BLAST/PSIBLAST alignment of GI: 254780378 and GI: 325291939 at iteration 1
>gi|325291939|ref|YP_004277803.1| flagellar basal body rod protein FlgG [Agrobacterium sp. H13-3] Length = 262
>gi|325059792|gb|ADY63483.1| flagellar basal body rod protein FlgG [Agrobacterium sp. H13-3] Length = 262
 Score =  328 bits (842), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 152/260 (58%), Positives = 205/260 (78%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM AQQTNLE+IANNIANINTTGYKRARAEF D LYQ E++ G P++ A++
Sbjct: 1   MRALAIAATGMDAQQTNLEVIANNIANINTTGYKRARAEFTDLLYQTERMQGVPNR-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG +IG GVQ S+VRN++TQG ++ TGN LD+A++G+GWFQ+E  D + +Y+RAG+
Sbjct: 60  AIVPEGANIGLGVQTSAVRNIHTQGNLIETGNKLDVAIIGQGWFQIEAADGSTLYSRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ G LVT DG  ++P I IP + ++I ++R+GQ+ A  G  +DF  +GQL IANF 
Sbjct: 120 FNKNADGNLVTVDGYNVIPNINIPTDAQDITITRTGQVTARIGNAADFTELGQLTIANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL+ +GDNL ++T  SG  +I  PDD  + ++KQ YLE SNVDAVKEI+++I+AQRA
Sbjct: 180 NEAGLKPLGDNLFSQTPASGAAVIGVPDDPSYGYIKQSYLEGSNVDAVKEITDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKVI  ADEM+S+++K
Sbjct: 240 YEMNSKVITTADEMASIVSK 259