HHsearch alignment for GI: 254780378 and conserved domain: PRK06802

>PRK06802 flgC flagellar basal body rod protein FlgC; Reviewed.
Probab=99.75  E-value=1.6e-17  Score=126.00  Aligned_cols=45  Identities=33%  Similarity=0.616  Sum_probs=42.9

Q ss_pred             ECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             073001023499999999999999999999999999999998715
Q gi|254780378|r  217 QGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKM  261 (262)
Q Consensus       217 qG~LE~SNVd~~~Emv~lI~~qR~ye~n~k~i~t~Dem~~~~~~l  261 (262)
T Consensus        94 ~GyV~~PnVn~~~EMvdm~~AsRsYeANv~~~~~aK~m~~~aL~I  138 (141)
T PRK06802         94 QGYVFYPDVNVVSEMADMMSASRSFETNVEVLNSVKSMQQSLLKL  138 (141)
T ss_pred             CCCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             988846898989999999999999999999999999999999986