RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780377|ref|YP_003064790.1| flagellar basal body P-ring biosynthesis protein FlgA [Candidatus Liberibacter asiaticus str. psy62] (152 letters) >3frn_A Flagellar protein FLGA; structural genomics, periplasmic, PSI-2, protein structure initiative; 2.05A {Thermotoga maritima} (A:208-278) Length = 71 Score = 61.7 bits (150), Expect = 4e-11 Identities = 11/59 (18%), Positives = 28/59 (47%) Query: 92 VISRGAKVRIILTQGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGSVVDTGTVRVV 150 + +G V + G++ ++T L + +G+ + N+++ V G V +R++ Sbjct: 2 DVVKGQVVPAYVDMGSIKVTTFVEVLENGYLGETVRAMNVESRKYVFGRVERGPVLRIL 60 >3frn_A Flagellar protein FLGA; structural genomics, periplasmic, PSI-2, protein structure initiative; 2.05A {Thermotoga maritima} (A:1-207) Length = 207 Score = 40.0 bits (93), Expect = 2e-04 Identities = 17/69 (24%), Positives = 30/69 (43%) Query: 22 ASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHV 81 + VV IN G+V+ E ++ + I G + +VVG ++RR L V Sbjct: 139 LRKERNVVVLKRNINVGDVIKEEDVRLEKRNVFEIYGEPFFDVSEVVGKISRRYLKEGTV 198 Query: 82 IPLSVLHRP 90 + ++ P Sbjct: 199 LTADMVKDP 207 >2vtc_A CEL61B, cellulase; hydrolase, glycoside; HET: NAG; 1.6A {Hypocrea jecorina} (A:) Length = 249 Score = 28.4 bits (63), Expect = 0.47 Identities = 9/28 (32%), Positives = 13/28 (46%) Query: 9 FFSLYVLSLDSLFASVIGHAVVPSVVIN 36 + +L L SV+GH V + IN Sbjct: 2 KSCAILAALGCLAGSVLGHGQVQNFTIN 29 >1qqp_1 FMDV, protein (genome polyprotein); heparan sulphate, virus-receptor interactions/protein-carbohydrate interactions; HET: IDX SGN IDS; 1.90A {Foot-and-mouth disease virus} (1:) Length = 213 Score = 24.6 bits (53), Expect = 7.1 Identities = 8/35 (22%), Positives = 11/35 (31%), Gaps = 2/35 (5%) Query: 28 AVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAH 62 V + V N G R + V S I + Sbjct: 9 DPVTTTVENYGGETQIQRRQHTDV--SFIMDRFVK 41 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.323 0.138 0.379 Gapped Lambda K H 0.267 0.0676 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,042,868 Number of extensions: 40363 Number of successful extensions: 110 Number of sequences better than 10.0: 1 Number of HSP's gapped: 110 Number of HSP's successfully gapped: 11 Length of query: 152 Length of database: 4,956,049 Length adjustment: 81 Effective length of query: 71 Effective length of database: 2,217,844 Effective search space: 157466924 Effective search space used: 157466924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (23.5 bits)