HHsearch alignment for GI: 254780378 and conserved domain: PRK12782

>PRK12782 flgC flagellar basal body rod protein FlgC; Reviewed.
Probab=99.73  E-value=2.8e-17  Score=124.49  Aligned_cols=45  Identities=36%  Similarity=0.603  Sum_probs=42.3

Q ss_pred             ECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             073001023499999999999999999999999999999998715
Q gi|254780378|r  217 QGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKM  261 (262)
Q Consensus       217 qG~LE~SNVd~~~Emv~lI~~qR~ye~n~k~i~t~Dem~~~~~~l  261 (262)
T Consensus        91 ~GyV~~pnVn~~~EMvdm~~AsRsYeANv~v~~tak~m~~~tL~i  135 (138)
T PRK12782         91 NGYVKLPNVNMLIEMADMREANRSYEANLQVIKQARAMVSMTIDL  135 (138)
T ss_pred             CCCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             788546898889999999999999999999999999999999998