HHsearch alignment for GI: 254780378 and conserved domain: PRK07191

>PRK07191 flgK flagellar hook-associated protein FlgK; Validated.
Probab=99.60  E-value=1.3e-15  Score=114.27  Aligned_cols=66  Identities=32%  Similarity=0.457  Sum_probs=49.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             90489999999999996599977542177734000022299999876402567665556654566631144202112322
Q gi|254780378|r    1 MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQISSVRN   80 (262)
Q Consensus         1 lr~ly~a~sgm~a~~~~l~~isnNlAN~nT~GfK~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~gv~~~~~~~   80 (262)
T Consensus         1 m~~ln~a~SgL~a~q~al~vts~NIANanT~GYsRq~v~~~~~~~----------------~~~~~~~~G~GV~v~~I~R   64 (456)
T PRK07191          1 MNFIRTAFSGMQAAQAHLNATSMNIANMHTPGYSRQGVEQSAIGA----------------DGQGGVNAGNGVNVDGIRR   64 (456)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCC----------------CCCCCCCCCCCEEEEEEEE
T ss_conf             975789999999999999999885743899891503667642357----------------7778875567779837887


Q ss_pred             CC
Q ss_conf             33
Q gi|254780378|r   81 VY   82 (262)
Q Consensus        81 ~~   82 (262)
T Consensus        65 ~~   66 (456)
T PRK07191         65 LS   66 (456)
T ss_pred             HH
T ss_conf             05