella baltica OS183]
 gi|307307163|ref|ZP_07586901.1| flagellar P-ring protein [Shewanella baltica BA175]
 gi|125999357|gb|ABN63432.1| flagellar P-ring protein [Shewanella baltica OS155]
 gi|304349146|gb|EFM13558.1| flagellar P-ring protein [Shewanella baltica OS183]
 gi|306910402|gb|EFN40833.1| flagellar P-ring protein [Shewanella baltica BA175]
          Length = 370

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 143/364 (39%), Positives = 208/364 (57%), Gaps = 14/364 (3%)

Query: 14  GLHEISAQVVSR-IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQN 72
               + A+  SR + DVV +Q  RDNQL+GYGLVVGL GTGD      FT QS+ ++L+ 
Sbjct: 11  ATGTLQAEEQSRYLMDVVDVQGLRDNQLVGYGLVVGLNGTGDRS-QVKFTSQSVVNMLKQ 69

Query: 73  LGISTPG-GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLG 131
            G+          KNVAAV V A +   ASPG  +DV+++SLGDA SL+GG L+MT L  
Sbjct: 70  FGVQIDDKTDPKLKNVAAVAVHATITSLASPGQSLDVTVSSLGDAKSLQGGTLLMTPLRA 129

Query: 132 ADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLIL 190
            DG +YAVAQG++VV G+   G   SS    + T G I NGA++E  +   F D+ D+IL
Sbjct: 130 VDGEVYAVAQGNLVVGGISAAGRNGSSVTVNVPTVGTIPNGALLEASIKSNFSDNEDIIL 189

Query: 191 QLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVEMLT 249
            L++P+F TA  I   +N      F   IA A D   V V  P  N +    MS +E L 
Sbjct: 190 NLKDPNFKTARNIERAVNEL----FGPDIARAQDHAKVLVHAPKSNRERVTFMSMLEELK 245

Query: 250 VETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF---SSNG 305
           ++      R++ N RTGT+V+G +V + K  VS+GNLTV I E E V QPN     ++ G
Sbjct: 246 IDQGRRSPRIVFNSRTGTVVLGGDVVVRKAAVSHGNLTVTIVERENVSQPNGAYLGNAAG 305

Query: 306 STVTQNNTDLKVSD-NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
            TV  N++ + V   NK  F   +   +  ++  +NS+G     +++IL+ +  AG+L++
Sbjct: 306 ETVVTNDSQVLVEQGNKRMFVWPEGTSIEEIVRAVNSLGATPMDLMAILEALSEAGSLEA 365

Query: 365 EIII 368
           ++++
Sbjct: 366 DLVV 369


>gi|304321123|ref|YP_003854766.1| flagellar P-ring protein precursor [Parvularcula bermudensis
           HTCC2503]
 gi|303300025|gb|ADM09624.1| flagellar P-ring protein precursor [Parvularcula bermudensis
           HTCC2503]
          Length = 367

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 151/372 (40%), Positives = 223/372 (59%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVS-RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           M  +      + + L           ++D+V ++  R N LIGYGLVVGL GTGD++R+S
Sbjct: 1   MKLKSLLASATALTLMMTGVASAEVALRDLVDVEGVRGNDLIGYGLVVGLNGTGDTVRNS 60

Query: 60  PFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           P+TE+++ SLLQ LG++         NVAAVMVTA LP FA  GS IDV+++S+GDA  L
Sbjct: 61  PYTEEALASLLQRLGVNVQDEDFRPDNVAAVMVTAELPAFARTGSEIDVTVSSIGDADDL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
            GG LVMT L  A+G++YAVAQG V+VSG   +G+++S  +G  T G I  GA VERE+ 
Sbjct: 121 TGGTLVMTPLTAANGDVYAVAQGPVLVSGFQAEGEAASITQGTPTAGTIPAGARVEREVD 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLT 239
             F     + L L+ PDF+TA RI D +N+    R     A   D  TV+++ P+  +  
Sbjct: 181 FAFGRMQTINLALKTPDFTTAARIEDALNA----RLGAGAATITDPGTVQLTLPSGRNPA 236

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
           R++SE+E + +    PARV+I++R+GTIV+G  VR+S V ++ GNL++ I E     QPN
Sbjct: 237 RVLSEIEQMAIRPSAPARVVIDQRSGTIVLGSAVRLSSVGIAQGNLSIAIAETPVASQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSD--NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
           AF   G T     T + V++        + +   L  L+S +N++G+     I IL+ +K
Sbjct: 297 AF-GEGETAILPRTTINVNEGATGNVALIEETVSLADLVSALNALGVTPRETIDILKSLK 355

Query: 358 AAGALQSEIIIQ 369
            AGAL +E+++Q
Sbjct: 356 VAGALHAELMLQ 367


>gi|144899355|emb|CAM76219.1| Flagellar P-ring protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 419

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 163/376 (43%), Positives = 238/376 (63%), Gaps = 19/376 (5%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L+   I      A   SRIKD+   +  RDN L+GYGLVVGL GTGD L ++PFT++S+ 
Sbjct: 47  LVAVTILAMPPVAYGASRIKDIADYEGVRDNLLVGYGLVVGLAGTGDDLTNAPFTKESLV 106

Query: 68  SLLQNLGISTPG-----GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
           ++L+ LG++          +  KNVAAVMVTA LP F+  G+R+DVS+ ++GDA SL GG
Sbjct: 107 AMLERLGVNIREQGGTIATVKPKNVAAVMVTATLPAFSRQGTRLDVSVAAMGDAKSLEGG 166

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGL------FVKGQSSSFMEGISTGGKIVNGAIVER 176
            L++T L+GADG IYAVAQG +   G          G ++S  +GI T GKI NGAI+ER
Sbjct: 167 TLLVTPLVGADGEIYAVAQGGLAGVGFTASGGGAGGGGTTSVRKGIPTTGKIANGAIIER 226

Query: 177 ELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI 236
           ELP +      + L LRNPDF+TA R A  +N++        +A   D  TV++  P + 
Sbjct: 227 ELPFEMAHLESVKLSLRNPDFTTANRTAQAVNAF----LGSTVARPTDPSTVQIVVPPDY 282

Query: 237 --DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQ 294
             ++  L++++E L VE D  A+++I++ TGTIV+G+NVRIS V V+ G LTV+ITE  Q
Sbjct: 283 RGNVVGLLTDIEQLKVEPDQVAKIVIDDATGTIVMGENVRISTVAVAQGQLTVRITETPQ 342

Query: 295 VVQPNAFSSNGSTVTQNNTDLKVSDNKGS--FSLIDAPDLNSLISGMNSIGLKTDGIISI 352
           V QP+ FS+ G+T   + TD++V + +G     +     L  L++G+N++G+    +I+I
Sbjct: 343 VSQPSPFSTTGTTTVVDRTDIEVDEGQGKKLMVVPHGVTLQDLVTGLNALGISPRDLIAI 402

Query: 353 LQGIKAAGALQSEIII 368
           LQ IKAAGA+Q++I +
Sbjct: 403 LQTIKAAGAIQADIEV 418


>gi|188025867|ref|ZP_02960114.2| hypothetical protein PROSTU_02022 [Providencia stuartii ATCC 25827]
 gi|188020801|gb|EDU58841.1| hypothetical protein PROSTU_02022 [Providencia stuartii ATCC 25827]
          Length = 367

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 145/356 (40%), Positives = 213/356 (59%), Gaps = 8/356 (2%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
             ++    RIKD+ ++Q  RDN LIGYGLVVGL GTGD    +PFT QS+ ++L  +GI+
Sbjct: 15  FATSAYSERIKDLTTVQGVRDNALIGYGLVVGLDGTGDQTMQTPFTTQSLSNMLSQMGIT 74

Query: 77  TPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
            P G  +  KNVAAVMVTA LPPFA  G  +DV ++S+G+A SLRGG L+MT L G DG 
Sbjct: 75  VPPGTNMQLKNVAAVMVTAKLPPFARAGQAVDVVVSSMGNAKSLRGGTLLMTPLKGVDGQ 134

Query: 136 IYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           +YA+AQG+++V G       SS       GG+I  GA +ERELP  F  +  + LQL + 
Sbjct: 135 VYAMAQGNILVGGAGASAGGSSIKVNQLAGGRITGGATIERELPTSFGQNGIINLQLNDD 194

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSEVEMLTV-ETD 253
            F+ A  I+D IN           A   DSRTV++  P  N D  R +++++ L V    
Sbjct: 195 SFTLAQDISDAINRLR----GAGTATPLDSRTVQLRVPMNNSDQVRFLAQIQELNVRTPI 250

Query: 254 TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
             A+VI+N RTG++VI  +V +    V++G+L+V +    QV QPN   + G TV   NT
Sbjct: 251 AEAKVILNSRTGSVVINRSVTLESCAVAHGSLSVMVERQTQVSQPNTPFAGGQTVVTRNT 310

Query: 314 DLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           ++ V +  G+   +  +  LN +I  +N++G     ++SILQ +++AG L++++ I
Sbjct: 311 NIGVREQGGALQKVNASVQLNQVIQALNTLGATPTDLMSILQAMESAGCLRAKLEI 366


>gi|312880332|ref|ZP_07740132.1| flagellar P-ring protein [Aminomonas paucivorans DSM 12260]
 gi|310783623|gb|EFQ24021.1| flagellar P-ring protein [Aminomonas paucivorans DSM 12260]
          Length = 371

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 139/371 (37%), Positives = 209/371 (56%), Gaps = 12/371 (3%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
                    +++     ++ +  R+KDV  L+  R NQL+G GLVVGLQGTGD       
Sbjct: 10  FLLGILSCLAMLLSAGSASALEVRVKDVAVLEGARPNQLVGMGLVVGLQGTGDKG---DM 66

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
             + M ++    G++     + SKNVA V VT  LPPF  PG  +DV +++ GDA SL+G
Sbjct: 67  AMRMMSNMSSRFGLTIDPKLVKSKNVALVSVTCELPPFVVPGQTLDVLVSAAGDAKSLQG 126

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G+L+ T L  A+G +YAVAQGS+ + G    GQ +   + ++T G++  GAIVE+     
Sbjct: 127 GVLLQTPLKAANGKVYAVAQGSLSLGGFSAGGQGAQVSKNVTTVGRVPGGAIVEQGTESS 186

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLT 239
           F     + L LR PDF+TA R+A  IN +        +A   D+  V+V+ P +      
Sbjct: 187 FVPGGRMSLLLRQPDFTTATRVAKAINKHHG-----QVARVVDAGRVEVAVPASYGDSPA 241

Query: 240 RLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
             ++ +E LT+  D+ ARV++NERTGT+V+G NVRI    V++GNLTV+++EN QV QPN
Sbjct: 242 SFVAALEGLTLVPDSVARVVVNERTGTVVMGGNVRIGSAAVAHGNLTVRVSENPQVSQPN 301

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
                G T     TDL+  + +G    L ++  +  L+  +N++G     +I ILQ +  
Sbjct: 302 PL-GQGQTAVVPRTDLQAQEGQGQVVALPESSTVTDLVRALNAVGATPRDLIPILQALDQ 360

Query: 359 AGALQSEIIIQ 369
           AGAL  ++IIQ
Sbjct: 361 AGALHGQLIIQ 371


>gi|254420498|ref|ZP_05034222.1| flagellar P-ring protein FlgI [Brevundimonas sp. BAL3]
 gi|196186675|gb|EDX81651.1| flagellar P-ring protein FlgI [Brevundimonas sp. BAL3]
          Length = 380

 Score =  356 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 160/365 (43%), Positives = 230/365 (63%), Gaps = 9/365 (2%)

Query: 7   FLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSM 66
              F+ +GL    A   SRIKD+ +++  R NQL+GYG+V+GL GTGDSLR+ PFT QS+
Sbjct: 21  LTAFAALGLVASPALAQSRIKDIAAVEGVRGNQLVGYGMVMGLNGTGDSLRNCPFTRQSL 80

Query: 67  RSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
             + + LG++  G    +KN+AAVMV+A LP FA+PGSRIDV+++S+ DA SL GG LV+
Sbjct: 81  EGMTERLGVNIRGANANTKNMAAVMVSAELPAFATPGSRIDVNVSSMCDAKSLLGGALVV 140

Query: 127 TSLLGADGNIYAVAQGSVVV-SGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           TSL GADG +YAVAQGSV   +     G  SS   G+ T G+I +GA VERE   +  + 
Sbjct: 141 TSLQGADGQVYAVAQGSVQTGAVSASGGSGSSVTRGVPTAGRIASGASVERETGFEMSNM 200

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEV 245
            ++ L LRNPDF+TA R+A  +N+          A A +   V +  P  + +   +S V
Sbjct: 201 NEVRLNLRNPDFTTAQRVAAVVNAAY-----PGTALAENGTVVTLRAPGQLGMAGFISRV 255

Query: 246 EMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
           E L V  D+PA+VII+E  G IV+GD VRIS+V ++ GNLT+ + E   V QP  F S G
Sbjct: 256 ENLAVTVDSPAKVIIDEVNGVIVMGDAVRISRVAIAQGNLTISVDEQLSVSQPAPF-SQG 314

Query: 306 STVTQNNTDLKVSDNKG--SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
            T    ++ + V ++ G     +     L++L++G+N++G+    +ISILQ IKA+GALQ
Sbjct: 315 QTAVIPDSQVSVEEDLGTQMRIVGGGTSLSTLVNGLNALGVSPRDMISILQAIKASGALQ 374

Query: 364 SEIII 368
           ++I +
Sbjct: 375 ADIEV 379


>gi|326386934|ref|ZP_08208548.1| flagellar basal body P-ring protein [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208614|gb|EGD59417.1| flagellar basal body P-ring protein [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 378

 Score =  356 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 140/373 (37%), Positives = 204/373 (54%), Gaps = 13/373 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           +   ++ L+   + L         R++D+   Q  R NQL GYG+VVGL GTGD   +  
Sbjct: 13  IRRLVSALVGLALTLALAPPAQADRVRDLGEFQGIRSNQLTGYGIVVGLPGTGD--DNLE 70

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           +  Q+MR +    G+  P G     KN AAV+VTA+LP FA PG RIDV+++++G A SL
Sbjct: 71  YVTQAMRGVSGRFGLQLPPGISPNLKNAAAVLVTADLPAFAKPGQRIDVTVSTIGKAKSL 130

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVEREL 178
           RGG LV+T L GADG IY +AQG++ V GL +     S     + T G+I +GA VER +
Sbjct: 131 RGGALVLTPLYGADGQIYGMAQGNLAVGGLGITAKDGSQLTVNVPTVGRIADGATVERAV 190

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F     L   L   DF TA R+ D IN+          A   D  TV +  P     
Sbjct: 191 DTGFDHGEVLRWNLFQADFQTAARVRDAINARF-----PQTASVEDGVTVALRLPAGADR 245

Query: 238 LTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
              LM+ +EM+ V      A+VI+N RTGT+VI   VR+S   +S+G L V+I E  QV 
Sbjct: 246 RASLMATIEMIDVTPAQAQAKVIVNSRTGTVVINSAVRLSPAAISHGKLVVRIDEKPQVS 305

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPN F SNG TV   ++ +  S++    +       L+SL+  +N +G+    +++IL+ 
Sbjct: 306 QPNGF-SNGRTVVTPSSQISASESTAHVALFKPGASLSSLVDALNKLGVSPSDLVAILEA 364

Query: 356 IKAAGALQSEIII 368
           +K AG+L++E+ +
Sbjct: 365 LKEAGSLKAEMEV 377


>gi|157373203|ref|YP_001471803.1| flagellar basal body P-ring protein [Shewanella sediminis HAW-EB3]
 gi|157315577|gb|ABV34675.1| flagellar P-ring protein [Shewanella sediminis HAW-EB3]
          Length = 375

 Score =  356 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 143/361 (39%), Positives = 207/361 (57%), Gaps = 14/361 (3%)

Query: 17  EISAQVVSR-IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI 75
            +SAQ  +R + D+V +Q  R+NQL+GYGLVVGL GTGD      FT QS+ ++L+  G+
Sbjct: 19  SVSAQSQTRYLMDIVDVQGIRENQLVGYGLVVGLDGTGDRT-QVRFTSQSVVNMLKQFGV 77

Query: 76  STPG-GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
                     KNVAAV V  N+P  ASPG  ID++++SLGDA SLRGG L+MT L   DG
Sbjct: 78  QIDDKTDPKLKNVAAVAVHGNVPALASPGQSIDITVSSLGDAKSLRGGTLLMTPLRAVDG 137

Query: 135 NIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLR 193
            IYAVAQG++VV G+  +G   +S    + T G I NGA++E  +   F +S  ++L LR
Sbjct: 138 EIYAVAQGNLVVGGVSAQGRNGTSVTINVPTVGNIPNGALLEAPMHSNFTESETIVLNLR 197

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTVET 252
            P F TA  I   +N+     F   +A+A  +  V V  P +  +    MS +E L +E 
Sbjct: 198 APSFMTARNIERTVNAL----FGPDVAQADSNAKVTVRAPESKRERVTFMSMLEELQIEQ 253

Query: 253 DTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN---AFSSNGSTV 308
                RV+ N RTGT+V+G +V + K  VS+GNLTV I E E V QPN      + G TV
Sbjct: 254 GRKSPRVVFNSRTGTVVMGGDVVVRKAAVSHGNLTVTIIEKESVSQPNGALWGQAQGETV 313

Query: 309 TQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEII 367
              ++ + +    G  F   +   L  ++  +NS+G     +++ILQ +  AGAL++E++
Sbjct: 314 VTTDSQVDIDTGNGHMFVWPEGIALEEVVRAVNSLGASPMDLMAILQALDEAGALEAELV 373

Query: 368 I 368
           +
Sbjct: 374 V 374


>gi|46578931|ref|YP_009739.1| flagellar basal body P-ring protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603468|ref|YP_967868.1| flagellar basal body P-ring protein [Desulfovibrio vulgaris DP4]
 gi|46448343|gb|AAS94998.1| flagellar P-ring protein FlgI [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563697|gb|ABM29441.1| flagellar P-ring protein [Desulfovibrio vulgaris DP4]
 gi|311232789|gb|ADP85643.1| flagellar P-ring protein [Desulfovibrio vulgaris RCH1]
          Length = 378

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 156/368 (42%), Positives = 234/368 (63%), Gaps = 8/368 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             +A  + +L+ L    +    RIKD+ +    RDNQL+GYGLVVGL GTGD  + S FT
Sbjct: 16  LLLAVALSTLLPLAMPGSAGAVRIKDIATFSGVRDNQLVGYGLVVGLGGTGDK-KESVFT 74

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
             SM ++L+ +G++    +L  KNVA+VMVTA +P  A PG+R+DV+++S+GDA+SL GG
Sbjct: 75  VSSMVNMLERMGVAVDPKQLKPKNVASVMVTARMPVSAKPGARLDVTVSSMGDATSLLGG 134

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
           +L+ T L G DG IY +AQGS+ + G   +GQ++   + I+T G I  GAI+ER +P +F
Sbjct: 135 VLLQTPLKGVDGKIYGLAQGSLALGGFSAEGQAARAQKNITTVGLIPGGAIIERGVPFEF 194

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTR 240
                L L L   DFSTA ++A+++N+    R+    A A D+ TV +  P N   +L  
Sbjct: 195 NQQDRLTLNLSTADFSTAQQVAERLNAAMGGRY----ANAVDASTVAMDVPPNYRGNLVP 250

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           LM+ VE + V  D PARV+++E+TGT+V+G +VRIS+V V++G+L V + E++QV QP  
Sbjct: 251 LMASVENIEVAPDAPARVVVDEKTGTVVLGRDVRISRVAVAHGSLQVTVQESQQVSQPAP 310

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           F S G TV    T++ V +      +I+   L  L+ G+N+IG     +ISIL+ +KAAG
Sbjct: 311 F-SQGQTVVTPQTNVNVREENRRLMMIEGATLQELVDGLNAIGATPRDLISILRAMKAAG 369

Query: 361 ALQSEIII 368
           AL +E+ +
Sbjct: 370 ALHAELEV 377


>gi|108868299|sp|Q2LT20|FLGI_SYNAS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 390

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 154/393 (39%), Positives = 230/393 (58%), Gaps = 29/393 (7%)

Query: 1   MIFRIAFL--IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRS 58
           M+ +  FL  I  L  +  +S    +R+KD+ S+   R+NQLIGYGLVVGL GTGD +++
Sbjct: 1   MLLKKIFLTGIIVLDLVFFVSYGFAARLKDIASISGVRENQLIGYGLVVGLAGTGDDVKN 60

Query: 59  SPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
             FT +S+ +LL   GIS     L + N+AAVMVT++LP FA  G+RID +++S+GDA S
Sbjct: 61  -GFTSESLSNLLNRQGISMKNKTLKADNIAAVMVTSSLPAFAKIGARIDATVSSIGDAKS 119

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVEREL 178
           L GG L+MT L G DG IYAVAQG V + G  V G +SS  +  ++ G++ +G +VEREL
Sbjct: 120 LHGGTLLMTPLRGVDGEIYAVAQGPVTLGGYAVGGANSSTGKNHASAGRVSSGVLVEREL 179

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNI 236
              F       L L  PDF+T+  +AD +N           A+  DS +V V     T  
Sbjct: 180 KYDFDRLRSFTLNLLQPDFTTSACLADVMNKTLGQHVE---AKQVDSFSVDVRMKEATGG 236

Query: 237 DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
           +L  ++S +E L V  D+ + V++NE+TGT+V+G+NVRIS V V++GNL++QI E+ +V 
Sbjct: 237 NLMNIISMMENLDVPVDSKSVVVMNEKTGTVVMGENVRISTVAVAHGNLSIQIKEDIRVS 296

Query: 297 QPNAF--------------------SSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSL 335
           QP  F                    +  G TV   +T + + + K    +I     +  +
Sbjct: 297 QPLPFSPLSSKGNQPAMDKKTGTIVAPGGQTVVTLDTTVGIEEEKKQVMVISKGVTIQEV 356

Query: 336 ISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +  +N++G+    +I+I+Q IKAAGALQ+E+ I
Sbjct: 357 VKALNALGVSPRDLITIMQTIKAAGALQAELKI 389


>gi|54307273|ref|YP_128293.1| flagellar basal body P-ring protein [Photobacterium profundum SS9]
 gi|81615817|sp|Q6LW60|FLGI1_PHOPR RecName: Full=Flagellar P-ring protein 1; AltName: Full=Basal body
           P-ring protein 1; Flags: Precursor
 gi|46911693|emb|CAG18491.1| Hypothetical flagellar P-ring protein [Photobacterium profundum
           SS9]
          Length = 374

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 142/376 (37%), Positives = 213/376 (56%), Gaps = 16/376 (4%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+ +   +   L+ +    +     +  VV +Q  R+NQL+GYGLVVGL GTGD    + 
Sbjct: 6   MVIKKHLI--GLLLILCPLSLQAQPLFSVVDIQGIRENQLVGYGLVVGLSGTGDKS-QTK 62

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS++++L   G+  P       KNVAAV V A LP  AS G  +D++++S+GDA SL
Sbjct: 63  FTSQSVKNMLSQFGVQLPANVNPKLKNVAAVAVNATLPALASKGQSLDITVSSIGDAKSL 122

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVEREL 178
           RGG L++T L GADG IYA+AQG++VV G+  +G   S     I T G I NG I+ERE+
Sbjct: 123 RGGTLLLTPLKGADGQIYAIAQGNLVVGGVVAQGNSGSGITINIPTAGLIPNGGIIEREV 182

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-D 237
              F  ++ ++L L+ P F+TA  I  +IN      F   +A A     + V  P +   
Sbjct: 183 TSSFLTASTVVLNLKKPGFNTARNIEKEINEL----FGPDVALAQSHARIHVRAPHDPSQ 238

Query: 238 LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               ++ +E L +ET   PARV+ N RTGTIV+G NV++    VS+GNLTV + E+  V 
Sbjct: 239 RVTFLAMLENLDIETGPRPARVVFNARTGTIVVGKNVKVHTAAVSHGNLTVSVMESFNVS 298

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSL----IDAPDLNSLISGMNSIGLKTDGIISI 352
           QPNAF   G+T     TD+ +   +G   +     +   L +++  +NS+G   + +++I
Sbjct: 299 QPNAF-GRGNTAVTPETDVSIDQERGKVFIWPDSDEGTSLQTIVDAVNSLGATPNDLMAI 357

Query: 353 LQGIKAAGALQSEIII 368
           L  +  AGAL  E+++
Sbjct: 358 LIALDEAGALDGELVV 373


>gi|327398481|ref|YP_004339350.1| Flagellar P-ring protein [Hippea maritima DSM 10411]
 gi|327181110|gb|AEA33291.1| Flagellar P-ring protein [Hippea maritima DSM 10411]
          Length = 368

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 141/372 (37%), Positives = 211/372 (56%), Gaps = 13/372 (3%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
            R    +  ++ L   +     +I+D+ S+   R NQL+GYG+VVGL GTGD   SS FT
Sbjct: 1   MRKVLTVLFILFLSINTFAFDVKIRDLTSVVGVRYNQLVGYGIVVGLAGTGDGT-SSKFT 59

Query: 63  EQSMRSLLQNLGISTPGGRL---GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
            QS+ + L+  G++     +    +KN+AAVMVTA LPPFA  G RIDV+++S+GDA SL
Sbjct: 60  IQSIVNALKRFGVTLSQSEIGSLQTKNIAAVMVTAQLPPFAKQGERIDVTVSSIGDAKSL 119

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQS-SSFMEGISTGGKIVNGAIVEREL 178
           +GG L+MT L G DGN+YAVAQG + + G        +   +   T G+I NGAIVE ++
Sbjct: 120 QGGTLIMTPLKGPDGNVYAVAQGPISIGGYNAGMGGGTKVRKNHPTVGRIPNGAIVENQV 179

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID- 237
                     IL L  P F  A RIA+ IN +        +A   D  ++KV  P     
Sbjct: 180 NVDINSKQSFILALNQPSFEMATRIANTINKFYRR----QMAFPSDGGSIKVIVPPLYRG 235

Query: 238 -LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
            +  L+S++  L+V+  T  RV+++E+TGT+V+G +V I  + +S+GNLT+ +T  ++V 
Sbjct: 236 AVVELISQINQLSVDQITEPRVVLDEKTGTVVVGGDVTIEPISISHGNLTITVTSTKEVS 295

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPN  +  G T T  N  + V++ KG F        ++ LI  +N  G     +++I Q 
Sbjct: 296 QPNPLAK-GKTTTVTNKQVSVNEGKGKFLTFSKGATVSELIQALNKAGATPRDMMAIFQA 354

Query: 356 IKAAGALQSEII 367
           IKAAGAL +++ 
Sbjct: 355 IKAAGALNAKLE 366


>gi|225850282|ref|YP_002730516.1| flagellar P-ring protein FlgI [Persephonella marina EX-H1]
 gi|225644788|gb|ACO02974.1| flagellar P-ring protein FlgI [Persephonella marina EX-H1]
          Length = 362

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 138/351 (39%), Positives = 204/351 (58%), Gaps = 8/351 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
           A    +I + V +   R N L GYG+VVGL+GTGD    S FT  S+ ++L+ +GI    
Sbjct: 17  AVNRVKIGNEVEVVGVRQNYLTGYGIVVGLKGTGDGTT-SRFTLISIANMLKKMGIYVDP 75

Query: 80  GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
            ++ +KN AAV+VTA++PPFA  G R DV+++SLGDA SL  G+L+ T L+G DG IYA 
Sbjct: 76  RQVRTKNAAAVIVTASMPPFAKNGMRFDVTVSSLGDAKSLENGVLIRTPLMGPDGKIYAF 135

Query: 140 AQGSVV-VSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           AQG V    G     +     +   T G ++NG I+ER+LP  F+   DL L L+ PDF+
Sbjct: 136 AQGPVSLGGGFSESNKGGRVTKNFPTTGVVLNGGIIERDLPFSFESMKDLTLTLKIPDFT 195

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARV 258
            A +I + IN      F + +A+A D+ TVKV  P  ID     S++  L +E+D    V
Sbjct: 196 KATKIQNAIN----RHFGKQLAKAIDATTVKVKFPEGIDPVEFTSQIMNLEIESDNEPTV 251

Query: 259 IINERTGTIVIGDNVRIS-KVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           +I ERTGT+++  +++I   + VS+GN+ V + +   V QP    S G TVT    +  V
Sbjct: 252 VIYERTGTVIMSGDIKIDTPIYVSHGNIYVSVLKTPVVSQPPPL-SGGETVTAEKVETTV 310

Query: 318 SDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            + +G    I +P L  L+  +N +G+    +I+I+Q IK AG L ++III
Sbjct: 311 VEEEGRIFSIQSPSLKDLVQALNDLGVSPRDLIAIIQAIKNAGKLHAKIII 361


>gi|315125988|ref|YP_004067991.1| FlgIL [Pseudoalteromonas sp. SM9913]
 gi|315014502|gb|ADT67840.1| FlgIL [Pseudoalteromonas sp. SM9913]
          Length = 369

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 138/373 (36%), Positives = 220/373 (58%), Gaps = 10/373 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSR-IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSS 59
           M + +  L+     L   +    +R + D+V +   R+NQL+GYGLVVGL G+GD     
Sbjct: 1   MKYLLLMLVCFFSLLAPATVAAKARPLLDIVDVLGVRENQLVGYGLVVGLPGSGDKA-QV 59

Query: 60  PFTEQSMRSLLQNLGISTPGGRL-GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASS 118
            F  QS+ ++L+  G+S    RL  SKN+AAV V A LPP  SPG  IDV++NSLGDA S
Sbjct: 60  KFAGQSLSNMLKQFGVSVDEERLPKSKNIAAVAVHATLPPMGSPGQAIDVTVNSLGDAKS 119

Query: 119 LRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERE 177
           L GG L++T L G DG +YA+AQG++VV G+   G+  SS    + T G I NGAI+ER 
Sbjct: 120 LHGGSLMLTPLKGVDGKVYALAQGNLVVGGINASGKSGSSVTVNVPTSGLIPNGAIIERS 179

Query: 178 LPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID 237
           +   ++  +D+IL L++P++ TA  +   IN      F   +A A +   + VS P++ +
Sbjct: 180 VTAMYESQSDVILNLKDPNYQTARNVVRAINKV----FGPDVATAENWARLVVSAPSDAN 235

Query: 238 -LTRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                MS ++ ++VE  +   +++ N RTGT+V+ D VR+++  V++GNLT+ I+E EQV
Sbjct: 236 SRNTFMSMLQDISVEQGSERPKIVFNSRTGTVVMNDTVRVNQAAVNHGNLTITISEQEQV 295

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
            QP  FS+  +T TQ++        +      +   L+ ++  +N++G     ++SIL  
Sbjct: 296 SQPGPFSNGQTTATQSSDITVDQQQRNMLLWPEGTSLDEIVKAVNALGATPAELMSILIA 355

Query: 356 IKAAGALQSEIII 368
           +  AGAL++E+++
Sbjct: 356 LDNAGALEAELLV 368


>gi|224825781|ref|ZP_03698885.1| flagellar P-ring protein [Lutiella nitroferrum 2002]
 gi|224602005|gb|EEG08184.1| flagellar P-ring protein [Lutiella nitroferrum 2002]
          Length = 368

 Score =  355 bits (911), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 147/369 (39%), Positives = 213/369 (57%), Gaps = 12/369 (3%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           ++ L+  L+            ++++VS++  R+NQLIGYG+VVGL GTGD+     F+ Q
Sbjct: 6   LSRLMLVLVAGLLPLNAGAQLLRNLVSVEGIRENQLIGYGIVVGLDGTGDNS-QVKFSGQ 64

Query: 65  SMRSLLQNLGISTP-GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           S+ +LL+  GI  P G     KNVAAVMV+A+LPP    G  IDV+++SLGDA SLRGG 
Sbjct: 65  SVSNLLKQFGIKQPEGSSTKVKNVAAVMVSASLPPGYRHGQTIDVTVSSLGDAKSLRGGT 124

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKF 182
           L++T L  ADG +YA+AQG++V+ GL  +G+  SS      T G+I NGA +ERE+P  F
Sbjct: 125 LLLTPLRAADGEVYALAQGNLVIGGLSAQGKSGSSVTVNTPTSGRIPNGASIEREIPSDF 184

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRL 241
           +    + L L+ P+F TA  I + IN +        IA   D+ +V+V  P +       
Sbjct: 185 ESGPSVRLSLKRPNFETATNIVNTINQHYGR-----IASTRDATSVEVLAPPDPTARVAF 239

Query: 242 MSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           ++ +E L +       RVI N RTGT+VI   V +    VS+GNL V I E+ QV QPN 
Sbjct: 240 VARLEKLNIGVGEETPRVIFNSRTGTVVISQGVTVRPAAVSHGNLRVVIAESSQVSQPNP 299

Query: 301 FSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAA 359
           F   G+TV    +D+ V  ++G  F       L ++I  +NS G   D I++ILQ +  A
Sbjct: 300 FGK-GNTVVTPQSDVSVQQDQGRMFKWPAGAKLQTIIDTINSTGATPDDIMAILQALDQA 358

Query: 360 GALQSEIII 368
           GAL  E+++
Sbjct: 359 GALDGELVV 367


>gi|34498336|ref|NP_902551.1| flagellar basal body P-ring protein [Chromobacterium violaceum ATCC
           12472]
 gi|81655150|sp|Q7NU22|FLGI2_CHRVO RecName: Full=Flagellar P-ring protein 2; AltName: Full=Basal body
           P-ring protein 2; Flags: Precursor
 gi|34104190|gb|AAQ60549.1| flagellar P-ring protein precursor flgI [Chromobacterium violaceum
           ATCC 12472]
          Length = 365

 Score =  355 bits (911), Expect = 8e-96,   Method: Composition-based stats.
 Identities = 144/348 (41%), Positives = 208/348 (59%), Gaps = 9/348 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG-RLG 83
           R+KD+ ++   R NQLIGYGLVVGL G+GD + SSPFT Q+M ++L  LG+  P G ++ 
Sbjct: 22  RLKDIANIGGVRPNQLIGYGLVVGLDGSGDKVTSSPFTGQAMINMLNQLGVQVPPGTKID 81

Query: 84  SKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGS 143
            KNVAAV +TA LPPF+  G  +DV+ +S+GDA SLRGG L+++ L GADG IYA+AQG+
Sbjct: 82  PKNVAAVTLTATLPPFSKRGQMLDVTASSIGDAKSLRGGTLLLSPLKGADGQIYAMAQGN 141

Query: 144 VVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRI 203
           VVV G       SS      + G+I +GA VERE+     D   + L+L+  DF+TA R 
Sbjct: 142 VVVGGAGASAGGSSTQINQLSVGRIPSGATVEREVQTALGDGEFIHLELQESDFTTANRA 201

Query: 204 ADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVET-DTPARVIIN 261
              IN      F    A A D R ++V  P +     + +S +E + V+  D    VIIN
Sbjct: 202 VQAINKV----FGGDTARAVDGRLIEVRAPFDSNQRVQFLSRMENIAVDPADLSPLVIIN 257

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            RTG+IV+   V +    VS+GNL+V +    QV QPN   S G TV  N  D+ ++   
Sbjct: 258 ARTGSIVMNQAVTLGSCAVSHGNLSVTVNNTPQVSQPNPL-SGGKTVVTNQADITINSTS 316

Query: 322 GSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           G    L    +L+ +++ +N++G     +ISILQ +K+AG+L++++ I
Sbjct: 317 GKVVGLKGGANLSQVVNALNALGATPQDLISILQAMKSAGSLKADLQI 364


>gi|297570288|ref|YP_003691632.1| flagellar P-ring protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296926203|gb|ADH87013.1| flagellar P-ring protein [Desulfurivibrio alkaliphilus AHT2]
          Length = 378

 Score =  355 bits (911), Expect = 8e-96,   Method: Composition-based stats.
 Identities = 132/366 (36%), Positives = 208/366 (56%), Gaps = 18/366 (4%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
             L  + +      A    R+KD+ S+Q  R NQL+GYG+VVGL G+GD  R++ FT Q 
Sbjct: 27  LVLGLACLVFVIADATAAVRLKDLASIQGVRHNQLVGYGIVVGLDGSGDG-RNAAFTIQG 85

Query: 66  MRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           + + ++N+G++     +  +N AAVMVTA LPPFA  G  IDV+++S+GDASSL+GG L+
Sbjct: 86  LANAMRNMGLNINPDDIQVRNAAAVMVTAKLPPFAKSGQNIDVTVSSVGDASSLQGGTLL 145

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           +T L G D  IYA+AQG + + G   +G  +    +   T  +I +GA VERE+P  F  
Sbjct: 146 VTPLKGLDNQIYAIAQGPLSIGGFEPQGPTAPGRQQNHQTVARIPSGASVEREVPVSFAQ 205

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLM 242
             ++++ L +PDF+T  R+   IN    N      A   D  TV V  P N   +   L+
Sbjct: 206 REEIVISLNSPDFTTVQRMTQAIN----NHLGNSAAHPRDGATVVVRVPENYRDNEIFLL 261

Query: 243 SEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFS 302
           +E+E L +  D  ARV+++ERTGT+V+G+NVRI ++ V++G+L +Q+          A +
Sbjct: 262 AELENLQIVPDNRARVVLDERTGTVVMGENVRIRELAVAHGDLNLQV----------APA 311

Query: 303 SNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
                + Q +     ++      L     L  ++  +N++G+    +I+I Q IKA+GAL
Sbjct: 312 LGPEELLQPDAAPMAAEGDQLVRLDPGATLGEVVQALNAVGVAPRDLIAIFQSIKASGAL 371

Query: 363 QSEIII 368
            +E+ I
Sbjct: 372 NAELEI 377


>gi|307546964|ref|YP_003899443.1| flagellar basal body P-ring protein [Halomonas elongata DSM 2581]
 gi|307218988|emb|CBV44258.1| flagellar basal body P-ring protein [Halomonas elongata DSM 2581]
          Length = 374

 Score =  354 bits (910), Expect = 9e-96,   Method: Composition-based stats.
 Identities = 145/353 (41%), Positives = 210/353 (59%), Gaps = 9/353 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
                RI+++ S    RDN L+GYGLVVGL G+GD    +PFT QS+ ++L  LGI+ P 
Sbjct: 26  PAQAERIREIASFAGVRDNALVGYGLVVGLDGSGDRTMQAPFTGQSLTNMLSQLGITVPA 85

Query: 80  G-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           G  +  +NVAAVMVTANLP FA  G R+DV ++S+G+A SLRGG L+MT L GADG  YA
Sbjct: 86  GTNMQLRNVAAVMVTANLPAFARQGQRLDVVVSSVGNADSLRGGTLLMTPLKGADGETYA 145

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF-KDSADLILQLRNPDF 197
           +AQG+V+V G       SS       GG+I NGA VERE+P     +   L LQL   DF
Sbjct: 146 IAQGNVLVGGAGASAGGSSVQVNQQAGGRIANGATVEREVPLVLGSNGGRLELQLDRSDF 205

Query: 198 STAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVET-DTP 255
            T  R+   IN      F   +A A + R + +  P++ +     M+ VE L V   + P
Sbjct: 206 GTVQRVVSAINQ----SFGYSVASAQNGRVISLDGPSDANARVNFMARVENLEVTPTEAP 261

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           ARV++N RTG IV+   V + +  V+ GNL++ I  +  V QPN F+  G TV   +T++
Sbjct: 262 ARVVLNSRTGAIVLNGAVTLRQAAVAQGNLSIVIDSDYGVSQPNPFTK-GETVVVRDTEV 320

Query: 316 KVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            +    G+  +++  DL  ++  +NS+G   + ++SIL+ +KAAG+L++E+ I
Sbjct: 321 SIEQQPGTLKVVEGADLLDVVDALNSLGATPNDLMSILEALKAAGSLRAELEI 373


>gi|254188068|ref|ZP_04894580.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei Pasteur
           52237]
 gi|157935748|gb|EDO91418.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei Pasteur
           52237]
          Length = 400

 Score =  354 bits (910), Expect = 9e-96,   Method: Composition-based stats.
 Identities = 147/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 45  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 104

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 105 GGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 164

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 165 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 224

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 225 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 280

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 281 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 339

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 340 AQQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 399


>gi|83955131|ref|ZP_00963787.1| flagellar P-ring protein FlgI [Sulfitobacter sp. NAS-14.1]
 gi|83840460|gb|EAP79633.1| flagellar P-ring protein FlgI [Sulfitobacter sp. NAS-14.1]
          Length = 385

 Score =  354 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 159/371 (42%), Positives = 225/371 (60%), Gaps = 20/371 (5%)

Query: 14  GLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNL 73
            +  + +    RIKD+   +  R+N LIGYGLVVGL GTGD L SSPFT +S+R +L+ L
Sbjct: 18  VVPAMPSWAEVRIKDIAHFEGVRENHLIGYGLVVGLLGTGDKLNSSPFTRESIRGMLERL 77

Query: 74  GI-STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
           G+ +  G  L +KN AAVMVTA LPPFA  GS ID++++SLGDA+SLRGG L++T L GA
Sbjct: 78  GVANLDGEALKTKNTAAVMVTAKLPPFARRGSPIDITVSSLGDATSLRGGTLLITPLTGA 137

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQL 192
           DG +YAV QG+V  SG  V G ++S ++G+ T  +I NGAIVERE+         + + L
Sbjct: 138 DGEVYAVGQGAVAASGYRVDGNAASVVDGVPTIARIENGAIVEREIEFSLFQLDSIRIAL 197

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVET 252
            NPDF+TA R+ + I             E  DS T++V      +    +  VE L V  
Sbjct: 198 NNPDFTTADRVREAI----AKHLGSSQVEVLDSGTIEVWVGDKRNAPETIMAVENLLVTP 253

Query: 253 DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN------------- 299
           D  ARV+I+E++GTIV+G +VRI++V +S G LTV++ EN  V QP              
Sbjct: 254 DAVARVVIDEKSGTIVMGSDVRIAQVAISQGGLTVRVRENFGVSQPGPISLGGNTAVISE 313

Query: 300 -AFSSNGSTVTQNNTDLKVSDNKGSFSLIDA-PDLNSLISGMNSIGLKTDGIISILQGIK 357
              S  G+TV    T++ + +  GSF++++    L  L+ G+N+IG+     I+ILQ IK
Sbjct: 314 EPISIGGTTVIVPETEIDIEETDGSFTILNGDVSLQELVDGLNAIGVGARQTIAILQAIK 373

Query: 358 AAGALQSEIII 368
           AAGAL +++ I
Sbjct: 374 AAGALHADLEI 384


>gi|114797455|ref|YP_758978.1| flagellar basal body P-ring protein [Hyphomonas neptunium ATCC
           15444]
 gi|114737629|gb|ABI75754.1| flagellar P-ring protein FlgI [Hyphomonas neptunium ATCC 15444]
          Length = 369

 Score =  354 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 149/358 (41%), Positives = 234/358 (65%), Gaps = 8/358 (2%)

Query: 15  LHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLG 74
           +  + A   +RI+DVV +Q  R+N L+GYG+VVGL GTGD++R+SPFTE S+  LL+ LG
Sbjct: 17  VFSLPADAQARIRDVVDVQGVRENDLVGYGIVVGLNGTGDTVRNSPFTEDSLTHLLERLG 76

Query: 75  ISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADG 134
           ++  G ++  KNVAAV+VTA+LPPF+  GS IDV+I S+GDA+SL GG L++T L   D 
Sbjct: 77  VNVQGEQIKPKNVAAVLVTASLPPFSRKGSSIDVNIASIGDATSLEGGTLILTPLKAGDN 136

Query: 135 NIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRN 194
            IYAVAQGS++VSG+ VK Q +    G  T G + NGA VERE+   F  +  + L LR+
Sbjct: 137 EIYAVAQGSIIVSGIDVKAQGARETRGSPTTGSVPNGAKVEREVNYDFNRNELISLALRS 196

Query: 195 PDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK-PTNIDLTRLMSEVEMLTVETD 253
           PDF+TA RI D IN+        P+A   D  T+++     +    RL++ +E L+VE  
Sbjct: 197 PDFTTAARIEDTINAA----LGVPLASMRDPGTIELDLRGISESPARLLASIENLSVEVA 252

Query: 254 TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
           +PAR++I+E++GTIV+G++V IS+V ++ GN+ +++ E     QPN F+  G ++    +
Sbjct: 253 SPARIVIDEKSGTIVLGEDVTISRVAIAQGNIAIKVRETPVASQPNPFAR-GESMVLPRS 311

Query: 314 DLKVSD--NKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIIIQ 369
           ++ ++   N     L     L+ LI+G+N++G+    +  I++ +KAAGA+ ++++I+
Sbjct: 312 EITITQTGNSNIAMLDPNVTLSQLIAGLNALGVSPQEMADIIRSMKAAGAIHADLVIR 369


>gi|85058015|ref|YP_453717.1| flagellar basal body P-ring protein [Sodalis glossinidius str.
           'morsitans']
 gi|124021073|sp|Q2NX13|FLGI_SODGM RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|84778535|dbj|BAE73312.1| flagellar P-ring protein precursor FlgI [Sodalis glossinidius str.
           'morsitans']
          Length = 365

 Score =  354 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 140/368 (38%), Positives = 213/368 (57%), Gaps = 8/368 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +   + ++ GL    +    RI+D+ ++   R+N LIGYGLVVGL GTGD    +PFT Q
Sbjct: 1   MMLSLCAIAGLLLAPSIQAERIRDLTTVLGVRENALIGYGLVVGLDGTGDQTTQTPFTTQ 60

Query: 65  SMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGI 123
           S+R++L  LG++ P G  +  KNVAAVMVTA LP FA  G +IDV ++SLG A SLRGG 
Sbjct: 61  SLRNMLSQLGVAVPTGTNMQLKNVAAVMVTAKLPAFARAGQKIDVVVSSLGSAKSLRGGT 120

Query: 124 LVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFK 183
           L+MT L G D  +YA+AQG+++VSG   +   +        GG+I  GAIVER +P  F 
Sbjct: 121 LLMTPLKGVDNQVYALAQGNILVSGSGAQAGGNRVQVNQLNGGRISGGAIVERSVPADFA 180

Query: 184 DSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLM 242
               ++LQL N DFS A +I+D IN      F    A   DSRT+ V+ P +     R +
Sbjct: 181 GGNVIMLQLNNDDFSLAQQISDAIN----RHFGHRSALPLDSRTINVAVPPDGPGKVRFL 236

Query: 243 SEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAF 301
           + ++ + +      A V+IN RTG++V+  +V +    V++G LTV++    +V QP+  
Sbjct: 237 ASLQNIPITLGPTDAVVVINSRTGSVVMNRDVVLGSCAVAHGELTVEVNRTYKVSQPDTP 296

Query: 302 SSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
              G TV    T + V +  G+   +    +LN ++S +N IG   + +++ILQ +++ G
Sbjct: 297 FGGGRTVVVPETAINVRNEGGALQQIDAGANLNDVVSALNGIGATPNDLMAILQSMQSTG 356

Query: 361 ALQSEIII 368
            L +++ I
Sbjct: 357 CLNAKLEI 364


>gi|300311356|ref|YP_003775448.1| flagellar basal-body P-ring protein [Herbaspirillum seropedicae
           SmR1]
 gi|300074141|gb|ADJ63540.1| flagellar basal-body P-ring protein [Herbaspirillum seropedicae
           SmR1]
          Length = 376

 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 145/351 (41%), Positives = 209/351 (59%), Gaps = 11/351 (3%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+ S+Q  R NQL+GYGLVVGL G+GD    +PFT QS+ S+LQ LG++ P G   
Sbjct: 30  ERLKDLASIQGVRQNQLVGYGLVVGLDGSGDQTTQTPFTVQSVISMLQQLGVNVPTGTSS 89

Query: 81  RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVA 140
            +  KNVAA MVTANLP FA PG  IDV+++S+G+A S+RGG L+M  L GADG IYA+A
Sbjct: 90  NMQLKNVAAAMVTANLPAFAQPGQLIDVTVSSIGNAKSIRGGTLLMAPLKGADGQIYAIA 149

Query: 141 QGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTA 200
           QG++VV G       SS +    + G+I  GA VER +P     S  ++L+L + DFSTA
Sbjct: 150 QGNIVVGGAGGSAAGSSTVINQLSAGRISGGATVERAVPSSLGSSDMIVLELNDNDFSTA 209

Query: 201 IRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVEMLTVETDT-PARV 258
            R+ D +N     RF    A A D R ++V  P  + D    +  +E + V      A+V
Sbjct: 210 SRVVDALNK----RFGNETAVAQDGRVIRVRAPISSGDRVAFLGALENVDVTPGKLAAKV 265

Query: 259 IINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVS 318
           I+N RTG++V+  +V +    VS+GNL+V I  +  V QPNA  + G T    N  + ++
Sbjct: 266 ILNARTGSVVMNQSVMLDTCAVSHGNLSVVIQADNAVSQPNAL-AGGQTAGVQNAQISIN 324

Query: 319 DNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              G    L     L  ++  +N+IG     +++ILQ +KAAG+L++E+ +
Sbjct: 325 KEPGKVMLLKGGASLAEVVKALNAIGATPQDLLAILQAMKAAGSLRAELEV 375


>gi|149927802|ref|ZP_01916053.1| flagellar P-ring protein precursor I [Limnobacter sp. MED105]
 gi|149823424|gb|EDM82655.1| flagellar P-ring protein precursor I [Limnobacter sp. MED105]
          Length = 381

 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 147/359 (40%), Positives = 220/359 (61%), Gaps = 9/359 (2%)

Query: 14  GLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNL 73
                 A+  +RI+D+V++   R N + GYGLV+GL GTGD    +PFT QS+ S+LQ  
Sbjct: 27  MAFGTQAEAQTRIRDLVTVSGVRSNPVYGYGLVIGLDGTGDQTTQTPFTSQSIVSMLQQS 86

Query: 74  GISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
           GI+ P G  L  KNVA+VMVTANLP FA PG  IDV+++S+G+A SLRGG+L+MT L GA
Sbjct: 87  GITLPPGANLQLKNVASVMVTANLPAFAQPGQAIDVTVSSIGNAKSLRGGMLLMTPLKGA 146

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQL 192
           DG +YA+AQG ++V G       S  +    + G+I  GA+VERE+   F     L L+L
Sbjct: 147 DGQVYALAQGQLIVGGAGASAGGSKTVINHLSAGRIPAGALVEREVASPFLLGETLQLEL 206

Query: 193 RNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTV- 250
            + DFS AIR+A+ IN    N     +A+A D RT+KV  P+N +     +S V+ L++ 
Sbjct: 207 TSTDFSNAIRVAEAIN----NNMGPNVAQALDGRTIKVRAPSNPNDRVAFLSRVQELSIN 262

Query: 251 ETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQ 310
           +    A+VI+N RTG++V+   V +    V++GNLTV+IT    + QP  F   G TV  
Sbjct: 263 KAMGSAKVIVNARTGSVVMNQAVMLESCAVAHGNLTVKITSTPVISQPAPF-GQGETVVT 321

Query: 311 NNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              D+++S++ G    +  A  L+ ++  +N++G     +ISILQ ++ AG+L++E+ +
Sbjct: 322 EVADIQISESGGELIEIKGAAQLSDVVKALNALGATPSDLISILQAMQTAGSLKAELEV 380


>gi|157959898|ref|YP_001499932.1| flagellar basal body P-ring protein [Shewanella pealeana ATCC
           700345]
 gi|157844898|gb|ABV85397.1| flagellar P-ring protein [Shewanella pealeana ATCC 700345]
          Length = 376

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 149/380 (39%), Positives = 215/380 (56%), Gaps = 18/380 (4%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRI-----KDVVSLQSGRDNQLIGYGLVVGLQGTGDSL 56
           + +IA  I S++        V + I      D+V +Q  RDNQL+GYGLVVGL GTGD  
Sbjct: 1   MKKIALFITSMLLALLPLLPVQAEIQNRYLMDIVDVQGIRDNQLVGYGLVVGLDGTGDK- 59

Query: 57  RSSPFTEQSMRSLLQNLGISTPG-GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGD 115
               FT QS+ ++L+  G+          KNVAAV V+A +PP ASPG  +D++++SLGD
Sbjct: 60  NQVKFTSQSVVNMLKQFGVQIDDKTDPKLKNVAAVAVSATVPPLASPGQTLDITVSSLGD 119

Query: 116 ASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIV 174
           A SLRGG L+MT L   DG IYAVAQG++VV G+  +G   SS    I T G I NGA++
Sbjct: 120 AKSLRGGTLLMTPLRAVDGEIYAVAQGNLVVGGVSAQGRNGSSITVNIPTVGNIPNGALL 179

Query: 175 ERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP- 233
           E  +   F ++  ++L L+ P F TA  I   +N      F   +AEA  +  V V  P 
Sbjct: 180 EAAMKSNFNETEHIVLNLKQPSFKTARNIERAVNEL----FGPSVAEADSNAKVMVRAPS 235

Query: 234 TNIDLTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
           +N +    MS +E L +E      RV+ N RTGT+V+G +V + K  VS+GNLTV I E 
Sbjct: 236 SNRERVTFMSMLEELQIEQGRKSPRVVFNSRTGTVVMGGDVVVRKAAVSHGNLTVSIVEQ 295

Query: 293 EQVVQPNAF---SSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDG 348
           + V QPN      + G TV  N++ + +    G  F   +   L+ ++  +NS+G     
Sbjct: 296 QNVSQPNGAFLGQAQGETVVTNDSTVDIEQGNGHMFVWEEGVALDDIVRAVNSLGASPMD 355

Query: 349 IISILQGIKAAGALQSEIII 368
           ++SILQ +  AGAL++E+++
Sbjct: 356 LMSILQALDEAGALEAELVV 375


>gi|288574700|ref|ZP_06393057.1| flagellar P-ring protein [Dethiosulfovibrio peptidovorans DSM
           11002]
 gi|288570441|gb|EFC91998.1| flagellar P-ring protein [Dethiosulfovibrio peptidovorans DSM
           11002]
          Length = 369

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 141/370 (38%), Positives = 211/370 (57%), Gaps = 10/370 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++  +A  +               RIKD+  ++  R NQL G G+V+GLQGTGD    S 
Sbjct: 7   ILLSVAVSLSVAGLSLGAPISPEVRIKDLADIEGVRSNQLSGVGVVMGLQGTGDK---SD 63

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
            + Q +R+L++  G++     + SKNVA V VTA LPPF  PG  +DV++++LGDA SL+
Sbjct: 64  MSIQVLRNLMRRFGVTLSDKDVKSKNVAMVAVTAELPPFVRPGQTVDVTVSTLGDAKSLQ 123

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG+L+ T L  A+GN+YA AQG V+V G       SS  + + T G++  GAIVER++  
Sbjct: 124 GGVLLQTPLKAANGNVYAAAQGPVLVGGFSAGRGGSSVTKNVVTVGRVNGGAIVERDVST 183

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--L 238
           +F     L L LRNPDF+T+ RIAD IN    +     IA A D+  V++  P       
Sbjct: 184 EFSYGGRLSLLLRNPDFTTSRRIADAINRKFGS-----IASALDAGRVQIQLPGAYMASP 238

Query: 239 TRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
           +  ++++E + V  D  A+V++NERTGT+V+G NV+IS V V++G+LTV+I +  QV QP
Sbjct: 239 SAFIADMESMRVTPDMQAKVVVNERTGTVVMGGNVQISSVAVAHGDLTVRIDQENQVSQP 298

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
             FS   +T   N+T            +     ++ L+  +N++G     +I ILQ I  
Sbjct: 299 EPFSGGVTTPYANDTVQAEEKRGSFIKMDATTTVDQLVDAINAVGASPRDVIGILQAIDR 358

Query: 359 AGALQSEIII 368
           AGAL  E+ +
Sbjct: 359 AGALHGELDV 368


>gi|167835116|ref|ZP_02461999.1| flagellar basal body P-ring protein [Burkholderia thailandensis
           MSMB43]
          Length = 401

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 147/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 46  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 105

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 106 GGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 165

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 166 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAIAQMNGVLQLQ 225

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 226 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 281

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 282 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 340

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 341 AQQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|124383419|ref|YP_001028056.1| flagellar basal body P-ring protein [Burkholderia mallei NCTC
           10229]
 gi|134283650|ref|ZP_01770349.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 305]
 gi|254182136|ref|ZP_04888733.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1655]
 gi|254207234|ref|ZP_04913585.1| flagellar P-ring protein [Burkholderia mallei JHU]
 gi|124291439|gb|ABN00708.1| flagellar P-ring protein [Burkholderia mallei NCTC 10229]
 gi|134245059|gb|EBA45154.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 305]
 gi|147752776|gb|EDK59842.1| flagellar P-ring protein [Burkholderia mallei JHU]
 gi|184212674|gb|EDU09717.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1655]
          Length = 400

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 147/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 45  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 104

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 105 GGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 164

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 165 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 224

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 225 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 280

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 281 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 339

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 340 AQQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 399


>gi|269792754|ref|YP_003317658.1| flagellar P-ring protein [Thermanaerovibrio acidaminovorans DSM
           6589]
 gi|269100389|gb|ACZ19376.1| flagellar P-ring protein [Thermanaerovibrio acidaminovorans DSM
           6589]
          Length = 365

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 140/366 (38%), Positives = 204/366 (55%), Gaps = 10/366 (2%)

Query: 5   IAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQ 64
           +   +  L         V  RIKD+V ++  R NQL+G GLVVGL GTGD         +
Sbjct: 9   LCLGLGFLAVFVVPVFGVEVRIKDLVDVEGARANQLVGMGLVVGLAGTGDKG---DMAMR 65

Query: 65  SMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGIL 124
            + ++  N G++     + SKNVA V VT  LPPF SPG  +DV +++LGDA SL+GG+L
Sbjct: 66  MLSNMALNFGVNVDPKAVKSKNVAVVSVTCELPPFVSPGQTLDVQVSALGDAKSLQGGML 125

Query: 125 VMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKD 184
           + T L  A+G +YAVAQG + + G    GQ +  +    T  +I  GAIVE+ +      
Sbjct: 126 LQTPLRAANGRVYAVAQGPLSIGGFSAGGQGAQTVRNFQTVARIPGGAIVEQGVDSTLGG 185

Query: 185 SADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSE 244
              L L LR PDF+TA RIA+ IN          +A A D+  V+VS P  + +T  ++ 
Sbjct: 186 GGALALLLRRPDFTTATRIAEAINRKYG-----GVARAVDAGRVEVSAPGGVGVTSFLAS 240

Query: 245 VEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           +E L V  D  ARV++NERTGT+V+G  V++S   VS+GNLTV+++E  +  QPN   + 
Sbjct: 241 IEGLRVTPDALARVVVNERTGTVVMGGEVKLSTAAVSHGNLTVKVSERPEASQPNPL-AG 299

Query: 305 GSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G T     TD+   +  G    L ++  +  L+  +N +G     +I ILQ +  AGALQ
Sbjct: 300 GRTQVLPRTDVSAQEGGGQVVLLPESSSVADLVKALNGVGASPRDLIPILQALDQAGALQ 359

Query: 364 SEIIIQ 369
            +++IQ
Sbjct: 360 GQLVIQ 365


>gi|126441723|ref|YP_001057326.1| flagellar basal body P-ring protein [Burkholderia pseudomallei 668]
 gi|126221216|gb|ABN84722.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 668]
          Length = 400

 Score =  354 bits (908), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 147/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 45  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 104

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 105 GGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 164

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 165 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 224

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 225 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 280

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 281 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 339

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 340 AQQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 399


>gi|320107045|ref|YP_004182635.1| flagellar P-ring protein [Terriglobus saanensis SP1PR4]
 gi|319925566|gb|ADV82641.1| flagellar P-ring protein [Terriglobus saanensis SP1PR4]
          Length = 371

 Score =  354 bits (908), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 140/364 (38%), Positives = 212/364 (58%), Gaps = 7/364 (1%)

Query: 6   AFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQS 65
            FLI +L    ++  Q ++RIKD+ S++  R+NQL+GYG+VVGLQGTGDS + + F  Q+
Sbjct: 13  IFLIGALSHASDLPQQHLARIKDIASVEGIRENQLVGYGIVVGLQGTGDS-QQTSFPVQT 71

Query: 66  MRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILV 125
           + + L  +G+S P   +  +N+AAV V+A+LPPF+ PG+RID++++S GDA SL GG+L+
Sbjct: 72  LAATLLRMGVSVPASSIRVQNLAAVFVSASLPPFSRPGTRIDLTVSSAGDAKSLEGGLLL 131

Query: 126 MTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           MT L GADG IYA AQG +V+ G  V    ++      T  ++  G  VER +P    + 
Sbjct: 132 MTPLYGADGRIYAQAQGPLVLGGYSVTANGNTKQTNHPTTARVPLGGSVERGVPLDLTNR 191

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEV 245
             L L +   DF +A  +AD IN+         +A A DSR + ++     D+  L++ V
Sbjct: 192 QSLSLLMHEADFRSAEAMADAINTTLHRT----VAHAADSRRIDLTLVPGEDVPSLLARV 247

Query: 246 EMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNG 305
           E + V     ++V++NERTGT+VIG NV +    + +G L V I    QV QP  F SNG
Sbjct: 248 EAIEVPFYPRSKVVVNERTGTVVIGGNVVLQPASILHGGLAVNIISENQVSQPGPF-SNG 306

Query: 306 STVTQNNTDLKVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQS 364
           +T     T +   D       L     ++ L+  +  IG     +ISILQ +K+AGA+++
Sbjct: 307 TTQVVQQTRIDAKDKPVNRIDLQQGSTVDDLVRSLQMIGATARDVISILQAMKSAGAMEA 366

Query: 365 EIII 368
           EI +
Sbjct: 367 EIEV 370


>gi|161723212|ref|YP_106904.2| flagellar basal body P-ring protein [Burkholderia pseudomallei
           K96243]
 gi|162210073|ref|YP_331884.2| flagellar basal body P-ring protein [Burkholderia pseudomallei
           1710b]
          Length = 397

 Score =  354 bits (908), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 147/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 42  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 101

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 102 GGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 161

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 162 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 221

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 222 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 277

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 278 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 336

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 337 AQQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 396


>gi|89068724|ref|ZP_01156110.1| flagellar P-ring protein precursor [Oceanicola granulosus HTCC2516]
 gi|89045687|gb|EAR51749.1| flagellar P-ring protein precursor [Oceanicola granulosus HTCC2516]
          Length = 372

 Score =  354 bits (908), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 157/347 (45%), Positives = 223/347 (64%), Gaps = 5/347 (1%)

Query: 23  VSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI-STPGGR 81
             RIKD+ + +  R+NQL+GYGLVVGL GTGDSLR+SPFT+QS++ +L+ LG+ +    +
Sbjct: 29  QVRIKDIATFEGVRENQLVGYGLVVGLNGTGDSLRNSPFTQQSIQGMLERLGVGNLSDDQ 88

Query: 82  LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQ 141
           + ++N AAVMVTA+LPPFA  GS IDV ++SLGDASSLRGG L++T L GADG IYAVAQ
Sbjct: 89  MKTENTAAVMVTASLPPFARRGSTIDVVVSSLGDASSLRGGTLIVTPLTGADGEIYAVAQ 148

Query: 142 GSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAI 201
           G + V+G   +G +++ +EG+ T  +I NGA++E E+  + ++   + + LR PDF+TA+
Sbjct: 149 GPIAVAGYAAQGANAAIVEGVPTVARIENGALIENEIGFRLEELESVRIALRVPDFTTAV 208

Query: 202 RIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIIN 261
           R+ D IN+          A A D  T++V      D+  LM+ +E L V  D+ A+V+I+
Sbjct: 209 RVQDVINAA----LGGGTARALDPGTIEVYPSDKSDIPGLMAGLENLRVNPDSVAKVVID 264

Query: 262 ERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNK 321
            R+GTIVIG  VRI +V VS G LTV + E+ +V QP  FS   + V    T        
Sbjct: 265 ARSGTIVIGAEVRIGRVAVSQGGLTVIVKEDVEVSQPEPFSVGETVVVPQTTVTVEERRT 324

Query: 322 GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
               +     L  L+ G+N+IGL     ISILQ +KAAGAL +++ I
Sbjct: 325 NFAIIEGDVSLQRLVDGLNAIGLGATETISILQAMKAAGALHADLEI 371


>gi|126451759|ref|YP_001064568.1| flagellar basal body P-ring protein [Burkholderia pseudomallei
           1106a]
 gi|167813807|ref|ZP_02445487.1| flagellar basal body P-ring protein [Burkholderia pseudomallei 91]
 gi|167822324|ref|ZP_02453795.1| flagellar basal body P-ring protein [Burkholderia pseudomallei 9]
 gi|167909132|ref|ZP_02496223.1| flagellar basal body P-ring protein [Burkholderia pseudomallei 112]
 gi|226199750|ref|ZP_03795301.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei Pakistan
           9]
 gi|242315232|ref|ZP_04814248.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1106b]
 gi|254259711|ref|ZP_04950765.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1710a]
 gi|126225401|gb|ABN88941.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1106a]
 gi|225928101|gb|EEH24137.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei Pakistan
           9]
 gi|242138471|gb|EES24873.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1106b]
 gi|254218400|gb|EET07784.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1710a]
          Length = 401

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 147/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 46  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 105

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 106 GGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 165

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 166 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 225

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 226 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 281

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 282 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 340

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 341 AQQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|332284023|ref|YP_004415934.1| flagellar basal body P-ring protein [Pusillimonas sp. T7-7]
 gi|330427976|gb|AEC19310.1| flagellar basal body P-ring protein [Pusillimonas sp. T7-7]
          Length = 384

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 144/353 (40%), Positives = 214/353 (60%), Gaps = 8/353 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTP- 78
                R+KD+ S+Q  R NQLIGYGLVVGL G+GD +R +PFT+QS+ ++L  LGI+ P 
Sbjct: 35  LVQAERVKDLASIQGVRANQLIGYGLVVGLDGSGDQVRQTPFTQQSLTNMLSQLGITVPQ 94

Query: 79  GGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           G  +  +NVAAVMVTA LP FA PG  +DV ++S+G+A SLRGG L+MT L GA+G +YA
Sbjct: 95  GTNMQLRNVAAVMVTARLPAFARPGQTVDVVVSSMGNAKSLRGGTLLMTPLKGANGQVYA 154

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           +AQG+++V G   +   SS       GG I NGAI+ER +P  +     + L+L   DF 
Sbjct: 155 IAQGNLLVGGAGAEAGGSSVQVNQLNGGIISNGAIIERAVPTIYARDGIVNLELNTTDFG 214

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVE-TDTPA 256
           TA  +   +N     +F    A A D R V+V  P N D     +S+VE L V      A
Sbjct: 215 TAQNLVAALNK----QFGTGTATALDGRVVQVRGPLNPDAQAAFLSQVESLQVRVAPARA 270

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           +V+IN RTG++V+   V I +  ++YGNL+V I+    V QP+     G TV  ++T ++
Sbjct: 271 KVVINARTGSVVMNRTVTIDEAAIAYGNLSVVISRQSDVSQPDTPFGGGQTVVTDSTQIE 330

Query: 317 VSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +  + GS   +  + +L  ++  +N++G     ++SILQ +K+AGAL++++ I
Sbjct: 331 MRSDSGSLQRVRTSANLADVVKALNALGATPQDLLSILQNLKSAGALRADLEI 383


>gi|161579513|ref|YP_104802.2| flagellar basal body P-ring protein [Burkholderia mallei ATCC
           23344]
          Length = 397

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 147/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 42  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 101

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 102 GGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 161

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 162 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 221

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 222 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 277

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 278 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 336

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 337 AQQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 396


>gi|76579516|gb|ABA48991.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 1710b]
          Length = 369

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 149/373 (39%), Positives = 210/373 (56%), Gaps = 20/373 (5%)

Query: 11  SLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLL 70
            L      +A    R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L
Sbjct: 1   MLALAFAPAAARAERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANML 60

Query: 71  QNLGISTPGG-----------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
            NLGIS   G            +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SL
Sbjct: 61  ANLGISINNGSANGGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L++T L GADG +YA+AQG++ V G       S         G+I  GAIVER +P
Sbjct: 121 RGGTLLLTPLKGADGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVP 180

Query: 180 KKFKDSAD-LILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-ID 237
                    L LQL + D+ TA RI   +NS     F    A A D RT++++ P +   
Sbjct: 181 NAVAQMNGVLQLQLNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQ 236

Query: 238 LTRLMSEVEMLTVETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               M+ ++ L V  +   A+VI+N RTG+IV+   V +    V++GNL+V +     V 
Sbjct: 237 QVAFMARLQNLEVSPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVS 296

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP  F SNG TV    + +++  + GS   +    +L  ++  +NS+G     ++SILQ 
Sbjct: 297 QPGPF-SNGQTVVAQQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQA 355

Query: 356 IKAAGALQSEIII 368
           +KAAGAL++++ I
Sbjct: 356 MKAAGALRADLEI 368


>gi|121598477|ref|YP_994295.1| flagellar basal body P-ring protein [Burkholderia mallei SAVP1]
 gi|167001542|ref|ZP_02267337.1| flagellar P-ring protein [Burkholderia mallei PRL-20]
 gi|167717665|ref|ZP_02400901.1| flagellar basal body P-ring protein [Burkholderia pseudomallei
           DM98]
 gi|167736708|ref|ZP_02409482.1| flagellar basal body P-ring protein [Burkholderia pseudomallei 14]
 gi|167892416|ref|ZP_02479818.1| flagellar basal body P-ring protein [Burkholderia pseudomallei
           7894]
 gi|217424961|ref|ZP_03456457.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 576]
 gi|237810465|ref|YP_002894916.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei MSHR346]
 gi|238562528|ref|ZP_00440319.2| flagellar P-ring protein FlgI [Burkholderia mallei GB8 horse 4]
 gi|254201899|ref|ZP_04908263.1| flagellar P-ring protein [Burkholderia mallei FMH]
 gi|121227287|gb|ABM49805.1| flagellar P-ring protein [Burkholderia mallei SAVP1]
 gi|147747793|gb|EDK54869.1| flagellar P-ring protein [Burkholderia mallei FMH]
 gi|217391981|gb|EEC32007.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 576]
 gi|237505619|gb|ACQ97937.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei MSHR346]
 gi|238522493|gb|EEP85937.1| flagellar P-ring protein FlgI [Burkholderia mallei GB8 horse 4]
 gi|243062742|gb|EES44928.1| flagellar P-ring protein [Burkholderia mallei PRL-20]
          Length = 401

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 147/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 46  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 105

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 106 GGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 165

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 166 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 225

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 226 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 281

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 282 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 340

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 341 AQQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|17548570|ref|NP_521910.1| flagellar basal body P-ring protein [Ralstonia solanacearum
           GMI1000]
 gi|22095704|sp|Q8XSW8|FLGI_RALSO RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|17430818|emb|CAD17500.1| probable flagellar p-ring precursor (basal body p-ring protein).
           signal peptide [Ralstonia solanacearum GMI1000]
          Length = 369

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 136/353 (38%), Positives = 199/353 (56%), Gaps = 9/353 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
                RIKD+ ++   R+N LIGYGLVVGL G+GD    +PFT QS  ++L   GI+ P 
Sbjct: 21  TAHADRIKDLTTIAGVRENALIGYGLVVGLDGSGDQTTQTPFTIQSFNNMLSQFGINVPS 80

Query: 80  G-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           G  +  KN AAV+VTA+LP F  PG  IDV+++S+G+A SLRGG L++T L G DG +YA
Sbjct: 81  GASIQLKNTAAVVVTASLPAFVRPGQTIDVTVSSIGNAKSLRGGTLLLTPLKGVDGQLYA 140

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           +AQG+VV+ G       S         G+I NGA VER +     ++  + L     DF 
Sbjct: 141 LAQGNVVIGGAGASANGSKVQINQLGAGRIANGATVERTVQATVGEAGSIQLDTGTTDFG 200

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVEMLTVET-DTPA 256
           T   I + IN     +F    AEA D RTV V  P    D    +++++ + V      A
Sbjct: 201 TVQNIVNAINK----QFGADTAEAADGRTVNVRAPALAADRVGFVAKLQNIEVTPAQAAA 256

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV++N RTG++V+   V++    V++GNL+V I+    V QP  F S G TV    ++++
Sbjct: 257 RVVVNARTGSVVMNQQVKLEPCAVAHGNLSVTISTEPVVSQPAPF-SQGQTVAGARSNIE 315

Query: 317 VSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           V    GS   +    +L  ++  +N+IG     +ISILQ +KAA AL++++ I
Sbjct: 316 VKQQGGSLINVKGGTNLADVVKAINAIGANPQDLISILQAMKAANALRADLEI 368


>gi|167900913|ref|ZP_02488118.1| flagellar basal body P-ring protein [Burkholderia pseudomallei NCTC
           13177]
          Length = 401

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 147/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 46  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 105

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 106 GGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 165

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 166 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 225

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 226 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 281

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 282 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 340

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 341 AQQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|261339380|ref|ZP_05967238.1| flagellar P-ring protein FlgI [Enterobacter cancerogenus ATCC
           35316]
 gi|288318181|gb|EFC57119.1| flagellar P-ring protein FlgI [Enterobacter cancerogenus ATCC
           35316]
          Length = 365

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 144/365 (39%), Positives = 217/365 (59%), Gaps = 8/365 (2%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
            +F+++     +     RI+D+ S+Q  R+N LIGYGLVVGL GTGD    +PFT QS+ 
Sbjct: 4   FLFAMVLALGATCAHADRIRDLTSVQGVRENSLIGYGLVVGLDGTGDQTTQTPFTTQSLN 63

Query: 68  SLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++L  LGI+ P G  +  KNVAAVMVTA+ P FA  G  IDV ++S+G+A SLRGG L+M
Sbjct: 64  NMLSQLGITVPTGTNMQLKNVAAVMVTASFPAFARQGQTIDVVVSSMGNAKSLRGGTLLM 123

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
           T L G D  +YA+AQG+++V G       SS       GG+I NGAI+ERELP +F    
Sbjct: 124 TPLKGVDSQVYALAQGNILVGGAGASAGGSSVQVNQLNGGRITNGAIIERELPTQFGSGN 183

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVS-KPTNIDLTRLMSEV 245
            + LQL N DF+ A +IAD IN           A A D+RTV++     N +  R+++++
Sbjct: 184 TINLQLNNEDFTMAQQIADTINRSR----GYGSATALDARTVQIRTSTGNSNQVRMLADI 239

Query: 246 EMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSN 304
           + + V      A+VIIN RTG++V+   V +    V+ GNL+V +  +  V QP+     
Sbjct: 240 QNMEVNMPVQDAKVIINSRTGSVVMNREVSLDSCAVAQGNLSVTVNRSANVSQPDTPFGG 299

Query: 305 GSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           G TV    T + +  + GS   +  + +LNS++  +N++G     ++SILQ +++AG L+
Sbjct: 300 GQTVVTPQTQIDLRQSGGSLQSVRSSANLNSVVRALNALGATPMDLMSILQSMQSAGCLR 359

Query: 364 SEIII 368
           +++ I
Sbjct: 360 AKLEI 364


>gi|222112277|ref|YP_002554541.1| flagellar basal body p-ring protein [Acidovorax ebreus TPSY]
 gi|221731721|gb|ACM34541.1| flagellar P-ring protein [Acidovorax ebreus TPSY]
          Length = 374

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 141/352 (40%), Positives = 203/352 (57%), Gaps = 10/352 (2%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR 81
              R+K++ ++Q  R NQL GYGLVVGL GTGD     PFT Q+M + LQ  GIS P G 
Sbjct: 27  QAVRLKEIAAVQGVRSNQLSGYGLVVGLDGTGDRSTQMPFTAQAMSNYLQQAGISLPPGT 86

Query: 82  --LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
                KNVA V++TA LP FA PG  IDV+++S+G+A SL+GG L+ T L GADG IYA+
Sbjct: 87  TAPQLKNVATVVITAQLPAFAQPGQMIDVAVSSIGNAKSLKGGTLIATPLRGADGEIYAL 146

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQG+VVV G       S       + G+I +GA VER +P    DS  + L L   DF  
Sbjct: 147 AQGNVVVGGAGASAGGSKVQINHLSAGRIPDGAQVERAVPTPLHDSDTITLGLNASDFQA 206

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVETDTP-AR 257
           A ++A  IN+    R     A A D RTV+V  P +       ++E+E L +   TP A+
Sbjct: 207 ARKVALAINA----RSGPDTAVALDGRTVQVRAPQDPGARVNFIAELEELQLPDSTPAAK 262

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           V+IN RTG+IV+   V +    +++GNL++ I+    + QP+   S G TV    +D+ +
Sbjct: 263 VVINARTGSIVLNQAVTLGPCAIAHGNLSITISTTPVISQPSPL-SRGVTVVAQKSDIAI 321

Query: 318 SDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + G    +  +P L  ++  +N++G     +++ILQ IKAAGAL +E+ +
Sbjct: 322 QQDGGKVMQVPASPQLADVVRALNTLGATPQDLLAILQAIKAAGALNAELEV 373


>gi|121534939|ref|ZP_01666758.1| flagellar P-ring protein [Thermosinus carboxydivorans Nor1]
 gi|121306538|gb|EAX47461.1| flagellar P-ring protein [Thermosinus carboxydivorans Nor1]
          Length = 369

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 159/358 (44%), Positives = 219/358 (61%), Gaps = 10/358 (2%)

Query: 14  GLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNL 73
            +   +     RIKDV  +Q  R NQL+GYGLVVGL GTGDS ++   T QS+ ++L+  
Sbjct: 18  IVPAGALAAGVRIKDVAKVQGVRSNQLVGYGLVVGLAGTGDSTKNMA-TMQSIANMLRTF 76

Query: 74  GISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGAD 133
           G++    +L +KNVAAVMVTA LPPF  PG  ID++++SLGDA SL+GG L+   L  A+
Sbjct: 77  GVTVTPAQLQAKNVAAVMVTAVLPPFVKPGDTIDITVSSLGDAKSLQGGTLLQAPLRAAN 136

Query: 134 GNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLR 193
           G +YAVAQG + + G       +S  +   T G I  GAIVER++P +F     + L L 
Sbjct: 137 GLVYAVAQGPLSIGGYAAGSGGASQQKNFPTVGTIPGGAIVERDVPVEFTAGGQIALALS 196

Query: 194 NPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID--LTRLMSEVEMLTVE 251
            PDF+TA RIA+ I      RF  PIA A D  TV VS P      +   ++ +E LT+ 
Sbjct: 197 QPDFTTASRIAEAI----AGRFG-PIAVARDPGTVTVSIPDYYRGDIVGFIAAIEELTIV 251

Query: 252 TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQN 311
            DT A+VIINERTGT+V+G  V I +V V+ G L+V+IT ++ V QP    S GSTV  +
Sbjct: 252 PDTAAKVIINERTGTVVMGGQVTIDEVAVAQGGLSVRITRDKAVSQPPPL-SGGSTVVTD 310

Query: 312 NTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            T L+V + K S   L  A  ++ +++ +N+IG     II+ILQ IKAAGAL +++ I
Sbjct: 311 KTTLQVDEAKASVVTLPPAASVSDVVAALNAIGATPRDIIAILQAIKAAGALHADLQI 368


>gi|161503731|ref|YP_001570843.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189044486|sp|A9MGD9|FLGI_SALAR RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|160865078|gb|ABX21701.1| hypothetical protein SARI_01816 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 367

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 144/370 (38%), Positives = 216/370 (58%), Gaps = 8/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             +   +  ++     +     RI+D+ S+Q  R+N LIGYGLVVGL GTGD    +PFT
Sbjct: 1   MYVFKALAGIVLALVATLAHAERIRDLTSVQGVRENSLIGYGLVVGLDGTGDQTTQTPFT 60

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            Q++ ++L  LGI+ P G  +  KNVAAVMVTA+ PPFA  G  IDV ++S+G+A SLRG
Sbjct: 61  TQTLNNMLSQLGITVPTGTNMQLKNVAAVMVTASYPPFARQGQTIDVVVSSMGNAKSLRG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L G D  +YA+AQG+++V G       SS       GG+I NGAI+ERELP +
Sbjct: 121 GTLLMTPLKGVDSQVYALAQGNILVGGAGASAGGSSVQVNQLNGGRITNGAIIERELPSQ 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTR 240
           F     + LQL + DF+ A +I D IN           A A D+RTV+V  P+ N    R
Sbjct: 181 FGAGNTINLQLNDEDFTMAQQITDAINRAR----GYGSATALDARTVQVRVPSGNSSQVR 236

Query: 241 LMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +++++ + V  T   A+V+IN RTG++V+   V +    V+ GNL+V +     V QPN
Sbjct: 237 FLADIQNMEVNVTPQDAKVVINSRTGSVVMNREVTLDSCAVAQGNLSVTVNRQLNVNQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
                G TV    T + +  + GS   +  + +LNS++  +N++G     ++SILQ +++
Sbjct: 297 TPFGGGQTVVTPQTQIDLRQSGGSLQSVRSSANLNSVVRALNALGATPMDLMSILQSMQS 356

Query: 359 AGALQSEIII 368
           AG L++++ I
Sbjct: 357 AGCLRAKLEI 366


>gi|121596122|ref|YP_988018.1| flagellar basal body P-ring protein [Acidovorax sp. JS42]
 gi|120608202|gb|ABM43942.1| flagellar P-ring protein [Acidovorax sp. JS42]
          Length = 374

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 141/352 (40%), Positives = 203/352 (57%), Gaps = 10/352 (2%)

Query: 22  VVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR 81
              R+K++ ++Q  R NQL GYGLVVGL GTGD     PFT Q+M + LQ  GIS P G 
Sbjct: 27  QAVRLKEIAAVQGVRSNQLSGYGLVVGLDGTGDQSTQMPFTAQAMSNYLQQAGISLPPGT 86

Query: 82  --LGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAV 139
                KNVA V++TA LP FA PG  IDV+++S+G+A SL+GG L+ T L GADG IYA+
Sbjct: 87  TAPQLKNVATVVITAQLPAFAQPGQMIDVAVSSIGNAKSLKGGTLIATPLRGADGEIYAL 146

Query: 140 AQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFST 199
           AQG+VVV G       S       + G+I +GA VER +P    DS  + L L   DF  
Sbjct: 147 AQGNVVVGGAGASAGGSKVQINHLSAGRIPDGAQVERAVPTPLHDSDTITLGLNASDFQA 206

Query: 200 AIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LTRLMSEVEMLTVETDTP-AR 257
           A ++A  IN+    R     A A D RTV+V  P +       ++E+E L +   TP A+
Sbjct: 207 ARKVALAINA----RSGPDTAVALDGRTVQVRAPQDPGARVNFIAELEELQLPDSTPAAK 262

Query: 258 VIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKV 317
           V+IN RTG+IV+   V +    +++GNL++ I+    + QP+   S G TV    +D+ +
Sbjct: 263 VVINARTGSIVLNQAVTLGPCAIAHGNLSITISTTPVISQPSPL-SRGVTVVAQKSDIAI 321

Query: 318 SDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
             + G    +  +P L  ++  +N++G     +++ILQ IKAAGAL +E+ +
Sbjct: 322 QQDGGKVMQVPASPQLADVVRALNTLGATPQDLLAILQAIKAAGALNAELEV 373


>gi|254196982|ref|ZP_04903406.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei S13]
 gi|254295818|ref|ZP_04963275.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 406e]
 gi|52208332|emb|CAH34265.1| flagellar P-ring protein precuror [Burkholderia pseudomallei
           K96243]
 gi|157805661|gb|EDO82831.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei 406e]
 gi|169653725|gb|EDS86418.1| flagellar P-ring protein FlgI [Burkholderia pseudomallei S13]
          Length = 394

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 147/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 39  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 98

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 99  GGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 158

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 159 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 218

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 219 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 274

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 275 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 333

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 334 AQQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 393


>gi|126450185|ref|YP_001082863.1| flagellar basal body P-ring protein [Burkholderia mallei NCTC
           10247]
 gi|167917168|ref|ZP_02504259.1| flagellar basal body P-ring protein [Burkholderia pseudomallei
           BCC215]
 gi|254174943|ref|ZP_04881604.1| flagellar P-ring protein [Burkholderia mallei ATCC 10399]
 gi|254359736|ref|ZP_04976007.1| flagellar P-ring protein [Burkholderia mallei 2002721280]
 gi|126243055|gb|ABO06148.1| flagellar P-ring protein [Burkholderia mallei NCTC 10247]
 gi|148028950|gb|EDK86882.1| flagellar P-ring protein [Burkholderia mallei 2002721280]
 gi|160695988|gb|EDP85958.1| flagellar P-ring protein [Burkholderia mallei ATCC 10399]
          Length = 394

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 147/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 39  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 98

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 99  GGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 158

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 159 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 218

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 219 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 274

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 275 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 333

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 334 AQQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 393


>gi|90112113|sp|Q63YB1|FLGI_BURPS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 389

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 147/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 34  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 93

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 94  GGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 153

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 154 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 213

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 214 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 269

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 270 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 328

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 329 AQQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 388


>gi|81603728|sp|Q62ES6|FLGI_BURMA RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|52427992|gb|AAU48585.1| flagellar P-ring protein [Burkholderia mallei ATCC 23344]
          Length = 389

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 147/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 34  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 93

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 94  GGGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 153

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 154 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 213

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 214 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 269

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 270 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 328

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 329 AQQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 388


>gi|85701342|sp|Q72EQ3|FLGI_DESVH RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
          Length = 366

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 156/368 (42%), Positives = 234/368 (63%), Gaps = 8/368 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             +A  + +L+ L    +    RIKD+ +    RDNQL+GYGLVVGL GTGD  + S FT
Sbjct: 4   LLLAVALSTLLPLAMPGSAGAVRIKDIATFSGVRDNQLVGYGLVVGLGGTGDK-KESVFT 62

Query: 63  EQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGG 122
             SM ++L+ +G++    +L  KNVA+VMVTA +P  A PG+R+DV+++S+GDA+SL GG
Sbjct: 63  VSSMVNMLERMGVAVDPKQLKPKNVASVMVTARMPVSAKPGARLDVTVSSMGDATSLLGG 122

Query: 123 ILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKF 182
           +L+ T L G DG IY +AQGS+ + G   +GQ++   + I+T G I  GAI+ER +P +F
Sbjct: 123 VLLQTPLKGVDGKIYGLAQGSLALGGFSAEGQAARAQKNITTVGLIPGGAIIERGVPFEF 182

Query: 183 KDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTR 240
                L L L   DFSTA ++A+++N+    R+    A A D+ TV +  P N   +L  
Sbjct: 183 NQQDRLTLNLSTADFSTAQQVAERLNAAMGGRY----ANAVDASTVAMDVPPNYRGNLVP 238

Query: 241 LMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA 300
           LM+ VE + V  D PARV+++E+TGT+V+G +VRIS+V V++G+L V + E++QV QP  
Sbjct: 239 LMASVENIEVAPDAPARVVVDEKTGTVVLGRDVRISRVAVAHGSLQVTVQESQQVSQPAP 298

Query: 301 FSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAG 360
           F S G TV    T++ V +      +I+   L  L+ G+N+IG     +ISIL+ +KAAG
Sbjct: 299 F-SQGQTVVTPQTNVNVREENRRLMMIEGATLQELVDGLNAIGATPRDLISILRAMKAAG 357

Query: 361 ALQSEIII 368
           AL +E+ +
Sbjct: 358 ALHAELEV 365


>gi|167617590|ref|ZP_02386221.1| flagellar basal body P-ring protein [Burkholderia thailandensis
           Bt4]
 gi|257140544|ref|ZP_05588806.1| flagellar basal body P-ring protein [Burkholderia thailandensis
           E264]
 gi|284159410|ref|YP_440805.3| flagellar basal body P-ring protein [Burkholderia thailandensis
           E264]
 gi|83653620|gb|ABC37683.1| flagellar P-ring protein FlgI [Burkholderia thailandensis E264]
          Length = 401

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 145/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 46  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 105

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 106 GAGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 165

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 166 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 225

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +N+     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 226 LNDMDYGTAQRIVSAVNA----SFGAGTAMALDGRTIQLTAPADSAQQVAFMARLQNLEV 281

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    +++GNL+V +     V QP  F SNG TV 
Sbjct: 282 SPEKAAAKVILNARTGSIVMNQMVTLQNCAIAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 340

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 341 AQQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|114765251|ref|ZP_01444383.1| flagellar P-ring protein precursor [Pelagibaca bermudensis
           HTCC2601]
 gi|114542386|gb|EAU45414.1| flagellar P-ring protein precursor [Roseovarius sp. HTCC2601]
          Length = 370

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 165/373 (44%), Positives = 233/373 (62%), Gaps = 9/373 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M      L         + A    RIKD+ + +  R+NQL+GYGLVVGL GTGDSLR+SP
Sbjct: 1   MRIAACLLALIGALSLALPALADVRIKDIATFEGVRENQLVGYGLVVGLNGTGDSLRNSP 60

Query: 61  FTEQSMRSLLQNLGI-STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FTE+S+ ++L+ LG+ +     + + N AAVMVTA LPPFA  GS IDV ++SLGDA+SL
Sbjct: 61  FTEKSIEAMLERLGVGNLSDDNIKTTNTAAVMVTAMLPPFARLGSTIDVVVSSLGDATSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L++T L GADG +YAVAQG + V+G    G ++S  EG+ T  +I NGA VE E+ 
Sbjct: 121 RGGTLIVTPLTGADGEVYAVAQGPIAVAGFSATGVAASITEGVPTVARIENGATVENEVD 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSK--PTNID 237
            +      + + LRNPDF+TA+R++D IN     R     +   DS TV+++       D
Sbjct: 181 FQLSSLNSVRITLRNPDFTTAVRMSDAIND----RLGGNSSRVLDSGTVELAIQGAGKGD 236

Query: 238 LTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
           +  ++SEVE L +E D+ A+V+++ +TGTIVIG NVRI +V VS G LTV + E+  V Q
Sbjct: 237 VPGVLSEVENLRLEPDSIAKVVVDAKTGTIVIGANVRIDRVAVSQGGLTVMVREDPVVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDA--PDLNSLISGMNSIGLKTDGIISILQG 355
           PN  +  G+TV    T + V + +  F++++     L  L+  +N+IGL     ISILQ 
Sbjct: 297 PNPITIGGTTVVVPRTTVGVEEQEAHFTILEGADVSLQRLVDALNAIGLSAMQTISILQA 356

Query: 356 IKAAGALQSEIII 368
           IKAAGAL +++ I
Sbjct: 357 IKAAGALHADLEI 369


>gi|16760057|ref|NP_455674.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29142172|ref|NP_805514.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|224584315|ref|YP_002638113.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|22095705|sp|Q8Z7K2|FLGI_SALTI RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|254789296|sp|C0Q827|FLGI_SALPC RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|25323476|pir||AF0640 flagellar P-ring protein precursor [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16502351|emb|CAD08305.1| flagellar P-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137802|gb|AAO69363.1| flagellar P-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|224468842|gb|ACN46672.1| flagellar P-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|320086379|emb|CBY96152.1| Flagellar P-ring protein 2 Basal body P-ring protein 2; Flags:
           Precursor [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|323129451|gb|ADX16881.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|326623704|gb|EGE30049.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 367

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 144/370 (38%), Positives = 216/370 (58%), Gaps = 8/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             +   +  ++     +     RI+D+ S+Q  R+N LIGYGLVVGL GTGD    +PFT
Sbjct: 1   MYVFKALAGIVLALVATLAHAERIRDLTSVQGVRENSLIGYGLVVGLDGTGDQTTQTPFT 60

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            Q++ ++L  LGI+ P G  +  KNVAAVMVTA+ PPFA  G  IDV ++S+G+A SLRG
Sbjct: 61  TQTLNNMLSQLGITVPTGTNMQLKNVAAVMVTASYPPFARQGQTIDVVVSSMGNAKSLRG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L G D  +YA+AQG+++V G       SS       GG+I NGAI+ERELP +
Sbjct: 121 GTLLMTPLKGVDSQVYALAQGNILVGGAGASAGGSSVQVNQLNGGRITNGAIIERELPTQ 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTR 240
           F     + LQL + DF+ A +I D IN           A A D+RTV+V  P+ N    R
Sbjct: 181 FGAGNTINLQLNDEDFTMAQQITDAINRAR----GYGSATALDARTVQVRVPSGNSSQVR 236

Query: 241 LMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +++++ + V  T   A+V+IN RTG++V+   V +    V+ GNL+V +     V QPN
Sbjct: 237 FLADIQNMEVNVTPQDAKVVINSRTGSVVMNREVTLDSCAVAQGNLSVTVNRQLNVNQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
                G TV    T + +  + GS   +  + +LNS++  +N++G     ++SILQ +++
Sbjct: 297 TPFGGGQTVVTPQTQIDLRQSGGSLQSVRSSANLNSVVRALNALGATPMDLMSILQSMQS 356

Query: 359 AGALQSEIII 368
           AG L++++ I
Sbjct: 357 AGCLRAKLEI 366


>gi|284007171|emb|CBA72455.1| flagellar basal body P-ring protein FlgI [Arsenophonus nasoniae]
          Length = 369

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 138/356 (38%), Positives = 210/356 (58%), Gaps = 8/356 (2%)

Query: 17  EISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGIS 76
             S     RI+D+ S++  R+N LIGYGLVVGL GTGD    +PFT QSM ++L  LGI+
Sbjct: 17  CSSMVPAERIRDLTSIEGVRENALIGYGLVVGLDGTGDQTSQTPFTTQSMSNMLSQLGIT 76

Query: 77  TPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
            P G  +  KNVAAVM+TA LPPF   G  IDV ++SLG+A SLRGG L+MT L GAD  
Sbjct: 77  VPPGTNMQLKNVAAVMITAKLPPFGRAGQTIDVVVSSLGNAKSLRGGTLLMTPLKGADNQ 136

Query: 136 IYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           +YAVAQG++VV G       SS       GG+I  GA++EREL  +F     L LQL   
Sbjct: 137 VYAVAQGNIVVGGAGASAGGSSIKVNQLAGGRISAGAVIERELASQFGKINTLNLQLNEE 196

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVEMLTVETDT 254
           +FS A  I+D +N           A   D+RTV++  P    +  R +++++ + +++  
Sbjct: 197 NFSLAQTISDAVNRIK----GFGTATPLDARTVELRLPASQSEQVRFLAQIQNINIKSVP 252

Query: 255 -PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNT 313
             A++I+N RTG++V+  +V +    +S G L++ +     V QP+   + G TV   NT
Sbjct: 253 IDAKIILNARTGSVVMNRSVMLDNCAISQGGLSITVDRRVNVSQPDTPFAGGKTVVTRNT 312

Query: 314 DLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           D+ +++   G   +  + +LN +I  +N++G     ++SILQ +++AG L++++ I
Sbjct: 313 DISLNEKHDGLHKVNASANLNEVIRALNALGATPTDLMSILQAMESAGCLRAKLEI 368


>gi|22127323|ref|NP_670746.1| flagellar basal body P-ring protein [Yersinia pestis KIM 10]
 gi|45442800|ref|NP_994339.1| flagellar basal body P-ring protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108809051|ref|YP_652967.1| flagellar basal body P-ring protein [Yersinia pestis Antiqua]
 gi|108810752|ref|YP_646519.1| flagellar basal body P-ring protein [Yersinia pestis Nepal516]
 gi|145597821|ref|YP_001161897.1| flagellar basal body P-ring protein [Yersinia pestis Pestoides F]
 gi|150260245|ref|ZP_01916973.1| lateral flagellar basal body P-ring protein [Yersinia pestis
           CA88-4125]
 gi|162420855|ref|YP_001604843.1| flagellar basal body P-ring protein [Yersinia pestis Angola]
 gi|165924943|ref|ZP_02220775.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165939047|ref|ZP_02227599.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166008946|ref|ZP_02229844.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211846|ref|ZP_02237881.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167398443|ref|ZP_02303967.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419183|ref|ZP_02310936.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425087|ref|ZP_02316840.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167466333|ref|ZP_02331037.1| flagellar P-ring protein FlgI [Yersinia pestis FV-1]
 gi|229837412|ref|ZP_04457575.1| Flagellar P-ring protein flgI [Yersinia pestis Pestoides A]
 gi|229840627|ref|ZP_04460786.1| Flagellar P-ring protein flgI [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229842822|ref|ZP_04462974.1| Flagellar P-ring protein flgI [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229900949|ref|ZP_04516073.1| Flagellar P-ring protein flgI [Yersinia pestis Nepal516]
 gi|270487668|ref|ZP_06204742.1| flagellar P-ring protein FlgI [Yersinia pestis KIM D27]
 gi|21960404|gb|AAM86997.1|AE013948_5 putative flagella basal body protein [Yersinia pestis KIM 10]
 gi|45437666|gb|AAS63216.1| putative flagella basal body protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108774400|gb|ABG16919.1| flagellar P-ring protein [Yersinia pestis Nepal516]
 gi|108780964|gb|ABG15022.1| putative flagellar P-ring protein [Yersinia pestis Antiqua]
 gi|145209517|gb|ABP38924.1| flagellar P-ring protein [Yersinia pestis Pestoides F]
 gi|149289653|gb|EDM39730.1| lateral flagellar basal body P-ring protein [Yersinia pestis
           CA88-4125]
 gi|162353670|gb|ABX87618.1| flagellar P-ring protein FlgI [Yersinia pestis Angola]
 gi|165913003|gb|EDR31628.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165923143|gb|EDR40294.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165992285|gb|EDR44586.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206592|gb|EDR51072.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166963177|gb|EDR59198.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167050947|gb|EDR62355.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055850|gb|EDR65631.1| flagellar P-ring protein FlgI [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229682288|gb|EEO78380.1| Flagellar P-ring protein flgI [Yersinia pestis Nepal516]
 gi|229690089|gb|EEO82146.1| Flagellar P-ring protein flgI [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229696993|gb|EEO87040.1| Flagellar P-ring protein flgI [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229705535|gb|EEO91545.1| Flagellar P-ring protein flgI [Yersinia pestis Pestoides A]
 gi|270336172|gb|EFA46949.1| flagellar P-ring protein FlgI [Yersinia pestis KIM D27]
 gi|320016707|gb|ADW00279.1| Flagellar P-ring protein flgI [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 391

 Score =  353 bits (905), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 138/373 (36%), Positives = 207/373 (55%), Gaps = 11/373 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           ++ +       L     +       +  +V +Q  R NQL+GY LVVGL G+GD      
Sbjct: 24  VLIKTRHCFVLLGLWLVLPTASAQPLGSLVDIQGVRGNQLVGYSLVVGLDGSGDK-NQVK 82

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QSM ++L+  G+  P       KNVAAV ++A LPP    G  ID++++S+GDA SL
Sbjct: 83  FTGQSMANMLRQFGVQLPEKMDPKVKNVAAVAISATLPPGYGRGQSIDITVSSIGDAKSL 142

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVEREL 178
           RGG L++T L GADG +YA+AQG+VVV G+  +G   SS      T G+I NGA +ER++
Sbjct: 143 RGGTLLLTQLRGADGEVYALAQGNVVVGGIKAEGDSGSSVTVNTPTVGRIPNGASIERQI 202

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID- 237
           P  F+ +  ++L L+ P F +A  +A  +N      F    A A  +  V V+ P +   
Sbjct: 203 PSDFQTNNQVVLNLKRPSFKSANNVALALNRA----FGANTATAQSATNVMVNAPQDAGA 258

Query: 238 LTRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
               MS +E + +   +   RV+ N RTGT+VIG+ V +    VS+GNLTV I E + V 
Sbjct: 259 RVAFMSLLEDVQINAGEQSPRVVFNARTGTVVIGEGVMVRAAAVSHGNLTVNIREQKNVS 318

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQG 355
           QPN     G TVT   +D++V+  K     +     L S+++ +NS+G   D I++ILQ 
Sbjct: 319 QPNPL-GGGKTVTTPESDIEVTKGKNQMVMVPAGTRLRSIVNTINSLGASPDDIMAILQA 377

Query: 356 IKAAGALQSEIII 368
           +  AGAL +E+++
Sbjct: 378 LYEAGALDAELVV 390


>gi|258592557|emb|CBE68866.1| Flagellar P-ring protein (basal body P-ring protein) [NC10
           bacterium 'Dutch sediment']
          Length = 372

 Score =  353 bits (905), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 150/373 (40%), Positives = 225/373 (60%), Gaps = 12/373 (3%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M+  I  ++ ++       A   +RIKD+  +Q  R+N+L GYGLVVGL GTGD      
Sbjct: 6   MVAVIVTVLSAVTATLPAPAMAEARIKDIAKIQGVRENELFGYGLVVGLAGTGDRA-QVT 64

Query: 61  FTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           FT Q++ S+L+ LGI+ P  RL  KNVAAVMVTA LPPFA  GS +DV+++S+GDA++L+
Sbjct: 65  FTIQAVVSMLKKLGITVPAERLTLKNVAAVMVTAKLPPFAKAGSTLDVTVSSMGDATNLQ 124

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLF--VKGQSSSFMEGISTGGKIVNGAIVEREL 178
           GG+L++T L  ADG +YAVAQG++ + G      G      +   T G++ NGAIVERE 
Sbjct: 125 GGMLLITPLQAADGQVYAVAQGAISIGGFNFEAGGTGEKVQKNHPTVGRVPNGAIVEREP 184

Query: 179 PKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-- 236
              F  +  L+L L NPDF+TAIR+A  +              A D+ TV++  P +   
Sbjct: 185 SADFLKAQQLLLVLTNPDFTTAIRMAQAVGHSLGAET-----RAKDASTVEIRVPDSYLA 239

Query: 237 DLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVV 296
           +   L++ +E L++  D  A+V++NERTGTI++G  VRIS V V++ NL++QI     V 
Sbjct: 240 NPVELIAAIENLSLVPDMTAKVVVNERTGTIIMGSQVRISTVAVAHSNLSLQIRSELLVS 299

Query: 297 QPNAFSSNGSTVTQNNTDLKVSDNKGSFSLI-DAPDLNSLISGMNSIGLKTDGIISILQG 355
           QP    S G T     T+++  +++   +L+ +   +  +I  +N++ +    +IS+LQ 
Sbjct: 300 QPAPL-SEGKTTVVPRTEIEAREDRTRVNLMGEGVSIGDVIKALNALAVTPRDMISLLQA 358

Query: 356 IKAAGALQSEIII 368
           IKAAGALQ E+ I
Sbjct: 359 IKAAGALQGELQI 371


>gi|299068736|emb|CBJ39975.1| FlgI: Flagellar P-ring protein ; signal peptide [Ralstonia
           solanacearum CMR15]
          Length = 369

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 136/353 (38%), Positives = 199/353 (56%), Gaps = 9/353 (2%)

Query: 20  AQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPG 79
                RIKD+ ++   R+N LIGYGLVVGL G+GD    +PFT QS  ++L   GI+ P 
Sbjct: 21  TAHADRIKDLTTIAGVRENALIGYGLVVGLDGSGDQTTQTPFTIQSFNNMLSQFGINVPS 80

Query: 80  G-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYA 138
           G  +  KN AAV+VTA+LP F  PG  IDV+++S+G+A SLRGG L++T L G DG +YA
Sbjct: 81  GASIQLKNTAAVVVTASLPAFVRPGQTIDVTVSSIGNAKSLRGGTLLLTPLKGVDGQLYA 140

Query: 139 VAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFS 198
           +AQG+VV+ G       S         G+I NGA VER +     ++  + L     DF 
Sbjct: 141 LAQGNVVIGGAGASANGSKVQINQLGAGRIANGATVERTVQATVGEAGSIQLDTGTTDFG 200

Query: 199 TAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTRLMSEVEMLTVET-DTPA 256
           T   I + IN     +F    AEA D RTV V  P    D    +++++ + V      A
Sbjct: 201 TVQNIVNAINK----QFGADTAEAADGRTVNVRAPALAADRVGFVAKLQNIDVTPAQAAA 256

Query: 257 RVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLK 316
           RV++N RTG++V+   V++    V++GNL+V I+    V QP  F S G TV    ++++
Sbjct: 257 RVVVNARTGSVVMNQQVKLEPCAVAHGNLSVTISTEPVVSQPAPF-SQGQTVAGARSNIE 315

Query: 317 VSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           V    GS   +    +L  ++  +N+IG     +ISILQ +KAA AL++++ I
Sbjct: 316 VKQQGGSLINVKGGTNLADVVKAINAIGANPQDLISILQAMKAANALRADLEI 368


>gi|237755440|ref|ZP_04584065.1| flagellar P-ring protein FlgI [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237692404|gb|EEP61387.1| flagellar P-ring protein FlgI [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 363

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 137/365 (37%), Positives = 202/365 (55%), Gaps = 11/365 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           ++ +++ +  +S     +I+D V ++  R N L GYG+VVGL GTGD    S +T  S+ 
Sbjct: 5   VLIAIVLITSLSFATEVKIRDEVYVEGFRPNYLTGYGIVVGLNGTGDGTT-SRYTLISIA 63

Query: 68  SLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           ++L+ LGI     ++ +KN AAVMVTANLPPFA PG  IDV + S+GDA  +  G+L+ T
Sbjct: 64  NMLRKLGIYIDPTQVRTKNAAAVMVTANLPPFAKPGMAIDVQVASIGDAKDIANGLLIRT 123

Query: 128 SLLGADGNIYAVAQGSVVVSG-LFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
            L G DG IYA AQG V   G      +     +G  T G I NGAIVE ELP  F    
Sbjct: 124 PLYGPDGKIYAFAQGPVSTGGGFLESNKGGKVQKGFPTAGIIPNGAIVEEELPFDFNSMT 183

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVE 246
           ++ L L+NP FS A  IA  IN          +A   D  ++KV  P   + T  ++E+ 
Sbjct: 184 EVTLSLKNPSFSKAQEIAKVINQKY-----PGLAVVQDPTSIKVRLPQTKNKTEFLAEIL 238

Query: 247 MLTVETDTP--ARVIINERTGTIVIGDNVRIS-KVVVSYGNLTVQITENEQVVQPNAFSS 303
            L ++TD      ++  E+TGT+++  +V I   V VS+G++ V + +   + QP    S
Sbjct: 239 DLKIKTDKDNVPTIVFYEKTGTVIMSGDVVIDTPVYVSHGSIYVTVEKTPVISQPPPL-S 297

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
           +G TV       KV + KG    I++  L+ L+  +N +G+    +I+ILQ IKAAG L 
Sbjct: 298 DGQTVVTQGVTTKVQEEKGRIISIESAKLSDLVKALNDLGVSPYDLIAILQAIKAAGKLH 357

Query: 364 SEIII 368
           +EI +
Sbjct: 358 AEIKV 362


>gi|225849138|ref|YP_002729302.1| flagellar P-ring protein FlgI [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643750|gb|ACN98800.1| flagellar P-ring protein FlgI [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 372

 Score =  352 bits (904), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 141/370 (38%), Positives = 205/370 (55%), Gaps = 10/370 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +F+   ++   I L    A    +I+D+V ++  R N L GYG+VVGL GTGD    S +
Sbjct: 9   MFKKIIVLLLFISLTTFGATNEIKIRDLVEVEGFRTNYLTGYGIVVGLNGTGDGTT-SRY 67

Query: 62  TEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
           T  S+ ++L+ LGI     ++ +KN AAV+VTANLPPFA PG  +DV + SLGDA  +R 
Sbjct: 68  TLISIANMLRKLGIYIDPAQVRTKNAAAVIVTANLPPFAKPGMSVDVQVASLGDAKDIRN 127

Query: 122 GILVMTSLLGADGNIYAVAQGSVVV-SGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           G+L+ T L G DG IYA AQG V    G     ++    +G +T G I NGA++E ELP 
Sbjct: 128 GLLIRTPLYGPDGKIYAFAQGPVSTGGGFSESNKTGKVQKGFTTAGIIPNGAVIEEELPF 187

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTR 240
            F    ++ L L+NPDF  +  IA+ IN          IA   D+ +VKV  P       
Sbjct: 188 DFNSLTEITLNLKNPDFKRSTLIAETINKKY-----PNIANVLDATSVKVKLPDGSSKAE 242

Query: 241 LMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRIS-KVVVSYGNLTVQITENEQVVQP 298
            ++ +  L V  DT    ++I E+TGT+++  +++I   V VS+GN+ V +     V QP
Sbjct: 243 FLASILDLKVSLDTDYPTIVIYEKTGTVIMSGDIKIDPPVYVSHGNIYVSVETIPLVSQP 302

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
               S G TVT   T  KV + KG    I+ P L  L+  +N +G+    +I+I+Q IK+
Sbjct: 303 PPL-SGGQTVTAQKTITKVVEEKGRIIEIEKPSLKDLVKALNDLGVSPYDLIAIIQAIKS 361

Query: 359 AGALQSEIII 368
           AG + + III
Sbjct: 362 AGKINANIII 371


>gi|322435949|ref|YP_004218161.1| flagellar P-ring protein [Acidobacterium sp. MP5ACTX9]
 gi|321163676|gb|ADW69381.1| flagellar P-ring protein [Acidobacterium sp. MP5ACTX9]
          Length = 398

 Score =  352 bits (904), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 140/354 (39%), Positives = 213/354 (60%), Gaps = 7/354 (1%)

Query: 16  HEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGI 75
             ++    +R+KD+ S++  RDNQL+GYGLVVGL GTGDS + + F  Q++ ++L  +G+
Sbjct: 50  AMVTPVRQARVKDIASIEGIRDNQLVGYGLVVGLNGTGDS-QQTTFPTQTLSAILLRMGV 108

Query: 76  STPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGN 135
           S P   +  +N+AAV V A+LPPFA PG+++D++++S GDA SL GG+L+MT L GADG 
Sbjct: 109 SVPASAIKVQNLAAVFVAASLPPFARPGTKLDITVSSAGDARSLEGGLLLMTPLYGADGK 168

Query: 136 IYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNP 195
           IYA AQG +V+ G  V    S+      T  ++  GA  ER +  + +      + L + 
Sbjct: 169 IYAQAQGPLVLGGYSVTANGSTKSLNHPTTARVPFGATAERGVALELEGRRQFSILLNDE 228

Query: 196 DFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTP 255
           DF +A  +A+ IN       +RP+A+AYDSR V+++ P   D+  L+S VE + V     
Sbjct: 229 DFHSAEAMAEAINK----DLARPLAKAYDSRRVELAVPAGEDVPMLLSRVEAVQVSLYPR 284

Query: 256 ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDL 315
           A+VI+NERTGT+VIG  V +  V + +G L V +  +  V QP  F SNG+T T   T +
Sbjct: 285 AKVIVNERTGTVVIGGTVVLQPVSILHGGLAVNVVTDFNVSQPGPF-SNGTTTTVPVTRI 343

Query: 316 KVSDNK-GSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
           +  D       L     ++ L+  + +IG     +ISILQ +K+AGAL++EI +
Sbjct: 344 EAHDKPVSRIELKQGATVDDLVRSLQTIGASARDVISILQAMKSAGALEAEIEV 397


>gi|167579493|ref|ZP_02372367.1| flagellar basal body P-ring protein [Burkholderia thailandensis
           TXDOH]
          Length = 401

 Score =  352 bits (904), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 145/360 (40%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 46  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 105

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA PG  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 106 GAGSSAMTNMQLKNVAAVMVTATLPPFARPGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 165

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 166 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 225

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +N+     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 226 LNDMDYGTAQRIVSAVNA----SFGAGTAMALDGRTIQLTAPADSAQQVAFMARLQNLEV 281

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    +++GNL+V +     V QP  F SNG TV 
Sbjct: 282 SPEKAAAKVILNARTGSIVMNQMVTLQNCAIAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 340

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 341 AQQSQIQLKQDNGSLRMVTAGANLAEVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|188997554|ref|YP_001931805.1| flagellar P-ring protein [Sulfurihydrogenibium sp. YO3AOP1]
 gi|254789298|sp|B2V6R9|FLGI_SULSY RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|188932621|gb|ACD67251.1| flagellar P-ring protein [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 363

 Score =  352 bits (903), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 136/365 (37%), Positives = 200/365 (54%), Gaps = 11/365 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           ++ +++ +   S     +I+D V ++  R N L GYG+VVGL GTGD    S +T  S+ 
Sbjct: 5   VLIAIVFITSFSFAAEVKIRDEVYVEGFRPNYLTGYGIVVGLNGTGDGTT-SRYTLISIA 63

Query: 68  SLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMT 127
           ++L+ LGI     ++ +KN AAVMVTANLPPFA PG  IDV + S+GDA  +  G+L+ T
Sbjct: 64  NMLRKLGIYIDPAQVRTKNAAAVMVTANLPPFAKPGMAIDVQVASIGDAKDIVNGLLIRT 123

Query: 128 SLLGADGNIYAVAQGSVVV-SGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSA 186
            L G DG IYA AQG V    G     +     +G  T G I NGAIVE ELP  F    
Sbjct: 124 PLYGPDGKIYAFAQGPVSTGGGFLESNKGGKVQKGFPTAGIIPNGAIVEEELPFDFNSMT 183

Query: 187 DLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDLTRLMSEVE 246
           ++ L L+NP FS A  I + IN          +A   D  ++KV  P   + T  ++E+ 
Sbjct: 184 EVTLSLKNPSFSKAQEIVNVINQKY-----PGLAVVQDPTSIKVRLPQTKNKTEFLAEIL 238

Query: 247 MLTVETDTP--ARVIINERTGTIVIGDNVRIS-KVVVSYGNLTVQITENEQVVQPNAFSS 303
            L ++TD      ++  E+TGT+++  +V I   V VS+G++ V + +   + QP    S
Sbjct: 239 DLKIKTDKDNIPTIVFYEKTGTVIMSGDVAIDTPVYVSHGSIYVTVEKTPVISQPPPL-S 297

Query: 304 NGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQ 363
            G TV       KV + KG    I++  L+ L+  +N +G+    +I+ILQ IKAAG L 
Sbjct: 298 GGQTVVTEGVTTKVQEEKGRIISIESAKLSDLVKALNDLGVSPYDLIAILQAIKAAGKLH 357

Query: 364 SEIII 368
           +EI +
Sbjct: 358 AEIKV 362


>gi|319764543|ref|YP_004128480.1| flagellar p-ring protein [Alicycliphilus denitrificans BC]
 gi|330826759|ref|YP_004390062.1| flagellar P-ring protein [Alicycliphilus denitrificans K601]
 gi|317119104|gb|ADV01593.1| flagellar P-ring protein [Alicycliphilus denitrificans BC]
 gi|329312131|gb|AEB86546.1| flagellar P-ring protein [Alicycliphilus denitrificans K601]
          Length = 381

 Score =  352 bits (903), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 143/349 (40%), Positives = 203/349 (58%), Gaps = 10/349 (2%)

Query: 25  RIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGR--L 82
           RIK+V ++Q  R NQL GYGLVVGL GTGD     P T Q+M++ LQ  GIS P G    
Sbjct: 37  RIKEVAAVQGVRSNQLTGYGLVVGLDGTGDQTTQMPITTQAMQNYLQQAGISLPAGTTAP 96

Query: 83  GSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQG 142
             KNVA V+VTA LPPFA PG  IDVS+ S+G+A SL+GG L+ T L GADG IYA+AQG
Sbjct: 97  QLKNVATVIVTAELPPFAQPGQAIDVSVASMGNAKSLKGGTLIATPLRGADGEIYALAQG 156

Query: 143 SVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIR 202
           ++VV G       S       + G+I  GA VER +P    D   + L L   DF TA +
Sbjct: 157 NMVVGGAGASAGGSKVQINHLSAGRIPGGAQVERSVPTPLHDGETITLGLNASDFQTARK 216

Query: 203 IADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI-DLTRLMSEVEMLTVETDTP-ARVII 260
           +A  IN+    R    +A A D RTV+V  P +       ++E+E L +   TP A+V+I
Sbjct: 217 VASTINT----RIGSGLATALDGRTVQVRAPMDPGSRVNFIAELEELPLPDSTPAAKVVI 272

Query: 261 NERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDN 320
           N RTG+IV+   V +    +++GNL++ I+    + QP    S G TV    +D+++  +
Sbjct: 273 NARTGSIVLNQAVTLGPCAIAHGNLSITISSTPVISQPAPL-SQGQTVVAQKSDIQLKQD 331

Query: 321 KGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
            G    +  +P L  ++  +N++G     +++ILQ IKA+GAL +E+ +
Sbjct: 332 GGKVIQVPASPQLADVVRALNTLGATPQDLLAILQAIKASGALNAELEV 380


>gi|327478813|gb|AEA82123.1| flagellar basal body P-ring protein [Pseudomonas stutzeri DSM 4166]
          Length = 365

 Score =  352 bits (903), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 148/366 (40%), Positives = 211/366 (57%), Gaps = 11/366 (3%)

Query: 8   LIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMR 67
           L  + + L          + D+V ++  R NQLIGYGLVVGL GTGD      FT  S+ 
Sbjct: 5   LFLAAVALCWQLPAQAVPLMDLVDIEGIRGNQLIGYGLVVGLDGTGDK-NQVKFTSHSVA 63

Query: 68  SLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVM 126
           ++++  GI+ P       KNVAAV VTA +PP  SPG  +DV+++SLGDA SLRGG L+M
Sbjct: 64  NMIKQFGINLPPNVDPKLKNVAAVTVTATVPPSYSPGQSVDVTVSSLGDAKSLRGGQLLM 123

Query: 127 TSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELPKKFKDS 185
           T L G DG +YAVAQG++VV G+  +G   S      S  G I NGA VER +P  F + 
Sbjct: 124 TPLQGVDGEVYAVAQGALVVGGVNAEGASGSKVAINTSNSGLIPNGATVERMIPTDFTER 183

Query: 186 ADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP-TNIDLTRLMSE 244
            +++L +R P F T  R+ D I+ Y    F +  A A ++  V +  P T+      M+ 
Sbjct: 184 PEVMLNVRQPSFQTVTRVVDAIDGY----FGKGTATALNATKVSIRAPVTSTQRMSFMAM 239

Query: 245 VEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSS 303
           +E L VE      +V+ N RTGT+V+G+ VR+    V++G+LTV I+E  QV QP  F S
Sbjct: 240 LERLDVEEGRVRPKVVFNSRTGTVVVGEGVRVKAAAVAHGSLTVTISERPQVSQPGPF-S 298

Query: 304 NGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGAL 362
            G T     +D+ V  + K  F   +   L S+I+ +NS+G   D ++SILQ ++ AGAL
Sbjct: 299 QGQTAVVPQSDVSVEQDRKAMFKWPEGASLESIINTINSLGATPDDVMSILQSLERAGAL 358

Query: 363 QSEIII 368
            +E+I+
Sbjct: 359 NAELIV 364


>gi|254460610|ref|ZP_05074026.1| flagellar P-ring protein FlgI [Rhodobacterales bacterium HTCC2083]
 gi|206677199|gb|EDZ41686.1| flagellar P-ring protein FlgI [Rhodobacteraceae bacterium HTCC2083]
          Length = 365

 Score =  352 bits (903), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 135/370 (36%), Positives = 212/370 (57%), Gaps = 18/370 (4%)

Query: 11  SLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLL 70
            L      +     RIKD+ S+   R NQL+GYGLVVGL GTGD       T QS++S++
Sbjct: 1   MLFTFWGANGVYADRIKDLASIAGVRTNQLVGYGLVVGLSGTGDGD--LGITLQSLQSMV 58

Query: 71  QNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLL 130
              G+ T    L   N AAV+VTA+LP F  PG  +DV++++LG + SLRGG L+MT LL
Sbjct: 59  SRFGMVTEADGLDGSNAAAVIVTADLPAFVKPGQTLDVTVSALGSSESLRGGTLLMTPLL 118

Query: 131 GADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIVERELPKKFKDSADLI 189
           G DG  YA+AQG+++V G+ V G   SS    + T G++  GA VE+ +   F  +  LI
Sbjct: 119 GVDGETYAIAQGNLLVGGMGVSGADGSSLTVNVPTVGRVPQGANVEKMVENPFITNDYLI 178

Query: 190 LQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNIDL-TRLMSEVEML 248
           L L   DFSTA  +AD IN      F    A   D+ +++V  P+++       S +E +
Sbjct: 179 LNLHLADFSTATNVADAINVV----FGGDTAVPIDASSIRVLAPSDMSQKVSFASLIEQV 234

Query: 249 TVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNA------- 300
            V+  + PA++I+N RTGT+VIG NV ++  V+++G+LTV+I E+ +V   N        
Sbjct: 235 EVQPAEPPAQIIVNSRTGTVVIGGNVNVTPAVITHGSLTVRIREDVEVTPTNETIILDGA 294

Query: 301 -FSSNGSTVTQNNTDLKVSDN-KGSFSLIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
             ++ G  +   +T++ + +    +F       L+ ++  +N+IG     +++IL+ +K 
Sbjct: 295 IVNAPGDPIETADTEIAIDEPIARAFLFNPGVSLSDVVDSINAIGATPSDLVAILEALKV 354

Query: 359 AGALQSEIII 368
           AGAL++++II
Sbjct: 355 AGALRAQLII 364


>gi|313894933|ref|ZP_07828492.1| flagellar P-ring protein FlgI [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312976386|gb|EFR41842.1| flagellar P-ring protein FlgI [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 370

 Score =  352 bits (903), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 145/363 (39%), Positives = 209/363 (57%), Gaps = 10/363 (2%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           +F        +   V+R+KD+  +Q  R NQL+GYGLVVGL GTGD   SS  T QS+ +
Sbjct: 14  VFGTFPGIVSAESAVTRLKDISKVQGVRSNQLMGYGLVVGLNGTGDGS-SSGETLQSIAN 72

Query: 69  LLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTS 128
           +L + GI+     +  KN AAVMVTANLPPF   G  +DV+++S+GDA SLRGG L+ T 
Sbjct: 73  MLISYGINVNTSSIKLKNAAAVMVTANLPPFVREGDALDVTVSSIGDAKSLRGGTLLQTP 132

Query: 129 LLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADL 188
           L   +G +Y VAQG+V   G       SS      T G  VN  IVER +         +
Sbjct: 133 LRAGNGEVYVVAQGAVSTGGFTAGSGGSSMQAAFPTVGIAVNAGIVERTVEDDIGGDGRI 192

Query: 189 ILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVE 246
            + L   DF+TA R+A  IN+   N     IA+A ++  V VS P+    ++   ++ +E
Sbjct: 193 SISLSRADFTTASRVAGAINAQYGN-----IAQAANAGRVDVSIPSYYRGNVVSFIASLE 247

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            L +  D  ARV++NERTGTI++G +V +  V ++ G +T++I  N  V QP  F S G+
Sbjct: 248 ELPIRPDNMARVVVNERTGTIIMGGDVSVDAVAITQGGITIRIQANPDVSQPGPF-SYGN 306

Query: 307 TVTQNNTDLKVSDNKGSFSLIDAPD-LNSLISGMNSIGLKTDGIISILQGIKAAGALQSE 365
           TV   N D+ VS+ KGS  ++ A   ++ ++  +N++G      ISILQ +KAAGAL +E
Sbjct: 307 TVVTENPDVSVSEAKGSTIVLPATTNVSDIVGALNTVGATPRDTISILQAMKAAGALHAE 366

Query: 366 III 368
           + I
Sbjct: 367 LEI 369


>gi|124268250|ref|YP_001022254.1| flagellar basal body P-ring protein [Methylibium petroleiphilum
           PM1]
 gi|124261025|gb|ABM96019.1| flagellar basal-body P-ring protein [Methylibium petroleiphilum
           PM1]
          Length = 384

 Score =  352 bits (903), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 144/371 (38%), Positives = 217/371 (58%), Gaps = 9/371 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           +     L  +   +        +R+K+V ++Q  R NQLIGYGLVVGL GTGD    +PF
Sbjct: 18  LLIAFSLFIASAAVWWPVDAQAARLKEVAAVQGVRSNQLIGYGLVVGLDGTGDQTTQTPF 77

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QS+ ++LQ LG++ P G  +  +NVAAVMVTA+LPPFA PG +ID++++S+G+A SLR
Sbjct: 78  TTQSLNAMLQQLGVTVPPGTSVQLRNVAAVMVTASLPPFAQPGQQIDINVSSMGNAKSLR 137

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPK 180
           GG LV+T L GADG IYA+AQG++++ G       S         G++  GA VER +P 
Sbjct: 138 GGTLVVTPLRGADGQIYALAQGNLIIGGAGASAGGSKVQVNTLNAGRVPGGATVERGVPT 197

Query: 181 KFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-LT 239
                  + L L   D+STA  +A  INS    +     A+A D RTV+V  P + +   
Sbjct: 198 PLAQGDAIQLDLNAADYSTAREVARVINS----KMGANTAQALDGRTVRVLMPADANARV 253

Query: 240 RLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQP 298
             ++++E L ++   P ARV++N RTG++V+  +V ++   V++GNL+V I+    + QP
Sbjct: 254 AFLADIENLPIDLAAPAARVVVNARTGSVVVNQSVTLNPCAVAHGNLSVTISSQPVISQP 313

Query: 299 NAFSSNGSTVTQNNTDLKVSDNKGS-FSLIDAPDLNSLISGMNSIGLKTDGIISILQGIK 357
              SS G TV     D+ +  + GS   L     L  ++  +NS+G     +++ILQ IK
Sbjct: 314 GPLSS-GQTVVAERADIAIKQDAGSLIQLPAGTQLTDVVKALNSLGATPQELLAILQAIK 372

Query: 358 AAGALQSEIII 368
           AAGAL +E+ +
Sbjct: 373 AAGALNAELEV 383


>gi|167626159|ref|YP_001676453.1| flagellar basal body P-ring protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167356181|gb|ABZ78794.1| flagellar P-ring protein [Shewanella halifaxensis HAW-EB4]
          Length = 376

 Score =  352 bits (903), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 147/380 (38%), Positives = 216/380 (56%), Gaps = 18/380 (4%)

Query: 2   IFRIAFLIFSLIGLHEIS----AQVVSR-IKDVVSLQSGRDNQLIGYGLVVGLQGTGDSL 56
           + +IA  + S++          AQ   R + D+V +Q  RDNQL+GYGLVVGL GTGD  
Sbjct: 1   MKKIAIFMVSMLLSLSPLLPVKAQPQHRYLMDIVDVQGLRDNQLVGYGLVVGLDGTGDRT 60

Query: 57  RSSPFTEQSMRSLLQNLGISTPG-GRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGD 115
               FT QS+ ++L+  G+          KNVAAV V A +PP ASPG  +D++++SLGD
Sbjct: 61  -QVRFTSQSIVNMLKQFGVQIDDKTDPKLKNVAAVAVHATVPPLASPGQTLDITVSSLGD 119

Query: 116 ASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKG-QSSSFMEGISTGGKIVNGAIV 174
           A SLRGG L+MT +   DG IYAVAQG++VV G+  +G   +S    + T G I NGA++
Sbjct: 120 AKSLRGGTLLMTPMRAVDGEIYAVAQGNLVVGGVSAQGRNGTSVTINVPTVGSIPNGALL 179

Query: 175 ERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKP- 233
           E  +   F D+ +++L L +P F TA  I   +N      F   +A+A  S  V V  P 
Sbjct: 180 EAAMHSNFNDNENIVLNLIDPSFKTARNIERAVNEL----FGPDVAQADSSAKVIVRAPS 235

Query: 234 TNIDLTRLMSEVEMLTVETDTP-ARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITEN 292
           +N +    MS +E L +E      RV+ N RTGT+V+G +V + K  VS+GNLTV I E 
Sbjct: 236 SNRERVTFMSMLEELQIEQGRKSPRVVFNSRTGTVVMGGDVVVRKAAVSHGNLTVTIVEQ 295

Query: 293 EQVVQPNAF---SSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDG 348
           E V QPN      + G TV   ++ + + +  G  F   +   LN ++  +NS+G     
Sbjct: 296 EFVSQPNGAYLGQAQGETVVTTDSQVGIDEGNGHMFVWPEGTALNDIVRAVNSLGASPMD 355

Query: 349 IISILQGIKAAGALQSEIII 368
           +++ILQ +  AGAL++E+++
Sbjct: 356 LMAILQALNEAGALEAELVV 375


>gi|62179698|ref|YP_216115.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|75484032|sp|Q57QH7|FLGI_SALCH RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|62127331|gb|AAX65034.1| putative flagella basal body protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|322714168|gb|EFZ05739.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 367

 Score =  352 bits (903), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 144/370 (38%), Positives = 217/370 (58%), Gaps = 8/370 (2%)

Query: 3   FRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFT 62
             +   +  ++     +     RI+D+ S+Q  R+N LIGYGLVVGL GTGD    +PFT
Sbjct: 1   MYVFKALAGIVLALVATLAHAERIRDLTSVQGVRENSLIGYGLVVGLDGTGDQTTQTPFT 60

Query: 63  EQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRG 121
            Q++ ++L  LGI+ P G  +  KNVAAVMVTA+ PPFA  G  IDV ++S+G+A SLRG
Sbjct: 61  TQTLNNMLSQLGITVPTGTNMQLKNVAAVMVTASYPPFARQGQTIDVVVSSMGNAKSLRG 120

Query: 122 GILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKK 181
           G L+MT L G D  +YA+AQG+++V G+      SS       GG+I NGAI+ERELP +
Sbjct: 121 GTLLMTPLKGVDSQVYALAQGNILVGGVGASAGGSSVQVNQLNGGRITNGAIIERELPTQ 180

Query: 182 FKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDLTR 240
           F     + LQL + DF+ A +I D IN           A A D+RTV+V  P+ N    R
Sbjct: 181 FGAGNTINLQLNDEDFTMAQQITDAINRAR----GYGSATALDARTVQVRVPSGNSSQVR 236

Query: 241 LMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPN 299
            +++++ + V  T   A+V+IN RTG++V+   V +    V+ GNL+V +     V QPN
Sbjct: 237 FLADIQNMEVNVTPQDAKVVINSRTGSVVMNREVTLDSCAVAQGNLSVTVNRQLNVNQPN 296

Query: 300 AFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGIKA 358
                G TV    T + +  + GS   +  + +LNS++  +N++G     ++SILQ +++
Sbjct: 297 TPFGGGQTVVTPQTQIDLRQSGGSLQSVRSSANLNSVVRALNALGATPMDLMSILQSMQS 356

Query: 359 AGALQSEIII 368
           AG L++++ I
Sbjct: 357 AGCLRAKLEI 366


>gi|271500070|ref|YP_003333095.1| flagellar P-ring protein [Dickeya dadantii Ech586]
 gi|270343625|gb|ACZ76390.1| flagellar P-ring protein [Dickeya dadantii Ech586]
          Length = 369

 Score =  352 bits (903), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 150/372 (40%), Positives = 220/372 (59%), Gaps = 8/372 (2%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           M     F +F  + +         RI+D+V++Q  RDN LIGYGLVVGL GTGD    +P
Sbjct: 1   MRITSVFTLFLALLVMVAPPASAERIRDLVTIQGVRDNALIGYGLVVGLDGTGDQTTQTP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QS+ ++L  LGI+ P G  +  KNVAAVMVTA LPPFA  G  +DV ++S+G+A SL
Sbjct: 61  FTTQSLNNMLSQLGITVPAGTNMQLKNVAAVMVTAKLPPFARAGQAVDVVVSSMGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L+MT L G D  +YA+AQG++++ G       SS      +GG+I  GAI+ERELP
Sbjct: 121 RGGTLLMTPLKGVDNQVYAIAQGNLLIGGAGAAAGGSSVQVNQLSGGRISGGAIIERELP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPT-NIDL 238
             F     ++LQL   DF+ A  I+D IN +         A   DSRTV+V  P  N   
Sbjct: 181 NTFGTGNTIMLQLNQDDFTMAQSISDAINRFGR----GGSAAPLDSRTVRVIVPAGNSAQ 236

Query: 239 TRLMSEVEMLTVETDT-PARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
            R +++++ + V   T  A+VIIN RTG++V+  NV++    V+ GNL+V I +   V Q
Sbjct: 237 VRFLADMQNIEVNVGTLDAKVIINSRTGSVVMNRNVQLENCAVAQGNLSVTINQQNVVSQ 296

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKGSFS-LIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PN   + G TV    T++ +    G+   +  + +LNS++  +NS+G     ++SILQ +
Sbjct: 297 PNTPLAGGQTVVTPQTEISMRQEGGALQRVNSSANLNSVVRALNSLGATPMDLMSILQAM 356

Query: 357 KAAGALQSEIII 368
           ++AG L++++ I
Sbjct: 357 ESAGCLRAKLEI 368


>gi|320530440|ref|ZP_08031498.1| flagellar P-ring protein FlgI [Selenomonas artemidis F0399]
 gi|320137273|gb|EFW29197.1| flagellar P-ring protein FlgI [Selenomonas artemidis F0399]
          Length = 370

 Score =  351 bits (902), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 143/363 (39%), Positives = 208/363 (57%), Gaps = 10/363 (2%)

Query: 9   IFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRS 68
           +F        +   V+R+KD+  +Q  R NQL+GYGLVVGL GTGD   SS  T QS+ +
Sbjct: 14  VFGTFPGIVSAESAVTRLKDISKVQGVRSNQLMGYGLVVGLNGTGDGS-SSGETLQSIAN 72

Query: 69  LLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTS 128
           +L + GI+     +  KN AAVMVTA LPPF   G  +DV+++S+GDA SLRGG L+ T 
Sbjct: 73  MLISYGINVNTSSIKLKNAAAVMVTATLPPFVREGDALDVTVSSIGDAKSLRGGTLLQTP 132

Query: 129 LLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSADL 188
           L   +G +Y VAQG+V   G       S+      T G  VN  IVER +         +
Sbjct: 133 LKAGNGEVYVVAQGAVSTGGFTAGSGGSNVQAAFPTVGIAVNAGIVERTVEDDIGGDGRI 192

Query: 189 ILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNI--DLTRLMSEVE 246
            + L   DF+TA R+A  IN+   N     IA+A ++  V VS P+    ++   ++ +E
Sbjct: 193 SISLSRADFTTASRVAGAINAQYGN-----IAQAANAGRVDVSIPSYYRGNVVSFIASLE 247

Query: 247 MLTVETDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGS 306
            L +  D  ARV++NERTGTI++G +V +  V ++ G +T++I  N  V QP  F S G+
Sbjct: 248 ELPIRPDNMARVVVNERTGTIIMGGDVSVDAVAITQGGITIRIQANPDVSQPGPF-SYGN 306

Query: 307 TVTQNNTDLKVSDNKGSFSLIDAPD-LNSLISGMNSIGLKTDGIISILQGIKAAGALQSE 365
           TV   N D+ VS+ KGS  ++ A   ++ ++  +N++G      ISILQ +KAAGAL +E
Sbjct: 307 TVVTENPDVSVSEAKGSTIVLPATTNVSDIVGALNTVGATPRDTISILQAMKAAGALHAE 366

Query: 366 III 368
           + I
Sbjct: 367 LEI 369


>gi|167843914|ref|ZP_02469422.1| flagellar basal body P-ring protein [Burkholderia pseudomallei
           B7210]
          Length = 401

 Score =  351 bits (902), Expect = 8e-95,   Method: Composition-based stats.
 Identities = 146/360 (40%), Positives = 206/360 (57%), Gaps = 20/360 (5%)

Query: 24  SRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGG--- 80
            R+KD+  +Q  RDN LIGYGLVVGL GTGD    +PFT Q++ ++L NLGIS   G   
Sbjct: 46  ERLKDLAQIQGVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSAN 105

Query: 81  --------RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLRGGILVMTSLLGA 132
                    +  KNVAAVMVTA LPPFA  G  IDV+++SLG+A SLRGG L++T L GA
Sbjct: 106 GGGSSAMTNMQLKNVAAVMVTATLPPFARSGEAIDVTVSSLGNAKSLRGGTLLLTPLKGA 165

Query: 133 DGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELPKKFKDSAD-LILQ 191
           DG +YA+AQG++ V G       S         G+I  GAIVER +P         L LQ
Sbjct: 166 DGQVYALAQGNMAVGGAGASANGSRVQVNQLAAGRIAGGAIVERSVPNAVAQMNGVLQLQ 225

Query: 192 LRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTN-IDLTRLMSEVEMLTV 250
           L + D+ TA RI   +NS     F    A A D RT++++ P +       M+ ++ L V
Sbjct: 226 LNDMDYGTAQRIVSAVNS----SFGAGTATALDGRTIQLTAPADSAQQVAFMARLQNLEV 281

Query: 251 ETD-TPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQPNAFSSNGSTVT 309
             +   A+VI+N RTG+IV+   V +    V++GNL+V +     V QP  F SNG TV 
Sbjct: 282 SPERAAAKVILNARTGSIVMNQMVTLQNCAVAHGNLSVVVNTQPVVSQPGPF-SNGQTVV 340

Query: 310 QNNTDLKVSDNKGSF-SLIDAPDLNSLISGMNSIGLKTDGIISILQGIKAAGALQSEIII 368
              + +++  + GS   +    +L  ++  +NS+G     ++SILQ +KAAGAL++++ I
Sbjct: 341 AQQSQIQLKQDNGSLRMVTAGANLADVVKALNSLGATPADLMSILQAMKAAGALRADLEI 400


>gi|51597633|ref|YP_071824.1| flagellar basal body P-ring protein [Yersinia pseudotuberculosis IP
           32953]
 gi|186896767|ref|YP_001873879.1| flagellar basal body P-ring protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|51590915|emb|CAH22571.1| Putative flagellar P-ring protein [Yersinia pseudotuberculosis IP
           32953]
 gi|186699793|gb|ACC90422.1| flagellar P-ring protein [Yersinia pseudotuberculosis PB1/+]
          Length = 391

 Score =  351 bits (901), Expect = 9e-95,   Method: Composition-based stats.
 Identities = 138/372 (37%), Positives = 206/372 (55%), Gaps = 11/372 (2%)

Query: 2   IFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSPF 61
           + +       L     +       +  +V +Q  R NQL+GY LVVGL G+GD      F
Sbjct: 25  LIKTRHCFVLLGLWLVLPTASAQPLGSLVDIQGVRGNQLVGYSLVVGLDGSGDK-NQVKF 83

Query: 62  TEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSLR 120
           T QSM ++L+  G+  P       KNVAAV ++A LPP    G  ID++++S+GDA SLR
Sbjct: 84  TGQSMANMLRQFGVQLPEKMDPKVKNVAAVAISATLPPGYGRGQSIDITVSSIGDAKSLR 143

Query: 121 GGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQ-SSSFMEGISTGGKIVNGAIVERELP 179
           GG L++T L GADG +YA+AQG+VVV G+  +G   SS      T G+I NGA +ER++P
Sbjct: 144 GGTLLLTQLRGADGEVYALAQGNVVVGGIKAEGDSGSSVTVNTPTVGRIPNGASIERQIP 203

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEAYDSRTVKVSKPTNID-L 238
             F+ +  ++L L+ P F +A  +A  +N      F    A A  +  V V+ P +    
Sbjct: 204 SDFQINNQVVLNLKRPSFKSANNVALALNRA----FGANTATAQSATNVMVNAPQDAGAR 259

Query: 239 TRLMSEVEMLTVET-DTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQVVQ 297
              MS +E + +   +   RV+ N RTGT+VIG+ V +    VS+GNLTV I E + V Q
Sbjct: 260 VAFMSLLEDVQINAGEQSPRVVFNARTGTVVIGEGVMVRAAAVSHGNLTVNIREQKNVSQ 319

Query: 298 PNAFSSNGSTVTQNNTDLKVSDNKG-SFSLIDAPDLNSLISGMNSIGLKTDGIISILQGI 356
           PN     G TVT   +D++V+  K     +     L S+++ +NS+G   D I++ILQ +
Sbjct: 320 PNPL-GGGKTVTTPESDIEVTKGKNQMVMVPAGTRLRSIVNTINSLGASPDDIMAILQAL 378

Query: 357 KAAGALQSEIII 368
             AGAL +E+++
Sbjct: 379 YEAGALDAELVV 390


>gi|319944131|ref|ZP_08018409.1| flagellar P-ring protein FlgI [Lautropia mirabilis ATCC 51599]
 gi|319742625|gb|EFV95034.1| flagellar P-ring protein FlgI [Lautropia mirabilis ATCC 51599]
          Length = 374

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 150/374 (40%), Positives = 215/374 (57%), Gaps = 7/374 (1%)

Query: 1   MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGLVVGLQGTGDSLRSSP 60
           MI R+      +  L         R+K+V S+Q  R NQL+GYGL+VGL GTGD    +P
Sbjct: 1   MITRLLAATCGVAALMGSLPAQAERLKEVASIQGVRTNQLLGYGLMVGLDGTGDQTTQAP 60

Query: 61  FTEQSMRSLLQNLGISTPGG-RLGSKNVAAVMVTANLPPFASPGSRIDVSINSLGDASSL 119
           FT QSM+SLLQ LGI  P G     KN AAV+VTA LP F+ PG  IDV+++S+G+A SL
Sbjct: 61  FTAQSMKSLLQQLGIQLPAGVTPQLKNSAAVIVTAQLPAFSQPGQLIDVTVSSVGNAKSL 120

Query: 120 RGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGISTGGKIVNGAIVERELP 179
           RGG L++T L G DG IYAVAQG+VVV G       S       + G+I  GA VER +P
Sbjct: 121 RGGTLLLTPLRGVDGEIYAVAQGNVVVGGAGTSAGGSKVQINHLSAGRIPGGATVERVVP 180

Query: 180 KKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRP--IAEAYDSRTVKVSKPTNI- 236
            +  +   + ++L   DFS    + D IN     R       A A D+R V+V  P +  
Sbjct: 181 NQTLEGDSIRVELNRTDFSDVRLVTDAINQKIRLRPGSDGRQAVAMDARVVQVPLPRDPA 240

Query: 237 DLTRLMSEVEMLTVE-TDTPARVIINERTGTIVIGDNVRISKVVVSYGNLTVQITENEQV 295
                ++E+E + V  T  PA+VI+N RTG++V+  +V ++   V++GNL+V ++    V
Sbjct: 241 QRVGFLAELESMEVALTAAPAKVIVNARTGSVVMNQSVALAPSAVAHGNLSVTVSSTPVV 300

Query: 296 VQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLID-APDLNSLISGMNSIGLKTDGIISILQ 354
            QP AF S G TV    +D+ V    G+  ++  +  L  L+  +NS+G     +I+ILQ
Sbjct: 301 SQPGAF-SGGQTVAGQVSDITVRQEGGAVMMLPKSAQLKDLVRALNSLGATPQDLIAILQ 359

Query: 355 GIKAAGALQSEIII 368
            ++AAG+L++E+ I
Sbjct: 360 ALQAAGSLKAELEI 373


>gi|16764537|ref|NP_460152.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56413832|ref|YP_150907.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|161614595|ref|YP_001588560.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167553031|ref|ZP_02346781.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167994045|ref|ZP_02575137.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168234107|ref|ZP_02659165.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168237264|ref|ZP_02662322.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168244780|ref|ZP_02669712.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168264026|ref|ZP_02685999.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168467134|ref|ZP_02700976.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168822625|ref|ZP_02834625.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194444645|ref|YP_002040435.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194447462|ref|YP_002045180.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194471002|ref|ZP_03076986.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194737316|ref|YP_002114180.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197248292|ref|YP_002146862.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197263092|ref|ZP_03163166.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197362755|ref|YP_002142392.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|198243836|ref|YP_002215956.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200390977|ref|ZP_03217588.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204930847|ref|ZP_03221720.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|207857311|ref|YP_002243962.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213051796|ref|ZP_03344674.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213424684|ref|ZP_03357449.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213648930|ref|ZP_03378983.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213865501|ref|ZP_03387620.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|238910999|ref|ZP_04654836.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289828577|ref|ZP_06546402.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|120302|sp|P15930|FLGI_SALTY RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|62286732|sp|Q5PGU7|FLGI_SALPA RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|189044487|sp|A9N5M7|FLGI_SALPB RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|226701956|sp|B5F926|FLGI_SALA4 RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|226701957|sp|B5FKC5|FLGI_SALDC RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|226701958|sp|B5QXY4|FLGI_SALEP RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|226701959|sp|B4TEV3|FLGI_SALHS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|226701960|sp|B4T313|FLGI_SALNS RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|226701961|sp|B5BAJ3|FLGI_SALPK RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|226701962|sp|B4TTE5|FLGI_SALSV RecName: Full=Flagellar P-ring protein; AltName: Full=Basal body
           P-ring protein; Flags: Precursor
 gi|153974|gb|AAA27069.1| flgI flagellar P-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Typhimurium]
 gi|16419698|gb|AAL20111.1| putative flagella basal body protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56128089|gb|AAV77595.1| flagellar P-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|161363959|gb|ABX67727.1| hypothetical protein SPAB_02345 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403308|gb|ACF63530.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194405766|gb|ACF65985.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194457366|gb|EDX46205.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194712818|gb|ACF92039.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195630288|gb|EDX48914.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197094232|emb|CAR59737.1| flagellar P-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197211995|gb|ACH49392.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197241347|gb|EDY23967.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197289852|gb|EDY29213.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197938352|gb|ACH75685.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199603422|gb|EDZ01968.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204320306|gb|EDZ05510.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205322428|gb|EDZ10267.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205328058|gb|EDZ14822.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205331929|gb|EDZ18693.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205336427|gb|EDZ23191.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205340996|gb|EDZ27760.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205347390|gb|EDZ34021.1| flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206709114|emb|CAR33447.1| flagellar P-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261246392|emb|CBG24201.1| Basal body P-ring protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992955|gb|ACY87840.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157722|emb|CBW17214.1| Flagellar P-ring protein precursor [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912168|dbj|BAJ36142.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321223799|gb|EFX48862.1| Flagellar P-ring protein FlgI [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322616551|gb|EFY13460.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620508|gb|EFY17372.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622502|gb|EFY19347.1| flagellar basal body P-ring protein [Salmonella enterica subsp.
           enteri