HHsearch alignment for GI: 254780378 and conserved domain: PRK12714

>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional.
Probab=98.90  E-value=1e-09  Score=78.48  Aligned_cols=66  Identities=35%  Similarity=0.513  Sum_probs=48.4

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             90489999999999996599977542177734000022299999876402567665556654566631144202112322
Q gi|254780378|r    1 MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQISSVRN   80 (262)
Q Consensus         1 lr~ly~a~sgm~a~~~~l~~isnNlAN~nT~GfK~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~gv~~~~~~~   80 (262)
T Consensus         1 msll~ig~sgL~a~Q~al~vt~~NIAN~nT~GYsRq~v~~~~~~---------~~~-------~~~~~~G~Gv~v~~i~R   64 (624)
T PRK12714          1 MSIMSTGTSALIAFQRALSTVSHNVANINTEGYSRQRVEFATRT---------PTD-------MGYAFVGNGAKITDVGR   64 (624)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCC---------CCC-------CCCCCCCCCEEEEEEEE
T ss_conf             97178999999999999998847565168998031277875136---------755-------67864105789737998


Q ss_pred             CC
Q ss_conf             33
Q gi|254780378|r   81 VY   82 (262)
Q Consensus        81 ~~   82 (262)
T Consensus        65 ~~   66 (624)
T PRK12714         65 VA   66 (624)
T ss_pred             HH
T ss_conf             26