HHsearch alignment for GI: 254780378 and conserved domain: PRK12641

>PRK12641 flgF flagellar basal body rod protein FlgF; Reviewed.
Probab=100.00  E-value=0  Score=427.25  Aligned_cols=239  Identities=23%  Similarity=0.313  Sum_probs=191.7

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             90489999999999996599977542177734000022299999876402567665556654566631144202112322
Q gi|254780378|r    1 MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQISSVRN   80 (262)
Q Consensus         1 lr~ly~a~sgm~a~~~~l~~isnNlAN~nT~GfK~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~gv~~~~~~~   80 (262)
T Consensus         2 ~r~lY~a~sgm~a~q~~ldvisNNLANvnT~GfK~~~~~~~~~~~~~~~-----~--------------~~~~~~~~~~~   62 (252)
T PRK12641          2 ESIIYASMTAANKLLEKQARIANNLANISTPGFKEEFELKILLPNQKNL-----N--------------SQEDNFLKEYY   62 (252)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCC-----C--------------CCCCCCCCCEE
T ss_conf             3589999999999999889999999878776550638988764421345-----6--------------66653243212


Q ss_pred             CCCCCCCCCCCCEEEEEECCCCEEEEECCCCCEEEEEEEEEEECCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCE
Q ss_conf             33578733265212123237752653148985778752122352588341466761044---310135653221013312
Q gi|254780378|r   81 VYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVP---GIVIPEETREIKVSRSGQ  157 (262)
Q Consensus        81 ~~~qG~l~~Tg~~lD~Ai~G~Gff~V~~~~G~~~yTR~G~f~~d~~G~Lvt~~G~~vl~---~~~~p~~~~~i~i~~dG~  157 (262)
T Consensus        63 ~~~qG~l~~Tg~~lDlAI~G~GfF~v~~~~G~~~YTR~G~F~ld~~G~L~~~-~~~vl~~~g~i~~p~~-~~~~i~~dG~  140 (252)
T PRK12641         63 NKNPGTLRRTNRNLDLIIKKNGWLVIKDDNGQEAYTKNGHFKINSNRKLTVQ-NHEVIGNNGNIFIPKN-ENLKISSNGY  140 (252)
T ss_pred             ECCCCCEECCCCCEEEEECCCCEEEEECCCCCEEEEECCCEEECCCCCEEEC-CCEEECCCCCEECCCC-CCEEECCCCE
T ss_conf             1487461016981028985897699977999678997254789899988979-9715178987027999-7268889955


Q ss_pred             EEECCCCCC--CCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             552158865--43222110000026620010068864334666655--20002467762068607300102349999999
Q gi|254780378|r  158 ILAVTGKNS--DFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGD--PIISNPDDIGFAHVKQGYLEASNVDAVKEISE  233 (262)
Q Consensus       158 I~~~~~~~~--~~~~i~~i~l~~f~n~~~L~~~g~~l~~~~~~~g~--~~~~~~~~~~~~~v~qG~LE~SNVd~~~Emv~  233 (262)
T Consensus       141 i~~~~~~~~~~~~~~vg~l~~~~~~~~~l~~~~~-g~~~~~~~~~~~~~~~~~~~~~~~~~v~qG~LE~SNVd~~~EM~~  219 (252)
T PRK12641        141 INIIKNNHKHILEHKIGSLKLVNLDINDLIQKEN-GLFYLKKNNKLNHTNHKNIKHSSNIRLQSGMLEDSNVNLEKNMIE  219 (252)
T ss_pred             EEEECCCCCCCCCEEEEEEEEEECCCHHHHHCCC-CCEECCCCCCCCCCCCCCCCCCCCCEEEECCEECCCCCHHHHHHH
T ss_conf             9994079875432155369997047533321578-832415776556666777777877248626400244669999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999999999999999999998715
Q gi|254780378|r  234 MISAQRAYEMNSKVIEAADEMSSLITKM  261 (262)
Q Consensus       234 lI~~qR~ye~n~k~i~t~Dem~~~~~~l  261 (262)
T Consensus       220 lI~~qRaye~n~K~i~~~Dem~~~an~L  247 (252)
T PRK12641        220 MISNARQFEMQMKIISMCDQNTEYANQL  247 (252)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999987