HHsearch alignment for GI: 254780378 and conserved domain: PRK08471

>PRK08471 flgK flagellar hook-associated protein FlgK; Validated.
Probab=99.02  E-value=2.4e-10  Score=82.30  Aligned_cols=42  Identities=24%  Similarity=0.423  Sum_probs=40.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             010234999999999999999999999999999999987159
Q gi|254780378|r  221 EASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR  262 (262)
Q Consensus       221 E~SNVd~~~Emv~lI~~qR~ye~n~k~i~t~Dem~~~~~~lr  262 (262)
T Consensus       570 svSGVnlDEE~~nLik~QqaY~AsArvista~em~dtLL~i~  611 (612)
T PRK08471        570 SISGVSTDEELTNLIKFQSSYGAAAKIITTVDQMLDTLLGIK  611 (612)
T ss_pred             HHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             510603999999999999999999999999999999998244