HHsearch alignment for GI: 254780378 and conserved domain: PRK12625

>PRK12625 flgB flagellar basal body rod protein FlgB; Provisional.
Probab=98.85  E-value=9.3e-09  Score=72.70  Aligned_cols=44  Identities=25%  Similarity=0.384  Sum_probs=38.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHH
Q ss_conf             48999999999999659997754217773400002229999987
Q gi|254780378|r    3 AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQ   46 (262)
Q Consensus         3 ~ly~a~sgm~a~~~~l~~isnNlAN~nT~GfK~~~~~f~~~~~~   46 (262)
T Consensus         8 ~~~~~~~aL~~~~~Rq~via~NIANadTPgYKa~dl~Fe~~L~~   51 (132)
T PRK12625          8 ALGVHQYTLGIRAQRAEVISSNIANADTPHYKARDVDFSAAMQA   51 (132)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHH
T ss_conf             86178999999999999998714306899988653889999999