RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780377|ref|YP_003064790.1| flagellar basal body P-ring biosynthesis protein FlgA [Candidatus Liberibacter asiaticus str. psy62] (152 letters) >gnl|CDD|31453 COG1261, FlgA, Flagellar basal body P-ring biosynthesis protein [Cell motility and secretion / Posttranslational modification, protein turnover, chaperones]. Length = 220 Score = 101 bits (252), Expect = 1e-22 Identities = 41/129 (31%), Positives = 71/129 (55%) Query: 21 FASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDH 80 G VV + I GE ++ + +K + + Y +VVG V++R LLP Sbjct: 90 AVQAPGEVVVAARTIYRGEKISAADVKLKRGDLDALPPGYVLDPDEVVGKVSKRTLLPGQ 149 Query: 81 VIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGS 140 I S+L + +++ RG V ++ G ++I+ G AL + ++G+VI V+N+ +G +VSG+ Sbjct: 150 PILASMLRQAWLVKRGQIVTVVAEGGGISITAEGKALENGAVGEVIRVRNVSSGKIVSGT 209 Query: 141 VVDTGTVRV 149 V GTV+V Sbjct: 210 VDGDGTVQV 218 >gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types. Length = 292 Score = 28.1 bits (62), Expect = 1.1 Identities = 10/28 (35%), Positives = 16/28 (57%) Query: 117 LSDASIGDVIAVKNIDTGVMVSGSVVDT 144 L D + G V KN +TG + + V++T Sbjct: 20 LGDGAFGKVYKAKNKETGALAAAKVIET 47 >gnl|CDD|107378 cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. AMPA receptors consist of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important roles in mediating the rapid excitatory synaptic current. Length = 368 Score = 27.8 bits (62), Expect = 1.3 Identities = 12/65 (18%), Positives = 21/65 (32%), Gaps = 10/65 (15%) Query: 27 HAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLSV 86 H + I RL+ + + N I G+ I+ V+ D + Sbjct: 161 HVITIINSIIDEVREQIKRLRNLDIKNIFILGSTEEIIRYVL----------DQALAEGF 210 Query: 87 LHRPY 91 + R Y Sbjct: 211 MGRKY 215 >gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration. Length = 282 Score = 27.7 bits (61), Expect = 1.5 Identities = 11/28 (39%), Positives = 17/28 (60%) Query: 117 LSDASIGDVIAVKNIDTGVMVSGSVVDT 144 L D + G V +N +TGV+ + V+DT Sbjct: 13 LGDGAFGKVYKAQNKETGVLAAAKVIDT 40 >gnl|CDD|146199 pfam03443, Glyco_hydro_61, Glycosyl hydrolase family 61. Length = 234 Score = 26.9 bits (60), Expect = 2.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 10 FSLYVLSLDSLFASVIGHAVVPSVVIN 36 S +L+L +L A V H V +V+N Sbjct: 3 LSTILLALLALAALVAAHGHVTKIVVN 29 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.138 0.379 Gapped Lambda K H 0.267 0.0787 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,666,792 Number of extensions: 81258 Number of successful extensions: 230 Number of sequences better than 10.0: 1 Number of HSP's gapped: 230 Number of HSP's successfully gapped: 17 Length of query: 152 Length of database: 6,263,737 Length adjustment: 85 Effective length of query: 67 Effective length of database: 4,426,972 Effective search space: 296607124 Effective search space used: 296607124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 53 (24.1 bits)