BLAST/PSIBLAST alignment of GI: 254780378 and GI: 163758015 at iteration 1
>gi|163758015|ref|ZP_02165103.1| flagellar basal-body rod protein [Hoeflea phototrophica DFL-43] Length = 262
>gi|162284304|gb|EDQ34587.1| flagellar basal-body rod protein [Hoeflea phototrophica DFL-43] Length = 262
 Score =  340 bits (873), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 161/260 (61%), Positives = 204/260 (78%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQQ NLE+IANN+ANINTTG+KRARAEFAD LYQ E+  G P+ S ++
Sbjct: 1   MKALAIAATGMNAQQLNLEVIANNVANINTTGFKRARAEFADLLYQVERNQGVPNAS-NQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG  IG GVQ S+VRN++ QG +V T N  DLALVGRGWFQ+ETPD    YTRAG+
Sbjct: 60  AIVPEGAHIGLGVQTSAVRNLHIQGSLVGTSNKFDLALVGRGWFQIETPDGETNYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ G+LVT DG T+VPGIV P+E  E+ +SR+GQ+ A  G  ++ Q +GQL +ANF+
Sbjct: 120 FNTNADGELVTIDGYTVVPGIVFPDEASEVVISRTGQVFARIGNEAEMQELGQLTLANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +GDNL   T+ SG   +  PDD GFAH++QGYLE SNVD +KEI+++ISAQRA
Sbjct: 180 NEAGLEPLGDNLFRETTASGPANVGVPDDPGFAHIQQGYLEGSNVDPIKEITDLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSK+I+AADEM+S ++K
Sbjct: 240 YEMNSKIIQAADEMASTVSK 259